Psyllid ID: psy5696


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MLNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED
ccccccccccccccEEEEccccccccccccccEEEEEEcccEEEEEEccccccccccEEEEEEEEEEEcccccccEEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEEcccc
cccHccccccccccEEEEEEccccccccccccEEEEEccccEEEEEEccccccccccEEEEEEEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEcccc
mlnwlarpepqsTIVTILTMYnismpslppeniacssvtSTTLKITWETVPNEARNGIIQGYKVVyypaedwyeslesdtkdtsSLSASLQGLGKFTNYSIQVMAFtqagdgtlsdVIFCRTLED
mlnwlarpepqSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITwetvpnearngiIQGYKVVYYPAEDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTqagdgtlsDVIFCRTLED
MLNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED
************TIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESL*************LQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRT***
MLNWLA*PEPQSTIVTILTMYNI*MPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAED***********TSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVI*CRTLE*
MLNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYES************ASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED
********EPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.928 0.055 0.391 6e-20
Q8VHZ8 2013 Down syndrome cell adhesi yes N/A 0.912 0.056 0.440 4e-19
Q9ERC8 2013 Down syndrome cell adhesi yes N/A 0.912 0.056 0.440 4e-19
O60469 2012 Down syndrome cell adhesi yes N/A 0.912 0.056 0.440 5e-19
Q4VA61 2053 Down syndrome cell adhesi no N/A 0.888 0.054 0.394 5e-17
Q8TD84 2053 Down syndrome cell adhesi no N/A 0.888 0.054 0.394 6e-17
Q8AV58 2169 Protein sidekick-1 OS=Gal no N/A 0.8 0.046 0.372 2e-14
Q58EX2 2172 Protein sidekick-2 OS=Hom no N/A 0.824 0.047 0.389 3e-14
Q3UH53 2193 Protein sidekick-1 OS=Mus no N/A 0.816 0.046 0.407 3e-14
Q7Z5N4 2213 Protein sidekick-1 OS=Hom no N/A 0.816 0.046 0.388 1e-13
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 78/120 (65%), Gaps = 4/120 (3%)

Query: 8    PEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYY 67
            P P S      TM ++  PS PPE++ C++++S +L+++W+  P    NG++QGYK+++ 
Sbjct: 1094 PGPLSEPTAAQTMEDV--PSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFE 1151

Query: 68   PAEDWYE--SLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125
            P  D  +    E +++ T++L+  L GL K+TNYSIQV+A T+ GDG +S  +FC + ED
Sbjct: 1152 PIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEED 1211




Cell adhesion molecule.
Drosophila melanogaster (taxid: 7227)
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function description
>sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus GN=SDK1 PE=2 SV=1 Back     alignment and function description
>sp|Q58EX2|SDK2_HUMAN Protein sidekick-2 OS=Homo sapiens GN=SDK2 PE=1 SV=3 Back     alignment and function description
>sp|Q3UH53|SDK1_MOUSE Protein sidekick-1 OS=Mus musculus GN=Sdk1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z5N4|SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens GN=SDK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
328711868 1948 PREDICTED: Down syndrome cell adhesion m 0.912 0.058 0.474 4e-23
328711870 1925 PREDICTED: Down syndrome cell adhesion m 0.912 0.059 0.474 4e-23
157135807 1870 down syndrome cell adhesion molecule [Ae 0.912 0.060 0.478 1e-22
270009930 1348 hypothetical protein TcasGA2_TC009254 [T 0.912 0.084 0.456 3e-22
189238865 1918 PREDICTED: similar to AGAP007092-PA [Tri 0.912 0.059 0.456 3e-22
147907437 1886 Dscam family member AbsCAM [Apis mellife 0.872 0.057 0.459 4e-22
92380877 1919 Dscam family member AbsCAM-Ig7A [Apis me 0.872 0.056 0.459 4e-22
380011235 1924 PREDICTED: Down syndrome cell adhesion m 0.872 0.056 0.459 4e-22
112732546 1923 cell adhesion molecule AbsCAM-Ig7B [Apis 0.872 0.056 0.459 4e-22
269115798 1587 Down syndrome cell adhesion molecule [Li 0.752 0.059 0.46 4e-22
>gi|328711868|ref|XP_001951010.2| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 2/116 (1%)

