Psyllid ID: psy5806


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330--
MGDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHCPRGEEGPDERHCPKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFEGIQAG
cccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccEEEEEcccccEEEEEEEccccEEEEEEEEEEcccccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEccccccccEEEEEccccEEEEEEccccccEEEEEccccccEEEEEccccccEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEccEEEEEEccccEEEEEEccccccEEEEccccccccEEEEEEccccccccccccccccccEEEcccccEEEEcccccccccccccccccccEEEEEEEccEEEEEcccccccccEEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccccEEEEEcccccEEEEEccccEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEEcccEEEEEEccEEEEEcccccccccccccccccccccccEEEcccccEEEEcccccEEcccccccccccccEEEEEEEccEEEEEcccccccEEEEEccccccEEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEcccccccEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEccccccccccEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEccEEEEEEcccccEEEEEccccccEEEEccccccEEEEEEccccccccccccccccccccEEcccccEEEccccccccccccccccccccEEEEEEEEcEEEEEEccccccccEEEcccccccEEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEccccccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEccccccEEEEEEccccEEEEEEcccccccccccEEEEEccccccEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEccccccEEEEEcccccccccEEEEEEccccEEEEEEEccccccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccEEccccccccccccccccccc
ccccccHccccccccccccEEccccccEccccEEEcccccccccccHcccccccccccccccccEcccccEccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEccccccEEEEEEEccccEEEEEEEEEEccccccccEEEEEccccEEEEEccccEEEEEEccccEEEEEEEcccccccEEEEcccccEEEEEcccccccEEEEEccccccEEEEEcccccccEEEEEccccEEEEEEccccEEEEEEccccccEEEEEccccccEEEEEEccEEEEEEccccEEEEEEccccccEEEEEEcccccccEEEEcccccccccccccccccccEEEcccccEEEEcccccEEcccccEcccccccEEEEEccccEEEEEcccccccccEEEEccccEEEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEcccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEccccccccccEEccccEEEEcccccccccccccccccccccEcccccccEEEEcccccEEcccccEcccccccEEEEEccccEEEEEccccccccEEEEccccEEEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccccccccEEEEcccccccEEEEccccccccEEEEcccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEccEEEEEEccccEEEEEEccccccEEEEEccccccEEEEEccccccccccccccccccEEcccccccEEEcccccEEcccccEccccccccEEEEEcccEEEEEEcccccccccEEEccccccEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEEEccccccccEEEEEccccEEEEEccccEEEEEEcccccEEEEEEccccccEEEEcccccEEEEEEcccccccccccEEEEEccccccEEEEEcccccccEEEEEccccEEEEEEccccEEEEEEccccccEEEEcccccEEEEEcccHEEEcccEEEEEEccccEEEEEEcccccccEEEEEEEcccccccEEEEEccccccccccccccccccccEEEEccccccEEEEcccccccccccccccccc
MGDSVPVLWVGylqeipqykkcnrtgacipaqwqcdnefdcemgedemkcpqasppkkcspdehrcttghcilktwlcdgipdcslgederncnktcdaqkefscmklaeprptevgsnikyfplhtvraprkdcfskkylcdgkkhcprgeegpderhcpkrvslsnkKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTgmqsvgslsvdwvHDFVFWTDTAARRVEFcdldgknrkiliannidkpravivhprdafvfwtdwgktpkiervemdgsnrkviltenifwpngltidfeedRLYWTEAKHHfiessdldgsrRQQVItkglphpfgitlyEDFVFWTDWHTKSISSankytgrniktvhsglhfpmnirsyhphrqpnyqshcapkvcshiclpnkhrftcqcplgltlspdnkscsespEELLIYARQKDlrisqltepsptfetvlpvMNVKSVVAIAWESAndslywadvengeinrahingtFQYNVirhntkkpagvaidwrtnkLYWTESEYNWievsnldgtyptllfwqnlseprdiavnpiggimywcswgdlhkiemagmdgshrhilasdslknptglaidleNSRLYWANVGLKtieftnldgtRKQTLIALHHLKVMTKvvgltdidifhrrrskkthpcnennggcshlcliapkdgircvcpagnllredrrtcsenpskfllvsQTDKIRQISldveyrypivlplrqLKMVasvdvdtkneyiyWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKiywtdmnaqtimvsdidgknaKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEViwpsclaidysdnpklywvdtskhTIEYKTLATGRAKrayavqshpytlTVLDYYVYWTDVQhskiyrankydvkdivefaqvdrpwlvraaqnisfpnacgsnnggcshlclrnptnftcacptgillsadrrscfSRTREFLLYTSRFGVIRrisldtadllpvtlpfpeymssiffdyhyskNLIYFAdmrsgnlrtfdmsdstrikpiplmndtirdnFVIDWVANNIYYIDSQMHTINvarsdgqhkKILVNDLmeplaiavyprrgllfyshwglydnspttkiekvyldgsyrtvlveedlafpnELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISkvapyglsvrqspgKAFIVELYWTDWEAMSVVIAREksdtgqwdvHLIRSNQEDFLNIKAISaskqltwnpcaqdnggcshlcfykgrtkgyvcgcpddlepneecfegiqag
MGDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEfscmklaeprptevgsnikYFPLHTVRAPRKDCFSKKYLCDGKkhcprgeegpderhcpkrvslsnKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKIliannidkpravivhPRDAFvfwtdwgktpkiervemdgsnrkviltenifwpngltIDFEEDRLYWTEAKHHFiessdldgsrRQQVITKGLPHPFGITLYEDFVFWTDWHTKSIssankytgRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLtepsptfetvlpVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIrhntkkpagvaidWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHrrrskkthpcnennggcsHLCLIAPKDGIRCVCPAGNLlredrrtcsenpskfllvsqtdkirqisLDVEYRYPIVLplrqlkmvasvdvdtkneyiywsdisektiervrfdmtgrerlvvndlnrtesiavdaigrkiyWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKrayavqshpytlTVLDYYVYWTDVQHSKIyrankydvKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFllytsrfgvirrISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVapyglsvrqspgKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFEGIQAG
MGDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHCPRGEEGPDERHCPKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFEGIQAG
****VPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCE**********************RCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLA****TEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGK********************LSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDG*RRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTL*************LLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDL*************
*GDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHCPRGEEGPDERHCPKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRI*******LPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFE*****
MGDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMG********************RCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHC************PKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFEGIQAG
*******LWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHCPRGEEGPDERHCPKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEEC*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDSVPVLWVGYLQEIPQYKKCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNCNKTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDCFSKKYLCDGKKHCPRGEEGPDERHCPKRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNTHIVHTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPKVCSHICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLEPNEECFEGIQAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1332 2.2.26 [Sep-21-2011]
O75096 1905 Low-density lipoprotein r yes N/A 0.946 0.661 0.382 0.0
Q9QYP1 1905 Low-density lipoprotein r yes N/A 0.949 0.664 0.385 0.0
Q8VI56 1905 Low-density lipoprotein r yes N/A 0.948 0.663 0.387 0.0
O75581 1613 Low-density lipoprotein r no N/A 0.841 0.694 0.347 0.0
O88572 1613 Low-density lipoprotein r no N/A 0.841 0.694 0.345 0.0
Q91VN0 1614 Low-density lipoprotein r no N/A 0.838 0.692 0.336 0.0
O75197 1615 Low-density lipoprotein r no N/A 0.834 0.688 0.341 0.0
Q07954 4544 Prolow-density lipoprotei no N/A 0.933 0.273 0.302 1e-169
Q91ZX7 4545 Prolow-density lipoprotei no N/A 0.932 0.273 0.301 1e-168
P98157 4543 Low-density lipoprotein r no N/A 0.939 0.275 0.295 1e-167
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function desciption
 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1436 (38%), Positives = 794/1436 (55%), Gaps = 175/1436 (12%)