Query: 10   PQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPA 69
            P S  +T+ T  +  +P++PPE + C S+TS +++++W+      RNG IQG+KV Y PA
Sbjct: 1114 PFSKPITVQT--DEGIPTMPPEKLTCRSLTSQSIQVSWDLPLPTGRNGKIQGFKVSYQPA 1171

Query: 70   EDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125
            EDWYE  E +TK T+    ++Q L K+TNYSI V AFT  GDG  SD I+C+T ED
Sbjct: 1172 EDWYEKNEFETKITTIQYTTIQALLKYTNYSISVFAFTSKGDGVQSDPIYCKTEED 1227




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328711870|ref|XP_003244665.1| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157135807|ref|XP_001663602.1| down syndrome cell adhesion molecule [Aedes aegypti] gi|108870110|gb|EAT34335.1| AAEL013409-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270009930|gb|EFA06378.1| hypothetical protein TcasGA2_TC009254 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189238865|ref|XP_972891.2| PREDICTED: similar to AGAP007092-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|147907437|ref|NP_001035325.2| Dscam family member AbsCAM [Apis mellifera] Back     alignment and taxonomy information
>gi|92380877|dbj|BAE93381.1| Dscam family member AbsCAM-Ig7A [Apis mellifera] Back     alignment and taxonomy information
>gi|380011235|ref|XP_003689716.1| PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2-like [Apis florea] Back     alignment and taxonomy information
>gi|112732546|dbj|BAF03050.1| cell adhesion molecule AbsCAM-Ig7B [Apis mellifera] Back     alignment and taxonomy information
>gi|269115798|gb|ACZ26466.1| Down syndrome cell adhesion molecule [Litopenaeus vannamei] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.8 0.049 0.45 2.5e-19
UNIPROTKB|F1MKB9 1859 DSCAM "Uncharacterized protein 0.912 0.061 0.440 3.3e-18
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.912 0.056 0.440 3.7e-18
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.912 0.056 0.440 3.7e-18
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.912 0.056 0.440 4.7e-18
UNIPROTKB|F1SGT7 1656 F1SGT7 "Uncharacterized protei 0.912 0.068 0.416 9.9e-18
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.912 0.057 0.432 1.6e-17
ZFIN|ZDB-GENE-050310-7 2024 dscama "Down syndrome cell adh 0.944 0.058 0.4 2.1e-17
UNIPROTKB|E1BZF3 1870 E1BZF3 "Uncharacterized protei 0.888 0.059 0.394 2.4e-17
UNIPROTKB|F1N4K6 1886 DSCAML1 "Uncharacterized prote 0.888 0.058 0.394 2.4e-17
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 45/100 (45%), Positives = 67/100 (67%)

Query:    26 PSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSS 85
             PS PP + AC+++TS T+++ W + P E+ NG+I+ YKVVY P+++WY+  +   K T+S
Sbjct:  1120 PSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTAS 1179

Query:    86 LSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125
                 L GL K+TNY++QV+A T  GDG  S  I C+T  D
Sbjct:  1180 SDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPD 1219


GO:0005887 "integral to plasma membrane" evidence=ISM;ISS
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0008046 "axon guidance receptor activity" evidence=IMP;NAS
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
GO:0007413 "axonal fasciculation" evidence=IMP
GO:0006909 "phagocytosis" evidence=IMP
GO:0051635 "bacterial cell surface binding" evidence=IDA
GO:0048666 "neuron development" evidence=IMP
GO:0030424 "axon" evidence=IDA
GO:0070593 "dendrite self-avoidance" evidence=IMP;IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0030425 "dendrite" evidence=IDA
GO:0042802 "identical protein binding" evidence=IPI
GO:0021551 "central nervous system morphogenesis" evidence=IMP
GO:0048846 "axon extension involved in axon guidance" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
UNIPROTKB|F1MKB9 DSCAM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGT7 F1SGT7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050310-7 dscama "Down syndrome cell adhesion molecule a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZF3 E1BZF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K6 DSCAML1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-15
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-12
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-09
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 64.8 bits (158), Expect = 6e-15
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 29  PPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDTSSLSA 88
           PP N+  + VTST++ ++W   P E   G I GY V Y       +  E +    S  S 
Sbjct: 3   PPTNLRVTDVTSTSVTLSWT--PPEDDGGPITGYVVEYREKGSG-DWKEVEVTPGSETSY 59

Query: 89  SLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRT 122
           +L GL   T Y  +V A    G+   S+ +   T
Sbjct: 60  TLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG4221|consensus 1381 99.79
KOG3513|consensus 1051 99.76
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.64
KOG0196|consensus 996 99.59
KOG4221|consensus 1381 99.55
KOG3513|consensus 1051 99.51
cd0006393 FN3 Fibronectin type 3 domain; One of three types 99.27
KOG4222|consensus 1281 98.9
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.81
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 98.79
KOG4367|consensus 699 98.65
KOG0196|consensus 996 98.55
KOG4258|consensus1025 98.32
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.9
KOG4802|consensus 516 97.56
KOG4258|consensus 1025 96.96
KOG4222|consensus 1281 96.91
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 96.8
KOG4152|consensus830 96.17
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 95.4
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 94.59
PLN02533 427 probable purple acid phosphatase 93.21
KOG4152|consensus 830 92.05
KOG4228|consensus 1087 91.4
KOG4802|consensus 516 87.37
PF10179 300 DUF2369: Uncharacterised conserved protein (DUF236 87.0
KOG3834|consensus 462 84.51
PF1134480 DUF3146: Protein of unknown function (DUF3146); In 84.5
>KOG4221|consensus Back     alignment and domain information
Probab=99.79  E-value=2.2e-18  Score=122.28  Aligned_cols=120  Identities=28%  Similarity=0.431  Sum_probs=105.7

Q ss_pred             CcCCCCCCCCCCcEEEEceecCCCCCCCCcceEEEeecCCeEEEEEEecCCCCCCCeeeEEEEEEEECCCCCCcceeEec
Q psy5696           2 LNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTK   81 (125)
Q Consensus         2 ~~~~~g~~~~s~~~~~~t~~~~~~p~~~P~~~~~~~~~~~~~~l~W~~p~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~   81 (125)
                      +-|++|.|..|..+.++|..+  .|..||.++.+...+++++.|.|.+|+.+..++.+.+|+|.|++..... +.....+
T Consensus       593 A~N~~G~g~sS~~i~V~Tlsd--~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~-~~~~t~v  669 (1381)
T KOG4221|consen  593 AYNSAGSGVSSADITVRTLSD--VPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSRED-EVNETVV  669 (1381)
T ss_pred             EecCCCCCCCCCceEEEeccC--CCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCccc-ccceeec
Confidence            357899999999999999999  9999999999999999999999999987778999999999998654331 1334555


Q ss_pred             CCCcCeEEEcCCCCCCeEEEEEEEecCCCCCCCCccEEeeccC
Q psy5696          82 DTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLE  124 (125)
Q Consensus        82 ~~~~~~~~i~~L~p~~~y~v~v~a~~~~g~g~~s~~~~~~t~~  124 (125)
                      ..+.+++++.+|+|.+.|.|+|.|.+..|.|++|.++.+.|++
T Consensus       670 ~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~  712 (1381)
T KOG4221|consen  670 KGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPE  712 (1381)
T ss_pred             ccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCcc
Confidence            5678899999999999999999999999999999999999875