Query: 25   TGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCDGIPDC 84
            +G CI A W+CD + DC+   DE  C  +     C+ ++ RC +G C+  +W CDG  DC
Sbjct: 240  SGLCINAGWRCDGDADCDDQSDERNCTTS----MCTAEQFRCHSGRCVRLSWRCDGEDDC 295

Query: 85   SLGEDERNC----------------NKTCDAQKEF-------------SCMKLAEPRPTE 115
            +   DE NC                N  C  Q++              S  +   PR  E
Sbjct: 296  ADNSDEENCENTGSPQCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGE 355

Query: 116  VGSNIK----YFPLHTVR-APRKDCFSKKYL------------CDGKKHCPRG---EEG- 154
               N+           VR A +  C +   L            C  + +C +G    EG 
Sbjct: 356  ENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGA 415

Query: 155  ------------PDERHCP----------------KRVSLSNKKYTAIIRNLHNVLAVDY 186
                        PD R C                 ++V     +YT ++ NL N +A+D+
Sbjct: 416  FQCWCETGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDF 475

Query: 187  HYKKNLLVWN-----------------THIVHTGMQSVGSLSVDWVHDFVFWTDTAARRV 229
            H+++ L+ W+                   +V TG++S G L+VDWVHD ++WTD+   R+
Sbjct: 476  HHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRI 535

Query: 230  EFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTE 289
            E  +LDG +RK+L+  N++KPRA+ +HP +  ++WTDWG TP+IE   MDGS R++I   
Sbjct: 536  EVANLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADT 595

Query: 290  NIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYEDFVFW 349
            ++FWPNGLTID+   R+YW +AKHH IE ++LDGS R+ VI++GLPHPF IT++ED ++W
Sbjct: 596  HLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYW 655

Query: 350  TDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPK--VCSHICLP 407
            TDWHTKSI+SANK+TG+N + + + LHFPM+I + HP RQP  ++ C      C+H+CLP
Sbjct: 656  TDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLP 715

Query: 408  NKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDL-RISQLTEPSPTFETVLPVMNV 466
            +   +TC CP G      + +C++S ++ L++AR+ D+ RIS  TE     + V+P+ +V
Sbjct: 716  SGQNYTCACPTGFR-KISSHACAQSLDKFLLFARRMDIRRISFDTE--DLSDDVIPLADV 772

Query: 467  KSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYW 526
            +S VA+ W+S +D +YW DV    I+RA  +GT Q  V+  + + PAG+AIDW TNKLYW
Sbjct: 773  RSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYW 832

Query: 527  TESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMAGMDGS 586
            T++  + IEV+N DG+  T+L W+NL  PRDI V P+GG MYW  WG   KIE AGMD S
Sbjct: 833  TDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDAS 892

Query: 587  HRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLI----------- 635
             R ++ S +L  P GLAID  + RLYWA+ G+KTIEF  LDG++++ LI           
Sbjct: 893  GRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLT 952

Query: 636  -----------------------ALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGG 672
                                    L    +   +  L DI +FHRRR   + PC   NGG
Sbjct: 953  LYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGG 1012

Query: 673  CSHLCLIAPK-DGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPI 731
            CSHLCL +P   G  C CP G  L  D +TCS   + FL+ ++   IR +SLD+ Y   +
Sbjct: 1013 CSHLCLRSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADV 1072

Query: 732  VLPLR-QLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVD 790
            V+P+   +K   ++ VD +   +YWSD +   I R   D +  E ++   L  T+ +AVD
Sbjct: 1073 VVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVD 1132

Query: 791  AIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLT 850
            AIGRK+YWTD     I V ++DG   KVL W NL  PR+IV+++ +G M W DW      
Sbjct: 1133 AIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGE---- 1188

Query: 851  NNRIEMAHMDGTNRAVF-ETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKR 909
            N ++E + MDG++RAV     + WP+ L +D + + +L W D     IE   L       
Sbjct: 1189 NAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASS-QLLWADAHTERIEAADLNGANRHT 1247

Query: 910  AYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEFAQVDRPWL-----VRAAQ 964
              +   HPY LT+LD Y+YWTD Q   I+RA+K    +++   + + P L     V  AQ
Sbjct: 1248 LVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVI-LVRSNLPGLMDMQAVDRAQ 1306

Query: 965  NISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVI 1024
             + F N CGS NGGCSHLCL  P+ F+CACPTGI L  D ++C      +LL++SR G I
Sbjct: 1307 PLGF-NKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSR-GSI 1364

Query: 1025 RRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIP 1084
            RRISLDT+D   V +P PE  + I  DY      +Y+ D+    +R  D++ S     I 
Sbjct: 1365 RRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIG 1424

Query: 1085 LMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVND-LMEPLAIAVYPRRG 1143
                T  D   +DWVA N+Y+ D+  +TI  +R DG  +K+L+N+ L EP AIAV+PR+G
Sbjct: 1425 RGLKTT-DGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKG 1483

Query: 1144 LLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKR 1203
             LF++ WG        KIE+  LDGS R VL+  DL +PN L +D+  RR++W D+   R
Sbjct: 1484 YLFWTDWG-----HIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDR 1538

Query: 1204 IEYCDFFGRSRKIVISKVA-PYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQW 1262
            IE  D  G+ R++++S V+ P+ L+ +          +YWTDW+  S  I R    +G+ 
Sbjct: 1539 IESADLNGKLRQVLVSHVSHPFALTQQDR-------WIYWTDWQTKS--IQRVDKYSGR- 1588

Query: 1263 DVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDD 1318
            +   + +N E  ++I  +S  +Q   N C  +NGGC+HLCF   R   +VC CPD+
Sbjct: 1589 NKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCF--ARASDFVCACPDE 1642




Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes.
Homo sapiens (taxid: 9606)
>sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus GN=Lrp4 PE=1 SV=2 Back     alignment and function description
>sp|Q8VI56|LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus GN=Lrp4 PE=1 SV=3 Back     alignment and function description
>sp|O75581|LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens GN=LRP6 PE=1 SV=2 Back     alignment and function description
>sp|O88572|LRP6_MOUSE Low-density lipoprotein receptor-related protein 6 OS=Mus musculus GN=Lrp6 PE=1 SV=1 Back     alignment and function description
>sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus GN=Lrp5 PE=1 SV=3 Back     alignment and function description
>sp|O75197|LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens GN=LRP5 PE=1 SV=2 Back     alignment and function description
>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus GN=Lrp1 PE=1 SV=1 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1332
189236723 2041 PREDICTED: similar to AGAP000037-PA [Tri 0.958 0.625 0.410 0.0
270005136 2042 hypothetical protein TcasGA2_TC007146 [T 0.958 0.625 0.410 0.0
242021136 2101 low-density lipoprotein receptor, putati 0.947 0.600 0.411 0.0
345481629 1996 PREDICTED: low-density lipoprotein recep 0.942 0.629 0.401 0.0
357627556 1915 putative low-density lipoprotein recepto 0.950 0.661 0.394 0.0
195044271 2095 GH12853 [Drosophila grimshawi] gi|193901 0.957 0.608 0.380 0.0
321459730 1830 hypothetical protein DAPPUDRAFT_327801 [ 0.949 0.691 0.404 0.0
157127000 2036 low-density lipoprotein receptor (ldl) [ 0.948 0.620 0.388 0.0
327259681 1907 PREDICTED: low-density lipoprotein recep 0.950 0.663 0.395 0.0
363734400 1944 PREDICTED: low-density lipoprotein recep 0.950 0.651 0.388 0.0
>gi|189236723|ref|XP_001814959.1| PREDICTED: similar to AGAP000037-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1449 (41%), Positives = 839/1449 (57%), Gaps = 172/1449 (11%)

Query: 21   KCNRTGACIPAQWQCDNEFDCEMGEDEMKCPQASPPKKCSPDEHRCTTGHCILKTWLCD- 79
            KCN +G CIP +++CD + DCE  EDE  C   S  + CSPDEH C+ G CILKTW+CD 
Sbjct: 440  KCN-SGKCIPERYRCDKQQDCEEKEDEANC-DYSLARSCSPDEHTCSNGACILKTWVCDG 497

Query: 80   ---------------------------------------------GIPDCSLGEDERNCN 94
                                                         G  DC  GEDE  C 
Sbjct: 498  YNDCPQGEDESKCEIVCDESKFSCSGHGINDTATEFCISRKHVCDGKKDCPKGEDESGCP 557

Query: 95   KTCDAQKEFSCMKLAEPRPTEVGSNIKYFPLHTVRAPRKDC-------FSKKYLCDGKKH 147
               + +K  +C +L      +        P + + +    C       ++   +C    +
Sbjct: 558  TKRECEKHTNCTQLC-ITTVDGRKGCDCIPGYKIASDGITCEDINECLYATDPVCSQTCN 616

Query: 148  CPRGE----------EGPDERHCP----------------KRVSLSNKKYTAIIRNLHNV 181
              +G             PD R C                 ++VSLSN KYT I++ LHN 
Sbjct: 617  NTQGSFRCGCMTGYVLRPDLRTCKAIGDPPTLLFANRIDIRQVSLSNAKYTPILKGLHNA 676

Query: 182  LAVDYHYKKNLLVWN-----------------THIVHTGMQSVGSLSVDWVHDFVFWTDT 224
            +A+DYHY K L+ W+                 T I+  G+QS G +++DW+HD +FWTD+
Sbjct: 677  IALDYHYDKKLIFWSDVSMDVIRRATMNGTEITDIIKWGLQSPGGVALDWIHDLIFWTDS 736

Query: 225  AARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRK 284
              RR+E   LDGK+R I+  N+IDKPRA+ VHP +A+VFWTDWG  PKIER EMDGSNR+
Sbjct: 737  GTRRIEVASLDGKHRAIIAGNDIDKPRAITVHPGEAYVFWTDWGPNPKIERAEMDGSNRR 796

Query: 285  VILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKGLPHPFGITLYE 344
             I+ E++FWPNGLT+D+  +R+YW +AKH+ IE++  +G+ R++VI+KGLPHPF +T++E
Sbjct: 797  SIINESVFWPNGLTLDYTSNRIYWADAKHNVIETALFNGNDRRKVISKGLPHPFALTIFE 856

Query: 345  DFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAPK--VCS 402
            D ++WTDWHTKSIS+ANK TG  ++T+HS LHFPM+I SYHP RQP Y + C      C+
Sbjct: 857  DAIYWTDWHTKSISTANKATGAGLRTIHSHLHFPMDIHSYHPQRQPKYSNRCGGNNGGCA 916

Query: 403  HICLPNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSP-TFETVL 461
            H+CLPN+  +TC C +G  L  D KSC + PE+LLI+AR+KDLRI  L   +      V+
Sbjct: 917  HLCLPNRKSYTCVCRMGQKLKSDKKSC-QKPEKLLIFARKKDLRIKHLDNNAVHQHSLVI 975

Query: 462  PVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRT 521
            P+  VKS VAIAW+S +D ++W DVE   INRA  NG+ Q  ++  N   PAG+A+DW T
Sbjct: 976  PLDGVKSAVAIAWDSESDYIFWTDVERDTINRALWNGSNQEVIVYSNIVTPAGLALDWLT 1035

Query: 522  NKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGDLHKIEMA 581
            NK+YWT+++   IEV+  +G   +LL W NL +PRDI V+PIGG MYW  W +  KIE A
Sbjct: 1036 NKIYWTDADTTRIEVAKTNGEMRSLLVWDNLYKPRDIVVDPIGGYMYWSDWAETPKIERA 1095

Query: 582  GMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIA----- 636
             MDG+ R ++ S +L  P GLAID    ++YWA+ G K IE +N DG++++T+I      
Sbjct: 1096 AMDGTMRSVIVSSNLTWPNGLAIDHSAGKIYWADGGTKAIECSNFDGSKRKTIIGPELPH 1155

Query: 637  -----------------------------LHHLKVMTKVVGLTDIDIFHRRRSKKTHPCN 667
                                         L+   + + +  L D+ +FHR R     PC 
Sbjct: 1156 PFGLDVFENYIYWTDWRTLTIERANKNTGLNRTVLASDITDLMDVRVFHRNRKMIKTPCG 1215

Query: 668  ENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEY 727
              NGGC+HLCL+ PK+   C CP G  L ED +TC+  P  FL+++  + IRQISLDV Y
Sbjct: 1216 TKNGGCTHLCLLKPKNNHTCACPTGIKLEEDGKTCANGPINFLILAHRNVIRQISLDVPY 1275

Query: 728  RYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESI 787
               +VLPL  LK+V SVDVD K   IYW D +E  I++   D    + ++++ L   E I
Sbjct: 1276 IADVVLPLPPLKLVTSVDVDRKTGEIYWIDQAEDVIQKSTRDGQNSKLIIMHKLQTPEGI 1335

Query: 788  AVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRT 847
            AVD+ GRKIYWTD    ++ V+++DG N KVLF  NL  PR+I +HY  GLM W+DW + 
Sbjct: 1336 AVDSTGRKIYWTDGERNSVEVAELDGSNRKVLFSTNLDNPRAITLHYHHGLMFWSDWGKK 1395