>KOG3513|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PF11344 DUF3146: Protein of unknown function (DUF3146); InterPro: IPR021492 This family of proteins with unknown function appear to be restricted to Cyanobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 1e-11
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 1e-09
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 7e-09
1x5g_A116 The Solution Structure Of The Second Fibronectin Ty 5e-08
2ed8_A106 Solution Structure Of The Second Fibronectin Type I 1e-07
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 1e-07
2edy_A103 Solution Structures Of The Fn3 Domain Of Human Rece 1e-06
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 2e-06
1uen_A125 Solution Structure Of The Third Fibronectin Iii Dom 8e-06
1wfn_A119 The Fourth Fn3 Domain Of Human Sidekick-2 Length = 3e-05
3d1m_C102 Crystal Structure Of Sonic Hedgehog Bound To The Th 4e-05
3n1g_C111 Crystal Structure Of Dhhn Bound To Bocfn3 Length = 9e-05
2ee2_A119 Solution Structures Of The Fn3 Domain Of Human Cont 1e-04
1x4y_A114 Solution Structure Of The 3rd Fibronectin Type Iii 1e-04
2x10_A545 Crystal Structure Of The Complete Epha2 Ectodomain 8e-04
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 5/113 (4%) Query: 16 TILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYP--AEDWY 73 TI S PS PP+ + C S+ STT++++W P ++RNG+I Y V Y ED Sbjct: 8 TIEARTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRG 67 Query: 74 ES-LESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125 ++ +++ SS L GL K+T Y + V A T G G S + RT ED Sbjct: 68 RHVVDGISREHSSW--DLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDED 118
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|1X5G|A Chain A, The Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Neogenin Length = 116 Back     alignment and structure
>pdb|2ED8|A Chain A, Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 106 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|1UEN|A Chain A, Solution Structure Of The Third Fibronectin Iii Domain Of Human Kiaa0343 Protein Length = 125 Back     alignment and structure
>pdb|1WFN|A Chain A, The Fourth Fn3 Domain Of Human Sidekick-2 Length = 119 Back     alignment and structure
>pdb|3D1M|C Chain C, Crystal Structure Of Sonic Hedgehog Bound To The Third Fniii Domain Of Cdo Length = 102 Back     alignment and structure
>pdb|3N1G|C Chain C, Crystal Structure Of Dhhn Bound To Bocfn3 Length = 111 Back     alignment and structure
>pdb|2EE2|A Chain A, Solution Structures Of The Fn3 Domain Of Human Contactin 1 Length = 119 Back     alignment and structure
>pdb|1X4Y|A Chain A, Solution Structure Of The 3rd Fibronectin Type Iii Domain From Mouse Biregional Cell Adhesion Molecule-RelatedDOWN- Regulated Oncogenes (Cdon) Binding Protein Length = 114 Back     alignment and structure
>pdb|2X10|A Chain A, Crystal Structure Of The Complete Epha2 Ectodomain Length = 545 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 9e-37
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 7e-35
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-34
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-32
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-32
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 7e-32
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 9e-32
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-31
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-31
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-30
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-30
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-29
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-28
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-27
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 7e-19
3p4l_A 211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-25
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-21
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-25
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-24
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-23
1cfb_A 205 Drosophila neuroglian; neural adhesion molecule; H 8e-09
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 4e-23
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 6e-13
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 6e-11
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 7e-23
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-22
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-22
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-22
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-22
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 5e-22
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-21
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-21
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-21
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-11
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-21
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-20
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-20
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-11
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-20
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-19
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-19
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-10
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-08
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 8e-08
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-18
2ibg_A 214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-08
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-18
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-17
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-17
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-13
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-12
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-09
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-08
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-17
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-16
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 5e-16
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-16
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 8e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-12
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-11
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 6e-15
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 7e-14
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 1e-12
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-12
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-14
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-13
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 7e-10
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 4e-14
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-14
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-14
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-09
3k2m_C101 Monobody HA4; engineered binding protein, antibody 6e-14
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 7e-14
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-13
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-12
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-13
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-11
1x4x_A106 Fibronectin type-III domain containing protein 3A; 5e-13
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-13
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-12
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 6e-11
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 8e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 8e-13
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-12
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-12
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-12
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-12
2vkw_A 209 Neural cell adhesion molecule 1,140 kDa isoform; a 6e-09
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-12
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-10
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-12
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 4e-12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 6e-12
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 7e-12
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-11
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-11
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-11
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 6e-11
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 7e-11
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 9e-11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-10
1bqu_A 215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-04
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 2e-10
1i1r_A 303 GP130, interleukin-6 receptor beta chain; cytokine 8e-04
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-10
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 5e-10
2ha1_A 201 Fibronectin; beta sandwich, protein-protein comple 9e-10
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-09
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-09
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 2e-09
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 4e-09
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-08
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-08
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-08
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 7e-08
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-07
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 5e-04
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-07
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-07
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-07
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 3e-07
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 3e-07
1x5x_A109 Fibronectin type-III domain containing protein 3A; 4e-07
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-07
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 5e-07
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-07
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 7e-07
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 1e-04
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 9e-07
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-06
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-06
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 4e-06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 4e-06
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 7e-06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 7e-06
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 8e-06
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 9e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-05
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 2e-05
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-05
2gys_A419 Cytokine receptor common beta chain; dimer of inte 3e-05
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 4e-05
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 8e-05
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 9e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 1e-04
3lqm_A 201 Interleukin-10 receptor subunit beta; IL-10R2, com 3e-04
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-04
3n06_B 210 PRL-R, prolactin receptor; PH dependence, hematopo 8e-04
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 2e-04
1eer_B227 Epobp, erythropoietin receptor; signal transductio 2e-04
1eer_B 227 Epobp, erythropoietin receptor; signal transductio 2e-04
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-04
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 4e-04
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 5e-04
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 6e-04
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
 Score =  120 bits (303), Expect = 9e-37
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 10  PQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPA 69
             +  +T++T+    +PS PP+N++   V S ++K++W   P+  +NG I GYK+ +   
Sbjct: 14  VSTDDITVVTLS--DVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKT 71

Query: 70  EDWYESLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125
               E     T + ++L     GL K + YS QV A T  G G  S+     T E+
Sbjct: 72  TRRGEME---TLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPEN 124


>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.93
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.93
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.92
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.91
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.91
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.9
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.9
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.9
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.88
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.88
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.87
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.87
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.86
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.86
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.86
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.86
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.86
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.85
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.85
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.85
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.85
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.85
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.84
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.84
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.84
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.84
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.83
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.83
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.82
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.82
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.81
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.81
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.81
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.8
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.8
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.78
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.78
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.78
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.78
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.78
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.77
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.77
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.76
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.76
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.76
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.76
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.75
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.75
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.75
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.74
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.74
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.73
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.72
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.72
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.72
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.72
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.71
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.7
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.7
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.7
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.69
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.69
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.69
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.68
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.68
3p4l_A 211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.68
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.67
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.67
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.67
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.67
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.66
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.66
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.66
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.66
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.64
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.64
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.64
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.64
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.63
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.63
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.62
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.62
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.62
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.61
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.61
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.59
1cfb_A 205 Drosophila neuroglian; neural adhesion molecule; H 99.59
3s98_A 306 Interferon alpha/beta receptor 1; human, type I in 99.59
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.59
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.59
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.58
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.58
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.58
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.57
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.57
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.57
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.56
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.54
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.54
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.53
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.53
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.53
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.53
2vkw_A 209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.52
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.52
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.52
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.51
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.51
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.49
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.49
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.48
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.48
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.47
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.47
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.47
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.46
2ibg_A 214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.45
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.45
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.44
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.43
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 99.43
2ha1_A 201 Fibronectin; beta sandwich, protein-protein comple 99.43
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.42
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.41
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.41
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.39
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.37
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.37
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.36
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.36
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.36
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.36
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.33
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 99.33
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.32
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.32
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 99.29
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 99.29
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.29
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 99.27
1bqu_A 215 Protein (GP130); cytokine receptor, glycoprotein 1 99.26
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 99.26
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.26
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.26
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.23
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.22
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 99.19
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 99.17
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 99.16
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.16
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.15
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.14
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.11
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.1
3n06_B 210 PRL-R, prolactin receptor; PH dependence, hematopo 99.08
1i1r_A 303 GP130, interleukin-6 receptor beta chain; cytokine 99.07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.03
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 98.98
3lqm_A 201 Interleukin-10 receptor subunit beta; IL-10R2, com 98.98
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.95
1cd9_B 215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 98.92
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 98.83
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.72
3g9v_A 211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.72
2d9q_B 313 Granulocyte colony-stimulating factor receptor; cy 98.62
4go6_B 232 HCF C-terminal chain 1; tandem fibronectin repeat, 98.61
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.55
4doh_R 221 Interleukin-20 receptor subunit alpha; IL10 family 98.52
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.48
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.42
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 98.42
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.18
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.12
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 97.98
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.95
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.78
1n26_A 325 IL-6 receptor alpha chain; transmembrane, glycopro 97.75
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 97.74
1axi_B 236 HGHBP, growth hormone receptor; complex (hormone-r 97.65
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 97.62
3og6_B 226 Interleukin 28 receptor, alpha (interferon, lambd 97.4
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.33
1y6k_R 214 Interleukin-10 receptor alpha chain; helix bundle, 97.28
3dlq_R 211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.08
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 96.94
4gns_A 290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 96.91
1fyh_B 229 Interferon-gamma receptor alpha chain; cytokine-re 96.87
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 96.77
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 96.73
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 96.68
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 96.5
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 96.49
1eer_B 227 Epobp, erythropoietin receptor; signal transductio 96.37
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 96.35
2hft_A 218 Human tissue factor; coagulation factor; 1.69A {Ho 96.05
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.72
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 92.75
3ott_A758 Two-component system sensor histidine kinase; beta 91.0
4a2l_A795 BT_4663, two-component system sensor histidine kin 88.73
3v9f_A781 Two-component system sensor histidine kinase/RESP 87.76
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 86.13
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 83.12
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 81.58
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=7.8e-25  Score=122.80  Aligned_cols=119  Identities=30%  Similarity=0.444  Sum_probs=103.1