Query: 848  RLTNNRIEMAHMDGTNRAVFETE-VIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGR 906
                 +IE+A MDGT R    T+ ++WP+ LAID     +LYW D   HTIE   L    
Sbjct: 1396 A----KIEVAQMDGTKRKALITDGLVWPNGLAIDRP-TERLYWNDAKLHTIESSDLKGHD 1450

Query: 907  AKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYDVKDIVEF-AQVDRPWLVRAAQN 965
             K       HPY L V+  ++YWTD Q   ++RA+K +  D  +   ++D    VR+ Q+
Sbjct: 1451 RKIIVTEAPHPYGLVVVGNHIYWTDWQTQALHRADKTNGTDKAKIREKLDGLMDVRSVQS 1510

Query: 966  ISFP-NACGSNNGGCSHLCLRNPTNFTCACPTGILLS-ADRRSCFSRTREFLLYTSRFGV 1023
             +   NACG NNGGCSHLCLRN   F+CACPTGI +S A+ + C  +   +LL  +RF  
Sbjct: 1511 DNIAENACGGNNGGCSHLCLRNSGGFSCACPTGIKMSKANPKVCEKQPSTYLLLATRF-A 1569

Query: 1024 IRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPI 1083
            + RISLDT DL  VTLP  +  + I  D+H+ K LIY+ D+ +  +++ +M + +  + I
Sbjct: 1570 LNRISLDTDDLWDVTLPIEDVNNVIDVDFHWEKRLIYYTDIGNNVIQSVNMFNLSDTRNI 1629

Query: 1084 PLMNDTIRDNFVIDWVANNIYYIDSQMHTINVARSDGQHKKILVN-DLMEPLAIAVYPRR 1142
               N +  D   +DWVANNIY+ ++    I VA+ DG ++K +V+ +L +P +IAV+PR+
Sbjct: 1630 VHSNLSSPDGIAVDWVANNIYWTNTGNKVIEVAKIDGSNRKTIVSTNLQDPRSIAVFPRK 1689

Query: 1143 GLLFYSHWGLYDNSPTTKIEKVYLDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADST-- 1200
            G L+++ WG        KIE+ +LDGS R +L+ E L+FP  LAIDF  +RL+W D+T  
Sbjct: 1690 GYLYWTDWG------KPKIERSFLDGSGRRILINEQLSFPIGLAIDFVDKRLYWIDATLN 1743

Query: 1201 NKRIEYCDFFGRSRKIV-ISKVAPYGLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDT 1259
             +RIE  D  GR+R ++ I +  P+ L+        F   +YWTDW  +   +AR    +
Sbjct: 1744 EERIETSDLHGRNRVVLDIPQTHPFSLT-------QFGEHIYWTDW--VHKTVARADKTS 1794

Query: 1260 GQWDVHLIRSNQEDFLNIKAISASKQLTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDL 1319
            G+ DV ++RS  E  + +  ++ S+Q  WNPCA +NGGC +LCF+K   K Y CGCP+D 
Sbjct: 1795 GK-DVVIVRSYLEAAMGVTMVTESRQTGWNPCAANNGGCPYLCFFK--QKNYTCGCPND- 1850

Query: 1320 EPNEECFEG 1328
              + +C EG
Sbjct: 1851 --HVKCVEG 1857




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270005136|gb|EFA01584.1| hypothetical protein TcasGA2_TC007146 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242021136|ref|XP_002431002.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212516226|gb|EEB18264.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345481629|ref|XP_001605666.2| PREDICTED: low-density lipoprotein receptor-related protein 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357627556|gb|EHJ77209.1| putative low-density lipoprotein receptor [Danaus plexippus] Back     alignment and taxonomy information
>gi|195044271|ref|XP_001991788.1| GH12853 [Drosophila grimshawi] gi|193901546|gb|EDW00413.1| GH12853 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|321459730|gb|EFX70780.1| hypothetical protein DAPPUDRAFT_327801 [Daphnia pulex] Back     alignment and taxonomy information
>gi|157127000|ref|XP_001661035.1| low-density lipoprotein receptor (ldl) [Aedes aegypti] gi|108873056|gb|EAT37281.1| AAEL010712-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|327259681|ref|XP_003214664.1| PREDICTED: low-density lipoprotein receptor-related protein 4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|363734400|ref|XP_421114.3| PREDICTED: low-density lipoprotein receptor-related protein 4 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1332
UNIPROTKB|F1ML31 1897 LRP4 "Uncharacterized protein" 0.611 0.429 0.362 2.8e-174
UNIPROTKB|F1SIB6 1898 LRP4 "Uncharacterized protein" 0.609 0.427 0.363 1.8e-172
UNIPROTKB|F1PXA0 1614 LRP5 "Uncharacterized protein" 0.349 0.288 0.412 8.8e-187
UNIPROTKB|F1N1K8 1611 LRP5 "Uncharacterized protein" 0.349 0.289 0.405 2.6e-185
RGD|1309329 1615 Lrp5 "low density lipoprotein 0.586 0.483 0.309 8.4e-116
MGI|MGI:1278315 1614 Lrp5 "low density lipoprotein 0.586 0.483 0.309 5e-116
UNIPROTKB|O75197 1615 LRP5 "Low-density lipoprotein 0.585 0.482 0.304 1.8e-104
UNIPROTKB|F1P1P9 1901 LRP4 "Uncharacterized protein" 0.611 0.428 0.363 4e-177
UNIPROTKB|J9P7Q4 1953 LRP4 "Uncharacterized protein" 0.623 0.425 0.358 1.3e-174
UNIPROTKB|F1PST3 1904 LRP4 "Uncharacterized protein" 0.623 0.436 0.358 2.2e-174
UNIPROTKB|F1ML31 LRP4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1398 (497.2 bits), Expect = 2.8e-174, Sum P(2) = 2.8e-174
 Identities = 311/859 (36%), Positives = 470/859 (54%)

Query:   456 TFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNTKKPAGV 515
             T + V+   +++S   +A + A + LYW D     I  A+ +G+ +  ++  N  +P  +
Sbjct:   797 TGQEVVVDTSLESPAGLAIDWATNKLYWTDAGTDRIEVANTDGSMRTVLLWENLDRPRDI 856

Query:   516 AIDWRTNKLYWTE-SEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYWCSWGD 574
              ++     +YWT+      IE + +D +   ++   NL+ P  +A++     +YW   G 
Sbjct:   857 VVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWADAG- 915

Query:   575 LHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTN-LDGTRKQT 633
             +  IE AG+DGS R +L    L +P GL   L   R+YW +   K+I+  + L G  ++T
Sbjct:   916 MKTIEFAGLDGSKRKVLIGSQLPHPFGLT--LYGERIYWTDWQTKSIQSADRLTGLDRET 973

Query:   634 LIALHHLKVMTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPK-DGIRCVCPAG 692
             L           +  L DI +FHRRR   + PC   NGGCSHLCL +P   G  C CP G
Sbjct:   974 L--------QENLENLMDIHVFHRRRPPVSTPCATENGGCSHLCLRSPNPSGFSCTCPTG 1025

Query:   693 NLLREDRRTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLR-QLKMVASVDVDTKNE 751
               +  D +TCS   + FL+ ++   IR +SLD+ Y   +V+P+   +K   ++ VD +  
Sbjct:  1026 INVMPDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEG 1085

Query:   752 YIYWSDISEKTIERVRFDMTGRERLVVNDLNRTESIAVDAIGRKIYWTDMNAQTIMVSDI 811
              +YWSD +   I R R D +  E L+   L  T+ +AVDAIGRK+YWTDM    I V ++
Sbjct:  1086 RVYWSDSTLHRISRARLDGSQHEDLITTGLQTTDGLAVDAIGRKVYWTDMGTNRIEVGNL 1145

Query:   812 DGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNRAVF-ETE 870
             DG   KVL W NL  PR+IV+++ +G M W DW      + ++E + MDG++RAV   + 
Sbjct:  1146 DGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGE----HAKLERSGMDGSDRAVLINSN 1201

Query:   871 VIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWT 930
             + WP+ L +D + + +L W D     IE   L         +   HPY LT+LD Y+YWT
Sbjct:  1202 LGWPNGLTVDKASS-QLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTLLDAYIYWT 1260

Query:   931 DVQHSKIYRANKYDVKDIVEFAQVDRPWLVRA-AQNISFP---NACGSNNGGCSHLCLRN 986
             D Q   I+RA+K    +++   + + P L+   A + S P   N CG  NGGCSHLCL  
Sbjct:  1261 DWQTRSIHRADKGTGSNVI-LVRSNLPGLMDIQAVDRSQPLGVNKCGPRNGGCSHLCLPR 1319

Query:   987 PTNFTCACPTGILLSADRRSCFSRTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMS 1046
             P+ F+CACPTGI L  D ++C      +LL++SR G IRRISLDT+D   V +P PE  +
Sbjct:  1320 PSGFSCACPTGIQLKGDGKTCDPAPETYLLFSSR-GSIRRISLDTSDHTDVHVPVPELNN 1378

Query:  1047 SIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDTIRDNFVIDWVANNIYYI 1106
              I  DY      +Y+ D+    +R  D++ S     I     T  D   +DWVA N+Y+ 
Sbjct:  1379 VISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTT-DGLAVDWVARNLYWT 1437

Query:  1107 DSQMHTINVARSDGQHKKILVND-LMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIEKVY 1165
             D+  +TI  +R DG  +K+L+N+ L EP AIAV+PR+G LF++ WG        KIE+  
Sbjct:  1438 DTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWG-----HIAKIERAN 1492

Query:  1166 LDGSYRTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVISKVA-PY 1224
             LDGS R VL+  DL +PN L +D+  RR++W D+   RIE  D  G+ R++++S V+ P+
Sbjct:  1493 LDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLSGKLRQVLVSHVSHPF 1552

Query:  1225 GLSVRQSPGKAFIVELYWTDWEAMSVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASK 1284
              L+ +          +YWTDW+  S  I R    +G+ +   + +N E  ++I  +S  +
Sbjct:  1553 ALTQQDR-------WIYWTDWQTKS--IQRVDKYSGR-NKETVLANVEGLMDIIVVSPQR 1602

Query:  1285 QLTWNPCAQDNGGCSHLCF 1303
             Q   N C  +NGGC+HLCF
Sbjct:  1603 QTGTNACGVNNGGCTHLCF 1621


GO:0090090 "negative regulation of canonical Wnt receptor signaling pathway" evidence=IEA
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IEA
GO:0043113 "receptor clustering" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0042733 "embryonic digit morphogenesis" evidence=IEA
GO:0042475 "odontogenesis of dentin-containing tooth" evidence=IEA
GO:0030971 "receptor tyrosine kinase binding" evidence=IEA
GO:0030279 "negative regulation of ossification" evidence=IEA
GO:0009954 "proximal/distal pattern formation" evidence=IEA
GO:0009953 "dorsal/ventral pattern formation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0001942 "hair follicle development" evidence=IEA
GO:0001932 "regulation of protein phosphorylation" evidence=IEA
GO:0001822 "kidney development" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|F1SIB6 LRP4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXA0 LRP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1K8 LRP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1309329 Lrp5 "low density lipoprotein receptor-related protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1278315 Lrp5 "low density lipoprotein receptor-related protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O75197 LRP5 "Low-density lipoprotein receptor-related protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1P9 LRP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7Q4 LRP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PST3 LRP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9QYP1LRP4_RATNo assigned EC number0.38560.94960.6640yesN/A
O75096LRP4_HUMANNo assigned EC number0.38230.94660.6619yesN/A
Q8VI56LRP4_MOUSENo assigned EC number0.38750.94890.6635yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1332
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 5e-13
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-11
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-10
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-10
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 2e-09
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 6e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 8e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 9e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 3e-07
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 3e-07
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 6e-07
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 5e-06
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 5e-06
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 1e-05
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 2e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 4e-05
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 5e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 8e-05
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 9e-05
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 2e-04
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-04
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 0.002
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 0.003
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 0.003
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
 Score = 63.8 bits (156), Expect = 5e-13
 Identities = 19/35 (54%), Positives = 22/35 (62%)

Query: 59 CSPDEHRCTTGHCILKTWLCDGIPDCSLGEDERNC 93
          C P+E RC  G CI  +W+CDG  DC  G DE NC
Sbjct: 1  CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35