Q ss_pred             CcCCCCCCCCCCcEEEEceecCCCCCCCCcceEEEeecCCeEEEEEEecCCCCCCCeeeEEEEEEEECCCCCCcceeEec
Q psy5696           2 LNWLARPEPQSTIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTK   81 (125)
Q Consensus         2 ~~~~~g~~~~s~~~~~~t~~~~~~p~~~P~~~~~~~~~~~~~~l~W~~p~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~   81 (125)
                      +.|..|.|+++..+.++|.++  +|..+|.++.+...+.+++.|.|.+|.....++.|.+|.|.|+..+...   .....
T Consensus         6 A~n~~G~g~~s~~~~~~T~~~--~P~~~P~~l~~~~~~~~sv~l~W~~p~~~~~~g~i~~Y~v~~~~~~~~~---~~~~~   80 (124)
T 2ed9_A            6 SGNRYGPGVSTDDITVVTLSD--VPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRG---EMETL   80 (124)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCC--CCSSCCBSCCEEEEETTEEEEECBCCCTTTCCSCCCEEEEEEEESSSSC---CEEEE
T ss_pred             EEeCCccCCCCCCEEEEcCCC--CCCCCCeeeEEEEcCCCEEEEEEECcCCcCCCcEEeEEEEEEEECCCCc---ceEEe
Confidence            467799999999999999998  8888898999988889999999999853337889999999999876542   22335


Q ss_pred             CCCcCeEEEcCCCCCCeEEEEEEEecCCCCCCCCccEEeeccCC
Q psy5696          82 DTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED  125 (125)
Q Consensus        82 ~~~~~~~~i~~L~p~~~y~v~v~a~~~~g~g~~s~~~~~~t~~~  125 (125)
                      ....+.+.|.+|+|++.|.|+|+|.|..|.|++|..+.++|.+|
T Consensus        81 ~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~~T~ed  124 (124)
T 2ed9_A           81 EPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPEN  124 (124)
T ss_dssp             CSSCSEEEEECCCSSCEEEECEEEECSSCBCCCCCCEEEECCCC
T ss_pred             cCCcCEEEEcCCCCCCEEEEEEEEEcCCccCCCCCCEEEECCCC
Confidence            66788999999999999999999999999999999999999986



>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 3e-18
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-17
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 1e-16
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 4e-16
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 4e-14
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 3e-13
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-13
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 7e-13
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-12
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 5e-12
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 6e-12
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-11
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-11
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 5e-10
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 5e-10
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 5e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 9e-10
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 1e-09
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-09
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 3e-09
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 5e-09
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 1e-08
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-08
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-07
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 2e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-07
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-07
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-07
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-07
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 6e-07
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 6e-07
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 7e-07
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 8e-07
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 8e-07
d2dtge2 196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-06
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 3e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 2e-06
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 2e-06
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 2e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-06
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-06
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 4e-06
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 5e-06
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 7e-06
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 7e-06
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 1e-05
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 1e-05
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-05
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 3e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 4e-05
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 4e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-04
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-04
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 2e-04
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 2e-04
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-04
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 2e-04
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 3e-04
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-04
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-04
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 7e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.002
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 0.003
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.6 bits (177), Expect = 3e-18
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 3/111 (2%)