Length = 35

>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1332
KOG1215|consensus877 100.0
KOG1215|consensus877 100.0
KOG1214|consensus1289 100.0
KOG1214|consensus1289 100.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.74
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.72
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.67
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.49
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.4
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.37
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.34
PRK11028330 6-phosphogluconolactonase; Provisional 99.33
PRK11028330 6-phosphogluconolactonase; Provisional 99.28
KOG4659|consensus 1899 99.25
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 99.1
COG3391381 Uncharacterized conserved protein [Function unknow 99.09
KOG4659|consensus 1899 99.03
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 99.03
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 99.0
COG3391381 Uncharacterized conserved protein [Function unknow 98.99
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.98
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.98
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.94
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.94
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.93
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.89
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.89
KOG4499|consensus310 98.87
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.86
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.84
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.79
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.79
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.78
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.75
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.74
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.73
KOG1520|consensus376 98.71
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.71
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.64
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.6
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.56
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.5
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.5
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.45
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.44
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.41
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.38
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.37
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.34
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.32
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.21
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.15
KOG1520|consensus376 98.15
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.05
PRK04792448 tolB translocation protein TolB; Provisional 98.02
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.0
PRK05137435 tolB translocation protein TolB; Provisional 97.94
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 97.94
KOG4499|consensus310 97.91
COG4946668 Uncharacterized protein related to the periplasmic 97.9
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.74
PRK04922433 tolB translocation protein TolB; Provisional 97.72
PRK00178430 tolB translocation protein TolB; Provisional 97.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.71
PRK02889427 tolB translocation protein TolB; Provisional 97.68
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.66
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.6
PRK03629429 tolB translocation protein TolB; Provisional 97.57
PRK01029428 tolB translocation protein TolB; Provisional 97.51
PRK04043419 tolB translocation protein TolB; Provisional 97.49
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.48
PF1266224 cEGF: Complement Clr-like EGF-like 97.47
PRK04792448 tolB translocation protein TolB; Provisional 97.45
PRK02888 635 nitrous-oxide reductase; Validated 97.42
PRK05137435 tolB translocation protein TolB; Provisional 97.37
PRK04043419 tolB translocation protein TolB; Provisional 97.36
PRK04922433 tolB translocation protein TolB; Provisional 97.35
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.34
PRK03629429 tolB translocation protein TolB; Provisional 97.33
COG5276370 Uncharacterized conserved protein [Function unknow 97.27
PRK02889427 tolB translocation protein TolB; Provisional 97.27
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.26
PRK00178430 tolB translocation protein TolB; Provisional 97.23
PRK01742429 tolB translocation protein TolB; Provisional 97.23
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.22
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.09
KOG2397|consensus480 97.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.01
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 97.01
KOG0318|consensus603 96.97
COG4946668 Uncharacterized protein related to the periplasmic 96.94
PRK01742429 tolB translocation protein TolB; Provisional 96.94
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 96.92
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.9
COG5276370 Uncharacterized conserved protein [Function unknow 96.86
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 96.83
KOG2397|consensus480 96.49
PF1266224 cEGF: Complement Clr-like EGF-like 96.48
PRK01029428 tolB translocation protein TolB; Provisional 96.41
PRK02888 635 nitrous-oxide reductase; Validated 96.35
PTZ00421 493 coronin; Provisional 96.32
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 96.21
KOG1446|consensus311 96.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.04
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.03
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 95.97
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 95.95
PTZ00420 568 coronin; Provisional 95.58
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.56
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.55
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.34
KOG3509|consensus964 95.17
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 94.94
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.67
smart0018135 EGF Epidermal growth factor-like domain. 94.46
KOG0315|consensus311 94.38
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.31
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.98
KOG3509|consensus964 93.87
PF13449326 Phytase-like: Esterase-like activity of phytase 93.73
PF13449326 Phytase-like: Esterase-like activity of phytase 93.54
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 93.29
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.14
KOG1219|consensus4289 93.1
KOG0291|consensus 893 92.98
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 92.82
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 92.61
KOG1446|consensus311 92.57
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.48
PLN00181793 protein SPA1-RELATED; Provisional 92.33
KOG0279|consensus315 92.12
COG0823425 TolB Periplasmic component of the Tol biopolymer t 91.76
smart0018135 EGF Epidermal growth factor-like domain. 91.64
KOG0266|consensus456 91.25
smart0017939 EGF_CA Calcium-binding EGF-like domain. 91.2
PRK13616591 lipoprotein LpqB; Provisional 91.2
KOG0273|consensus524 91.19
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 91.09
cd0005336 EGF Epidermal growth factor domain, found in epide 91.06
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 90.96
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 90.85
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 90.76
KOG0266|consensus456 90.51
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.24
KOG0286|consensus343 90.01
PF05787524 DUF839: Bacterial protein of unknown function (DUF 89.89
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.78
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 89.72
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 89.68
KOG0315|consensus311 89.5
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 89.37
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 88.74
KOG0294|consensus362 88.63
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 88.57
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.35
PLN00181793 protein SPA1-RELATED; Provisional 87.68
COG0823425 TolB Periplasmic component of the Tol biopolymer t 87.63
KOG4378|consensus 673 87.08
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.6
KOG0319|consensus 775 86.22
PF0000832 EGF: EGF-like domain This is a sub-family of the P 86.22
KOG0310|consensus 487 85.99
PF05787524 DUF839: Bacterial protein of unknown function (DUF 85.23
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 84.94
KOG0291|consensus 893 84.5
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 84.19
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 83.59
KOG2139|consensus445 83.51
KOG0293|consensus519 83.5
smart00284255 OLF Olfactomedin-like domains. 83.47
cd0005336 EGF Epidermal growth factor domain, found in epide 83.27
KOG0289|consensus506 83.08
PTZ00420 568 coronin; Provisional 82.32
KOG4649|consensus 354 82.13
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 82.09
KOG4289|consensus2531 82.03
KOG0293|consensus519 82.02
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 81.66
KOG1407|consensus313 81.62
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 81.25
KOG0277|consensus311 80.63
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 80.52
KOG0285|consensus460 80.39
PTZ00421493 coronin; Provisional 80.08
>KOG1215|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-77  Score=786.96  Aligned_cols=830  Identities=36%  Similarity=0.621  Sum_probs=701.6

Q ss_pred             CceEEEcCCCCeEEEEecCCCCceeEecCCCCCcEEEecCCccCceeeeeecCCCeEEEEeCCCCeEEEEeCCCCcEEEE
Q psy5806         250 PRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQV  329 (1332)
Q Consensus       250 pr~iavdp~~g~~fwtd~g~~~~Iera~mdGs~~~~l~~~~~~~p~gl~iD~~~~rlYw~D~~~~~i~~~~~dG~~~~~v  329 (1332)
                      ||+||++|..++|||||||. . ||    ||+.++.++.+.+.||||++||+..+++||+|++.+.|++.++||+.|+  
T Consensus         1 pra~~~~p~~~~l~wtd~~~-~-i~----dg~~~~~~~~~~~~~~ng~~id~~~~~~y~~d~~~~~i~~~~~dg~~r~--   72 (877)
T KOG1215|consen    1 PRAIALLPLEGLLFWTDWGA-N-IE----DGGERKILEKEEFEWPNGLTIDLAWQRIYWADAKNDLIESANYDGSGRR--   72 (877)
T ss_pred             CceEEeccccceEEEecCCc-c-cc----cCcceEEeeccceeCCCcceecchhheeeeccccCCceEEeccCCccce--
Confidence            89999999999999999998 4 88    8899999999999999999999999999999999999999999999887  


Q ss_pred             EcCCCCCceeEEEecCeeEeecCCCcceEEeecccCcceEEEeccCCCceeEEEecCCCCccccccCCC---Ccceeeec
Q psy5806         330 ITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQSHCAP---KVCSHICL  406 (1332)
Q Consensus       330 ~~~~~~~p~~l~~~~~~~ywtd~~~~~i~~~~k~~g~~~~~i~~~~~~p~~i~~~h~~~qp~~~n~C~~---g~CshlCl  406 (1332)
                               +|++|++++||+|   +.|.+++|.+|+....+....+.|+.++++|+.+||...++|..   .+|+|.|+
T Consensus        73 ---------~l~~~~~~~y~~d---~~v~~~~~~sg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  140 (877)
T KOG1215|consen   73 ---------ALTLFEDGLYWTD---KSVSAANKKTGKDVTRLSQDSHFPLDIHAYHPSSQPLAPDPCAESGNGPCSHCCL  140 (877)
T ss_pred             ---------eeeeeccceeecc---chhhhhccCCCCcceeehhcCCCCcceeEEecCCCCCCCCcccccCCCCCccccC
Confidence                     8999999999999   78899999999999888777777999999999999999999983   58999999


Q ss_pred             cCCC--ceEEeCCCCceecCCCCCcCCCccceeEeeecccccccccCCCCCceeeEEeeeeccceEEEEEEccCCeEEEE
Q psy5806         407 PNKH--RFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWA  484 (1332)
Q Consensus       407 ~~~~--~~~C~C~~G~~L~~d~~tC~~~~~~~ll~~~~~~i~~~~l~~~~~~~~~~~p~~~~~~~~~i~~d~~~~~lyws  484 (1332)
                      ....  .++|+|+.+..+-.+...|..+.+..+.......+++..+..     ....++.......++++|..++.+||+
T Consensus       141 ~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de~~~~~~~~~~~~~~~~~-----~~~~~~~d~~~~~~~~~d~~~~~~~~~  215 (877)
T KOG1215|consen  141 DKFSCRTGSCKCIPGDWLCDGEADCPDGSDELNCAVRRCEPRGASLDC-----IVAIKVCDIQHDCADDYDESEGRIYWT  215 (877)
T ss_pred             CCCCCcCccccCCCCceeCCCCCccccchhhhcccccccCcccccccc-----ceeeeecCcccccccccccccCccccc
Confidence            8876  459999999999877789988765544443333344333322     124444556667777777777777777


Q ss_pred             cCCCceEEEEEecCcceEEEEeCCCCCCccEEEeccCCeEEEEeCCCCeEEEEeCCCCCcEEEEeCCCCCceEEEEecCC
Q psy5806         485 DVENGEINRAHINGTFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIG  564 (1332)
Q Consensus       485 D~~~~~I~r~~~~g~~~~~v~~~~~~~p~glAvDw~~~~lYw~d~~~~~I~v~~l~g~~~~~l~~~~~~~P~~iavdp~~  564 (1332)
                      +..                                             +|++...+|+.+.+.++...+.|+++++.|..
T Consensus       216 ~~~---------------------------------------------~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de  250 (877)
T KOG1215|consen  216 DDS---------------------------------------------RIEVTRCDGSSRCILISEVCDGPRDCVDGPDE  250 (877)
T ss_pred             CCc---------------------------------------------ceeEEEecCCCcEEeehhccCCCcccccCCcC
Confidence            643                                             78999999988888888899999999999999


Q ss_pred             CeEEEEecCC-CCceEEEcCCCCceEEEEeCCCCCceeeEEeccCCeEEEEeCCCCeEEEEecCCCceEEEEe--ecc--
Q psy5806         565 GIMYWCSWGD-LHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGTRKQTLIA--LHH--  639 (1332)
Q Consensus       565 G~lywtd~g~-~~~I~r~~~dG~~~~~l~~~~l~~p~glaiD~~~~rLYw~d~~~~~I~~~~~dG~~~~~~~~--~~~--  639 (1332)
                      |++||++++. .+.++.+.+++..+..+....+.+|+|++.|+..+.+||         ..++|+..++ |..  +.|  
T Consensus       251 ~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~g~~d~pdg~de~~~~~~~~~---------~~~~d~~~~~-i~~~~~~~~~  320 (877)
T KOG1215|consen  251 GVMNCSDATCEAPEIECADGDCSDRQKLCDGDLDCPDGLDEDYCKKKLYW---------SMNVDGSGRR-ILLSKLCHGY  320 (877)
T ss_pred             ceeEeeccccCCcceeecCCCCccceEEecCccCCCCcccccccccceee---------eeecccCCce-eeecccCccc
Confidence            9999999874 478999999999999999888999999999999999999         7788888876 543  332  


Q ss_pred             --------eEE------------EeeecCceeEEEEeCCCCcCcCCCcCCCCCCccccccCCCCCceeeCCCCccccCCC
Q psy5806         640 --------LKV------------MTKVVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDR  699 (1332)
Q Consensus       640 --------l~v------------~~~~~~~~~i~v~~~~~q~~~~pC~~~nggCs~lCl~~~~~~~~C~Cp~g~~l~~d~  699 (1332)
                              +..            .......++..+++....+..++|...||+|+|+|++.....+.|.|+.||.+..++
T Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~g~Csq~C~~~~p~~~~c~c~~g~~~~~~~  400 (877)
T KOG1215|consen  321 WTDGLNECAERVLKCSHKCPDVSVGPRCDCMGAKVLPLGARTDSNPCESDNGGCSQLCVPNSPGTFKCACSPGYELRLDK  400 (877)
T ss_pred             cccccccchhhcccccCCCCccccCCcccCCccceecccccccCCcccccCCccceeccCCCCCceeEecCCCcEeccCC
Confidence                    000            112233456666666555567999999999999999653339999999999999988


Q ss_pred             CccccCCccceEeeccceeEEEecCCCCCcceeeecccccceeEEeecCCCceEEEEecCCCceEEEecCCCCceEEEeC
Q psy5806         700 RTCSENPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVN  779 (1332)
Q Consensus       700 ~tC~~~~~~~ll~s~~~~i~~i~l~~~~~~~~~~~~~~~~~~~~id~d~~~~~lYwsD~~~~~I~r~~~~g~~~~~vi~~  779 (1332)
                      ..+...+..||+++.+.+|++++++..   ++..|+.++.++.++++|..++++||+|.....|.+...++.....+...
T Consensus       401 c~~~~~~~~~l~~s~~~~ir~~~~~~~---~~~~p~~~~~~~~~~d~d~~~~~i~~~d~~~~~i~~~~~~~~~~~~~~~~  477 (877)
T KOG1215|consen  401 CEASDQPEAFLLFSNRHDIRRISLDCS---DVSRPLEGIKNAVALDFDVLNNRIYWADLSDEKICRASQDGSSECELCGD  477 (877)
T ss_pred             ceecCCCCcEEEEecCccceecccCCC---cceEEccCCccceEEEEEecCCEEEEEeccCCeEeeeccCCCccceEecc
Confidence            333344789999999999999999875   67788888899999999999999999999999999999999888888888


Q ss_pred             CCCCccceeEecCCCeEEEEeCCCCeEEEEeCCCCceEEEEecCCCCCeEEEEeCCCCeEEEEecccCcCCCCceEEEec
Q psy5806         780 DLNRTESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHM  859 (1332)
Q Consensus       780 ~~~~p~glAvD~~~~nLYwtD~~~~~I~v~~ldG~~~~~l~~~~~~~P~~Iavdp~~g~lywtd~g~~~~~~~~I~r~~~  859 (1332)
                      ++..++|||+||+++++||+|.....|++.+++|+.+.+++...+..|+.++++|..|++||++|+..    ++|+|+.|
T Consensus       478 g~~~~~~lavD~~~~~~y~tDe~~~~i~v~~~~g~~~~vl~~~~l~~~r~~~v~p~~g~~~wtd~~~~----~~i~ra~~  553 (877)
T KOG1215|consen  478 GLCIPEGLAVDWIGDNIYWTDEGNCLIEVADLDGSSRKVLVSKDLDLPRSIAVDPEKGLMFWTDWGQP----PRIERASL  553 (877)
T ss_pred             CccccCcEEEEeccCCceecccCCceeEEEEccCCceeEEEecCCCCccceeeccccCeeEEecCCCC----chhhhhcC
Confidence            99999999999999999999999999999999999999999988899999999999999999999987    79999999


Q ss_pred             CCCCcEEEecc-cccCceeEEeCCCCCeEEEEeCCCC-eEEEEccCCCcee-EEeccCCcceEEEEeCCEEEEEeCCCCE
Q psy5806         860 DGTNRAVFETE-VIWPSCLAIDYSDNPKLYWVDTSKH-TIEYKTLATGRAK-RAYAVQSHPYTLTVLDYYVYWTDVQHSK  936 (1332)
Q Consensus       860 dG~~~~~l~~~-l~~P~gl~iD~~~~~~lYw~d~~~~-~I~~~~~dG~~~~-~l~~~~~~P~~la~~~~~iywtD~~~~~  936 (1332)
                      ||+.+..++.. +.||+||++|... +++||+|+... .|++++++|..++ +....+.||++++++++++||+||....
T Consensus       554 dg~~~~~l~~~~~~~p~glt~d~~~-~~~yw~d~~~~~~i~~~~~~g~~r~~~~~~~~~~p~~~~~~~~~iyw~d~~~~~  632 (877)
T KOG1215|consen  554 DGSERAVLVTNGILWPNGLTIDYET-DRLYWADAKLDYTIESANMDGQNRRVVDSEDLPHPFGLSVFEDYIYWTDWSNRA  632 (877)
T ss_pred             CCCCceEEEeCCccCCCcceEEeec-ceeEEEcccCCcceeeeecCCCceEEeccccCCCceEEEEecceeEEeeccccc
Confidence            99999999988 9999999999999 99999999998 8999999999998 3334899999999999999999999999


Q ss_pred             EEEEECCCC-e--EEEeeee--cCcceEE-e-ccccCCCCCcccCCCCCCccccccCCCCccccCCCCeeEccCCccccc
Q psy5806         937 IYRANKYDV-K--DIVEFAQ--VDRPWLV-R-AAQNISFPNACGSNNGGCSHLCLRNPTNFTCACPTGILLSADRRSCFS 1009 (1332)
Q Consensus       937 i~~~~~~~g-~--~i~~~~~--~~i~~~~-~-~~~~~~~~n~C~~~nGgCshlCl~~p~~~~C~Cp~g~~l~~d~~tC~~ 1009 (1332)
                      +.+..+..+ .  .++.+..  +.+. ++ + ..++.+ .|+|+.+||+|+|||++.|...+|+||+|+.|..++++|..
T Consensus       633 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-~n~C~~~n~~c~~KOG~~p~~~~c~c~~~~~l~~~~~~C~~  710 (877)
T KOG1215|consen  633 ISRAEKHKGSDSRTSRSNLAQPLDII-LVHHSSSRPTG-VNPCESSNGGCSQLCLPRPQGSTCACPEGYRLSPDGKSCSS  710 (877)
T ss_pred             eEeeecccCCcceeeecccCcccceE-EEeccccCCCC-CCcccccCCCCCeeeecCCCCCeeeCCCCCeecCCCCeecC
Confidence            999998888 3  3333333  4444 34 2 334555 99999999999999999999889999999999999999997


Q ss_pred             cCcceEEEEeecceEEEEeCCCCCCCCcccccCCccceEEEEEeCCCcEEEEEeCCCCeEEEEECCCCCCceeEeecCCC
Q psy5806        1010 RTREFLLYTSRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLMNDT 1089 (1332)
Q Consensus      1010 ~p~~~ll~~~~~~~i~~i~l~~~~~~~~~~pi~~~~~~~~id~d~~~~~lY~sd~~~~~I~~~~l~~g~~~~~i~~~~~~ 1089 (1332)
                       +..+++++.+.. |+.++.+.........+..          +...+..+|+....+...+...+ ......++.....
T Consensus       711 -~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  777 (877)
T KOG1215|consen  711 -PEGYLLITSRTG-IPCISLDSELSPDQPLEDG----------DTIDRLEYWTDVRVGVAAVSSQN-CAPGYDLVGEGEP  777 (877)
T ss_pred             -cccccccccccc-cceeecCcccCCCcccCCC----------cccccceecccccceeeEEEecC-CCCccccccccCC
Confidence             788999999999 9999988665554333322          67778899998777666655544 3333335556677


Q ss_pred             CceeeEEEecCCeEEEEcCCCceEEEEeeCCce-------EEEEecCCCCceEEEEcCCCcEEEEEecCCCCCCCCCcEE
Q psy5806        1090 IRDNFVIDWVANNIYYIDSQMHTINVARSDGQH-------KKILVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTTKIE 1162 (1332)
Q Consensus      1090 ~p~glAvDw~~~~LY~td~~~~~I~v~~ldG~~-------~~~~~~~~~~P~~iavdp~~g~Lywtd~~~~~~~~~~~I~ 1162 (1332)
                      .+.++|+++..+.|||+....+.|.+..+++..       ..+.......|+.+.+.|..+.++|+++..     .+.|.
T Consensus       778 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~  852 (877)
T KOG1215|consen  778 PPEGSAVDEAEDTLYWTCSATSFIEVSGLDGERKCRRRPEGVVDFDNPVPPRTTGVEPEKSLLFWTNWEP-----GPKIP  852 (877)
T ss_pred             CCCCceeehhhcceEEEeecccEEEEEEEeeecccccccccccccCCCCCCcceeeccccceeccCCccc-----cceee
Confidence            899999999999999999999999999988742       111334567899999999999999999833     58999


Q ss_pred             EEecCCCceEEEEecCCCCcceEEE
Q psy5806        1163 KVYLDGSYRTVLVEEDLAFPNELAI 1187 (1332)
Q Consensus      1163 r~~ldG~~~~~l~~~~l~~p~glai 1187 (1332)
                      +..+++.+...++...+..|+++++
T Consensus       853 ~~~~~~~~~~~~~~~~~~~~~~~~~  877 (877)
T KOG1215|consen  853 RSALDGSERLVLFKSLLSCPNALAL  877 (877)
T ss_pred             ecccccccccceeccCCCCccCCCC
Confidence            9999999999999888899998863



>KOG1215|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1332
4dg6_A616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 1e-123
4dg6_A616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 1e-104
4dg6_A616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 7e-93
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 1e-123
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 1e-104
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 5e-93
3s2k_A629 Structural Basis Of Wnt Signaling Inhibition By Dic 5e-90
3s2k_A629 Structural Basis Of Wnt Signaling Inhibition By Dic 4e-78
3s2k_A629 Structural Basis Of Wnt Signaling Inhibition By Dic 4e-76
3s8v_A623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 3e-89
3s8v_A623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 7e-78
3s8v_A623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 1e-75
4a0p_A628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 4e-89
4a0p_A628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 8e-78
4a0p_A628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 1e-75
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 3e-81
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 3e-51
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 4e-42
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 5e-81
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 3e-51
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 4e-42
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 3e-70
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 2e-52
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 4e-46
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 2e-34
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 2e-67
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 5e-51
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 3e-45
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 1e-34
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 4e-53
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 4e-41
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 4e-27
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 6e-52
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-40