Query: 15  VTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYE 74
           V + T+ ++  PS  P+N++     S ++ I W+      +NG I GYK+ Y  A    +
Sbjct: 2   VAVRTLSDV--PSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSD 59

Query: 75  SLESDTKDTSSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLED 125
                    + LS  ++GL + T Y+ +V A T  G G  +D +   T E 
Sbjct: 60  V-TETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFES 109


>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.88
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.86
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.84
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.84
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.83
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.83
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.83
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.82
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.82
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.82
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.81
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.81
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.81
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.8
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.79
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.78
d2crza197 Fibronectin type-III domain containing protein 3a, 99.77
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.76
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.76
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.76
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.75
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.74
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.74
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.74
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.73
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.73
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.73
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.73
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.72
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.72
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.72
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.71
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.71
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.7
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.69
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.69
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.69
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.68
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.68
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.68
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.68
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.67
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.67
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.67
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.67
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.67
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.65
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.64
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.64
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.64
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.63
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.63
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.62
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.62
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.62
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.61
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.61
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.61
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.6
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.59
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.58
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.57
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.54
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.43
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.42
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.37
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.36
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 99.02
d2dtge2 196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.84
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.55
d2c4fu1116 Extracellular region of human tissue factor {Human 98.23
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.81
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.67
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.35
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.92
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.86
d2hfta1106 Extracellular region of human tissue factor {Human 96.69
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 90.25
d2hyma2103 Interferon-alpha/beta receptor beta chain {Human ( 86.75
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=1e-23  Score=115.97  Aligned_cols=115  Identities=21%  Similarity=0.299  Sum_probs=95.6

Q ss_pred             CCCCCCCC-CcEEEEceecCCCCCCCCcceEEEeecCCeEEEEEEecCCCCCCCeeeEEEEEEEECCCCCCcceeEecCC
Q psy5696           5 LARPEPQS-TIVTILTMYNISMPSLPPENIACSSVTSTTLKITWETVPNEARNGIIQGYKVVYYPAEDWYESLESDTKDT   83 (125)
Q Consensus         5 ~~g~~~~s-~~~~~~t~~~~~~p~~~P~~~~~~~~~~~~~~l~W~~p~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~   83 (125)
                      ++|.|+++ .++.++|.++  +|. +|.++.+...+.+++.|.|.+|  ...++.|.+|.|.|+..+.............
T Consensus         1 ~~G~G~pss~~v~~~T~~~--~P~-~P~~~~~~~~~~~sv~v~W~~P--~~~~g~i~~Y~i~y~~~~~~~~~~~~~~~~~   75 (117)
T d1wfoa1           1 RIGDGSPSHPPILERTLDD--VPG-PPMGILFPEVRTTSVRLIWQPP--AAPNGIILAYQITHRLNTTTANTATVEVLAP   75 (117)
T ss_dssp             CCCCCCCCCCCSCCCCSCC--CCC-CCCCCEEEEECSSEEEEECCCC--SCCCSCCCEEEEEEEESSCCCSCCCEEEECT
T ss_pred             CccCCCCCCCCEEEECCCC--CCc-CCCCcEEEEecCCEEEEEEECC--CCCCCceEEEeeeeeeccCCCceEeEEecCC
Confidence            37889766 4678889888  885 8889999999999999999987  5567899999999987655432233455667


Q ss_pred             CcCeEEEcCCCCCCeEEEEEEEecCCCCCCCCccEEeeccC
Q psy5696          84 SSLSASLQGLGKFTNYSIQVMAFTQAGDGTLSDVIFCRTLE  124 (125)
Q Consensus        84 ~~~~~~i~~L~p~~~y~v~v~a~~~~g~g~~s~~~~~~t~~  124 (125)
                      ..+.+.|.+|+|++.|.|+|+|.|..|.|++|..+.++|.+
T Consensus        76 ~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~tT~e  116 (117)
T d1wfoa1          76 SARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEK  116 (117)
T ss_dssp             TCCEEEEESCCSSSEEEEEEEEECSSCEEEEEEEEEECCSS
T ss_pred             ceEEEEECCCCCCCEEEEEEEEECCCcCCCCcCCEEEECCC
Confidence            78899999999999999999999999999999988888875



>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma2 b.1.2.1 (A:110-212) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure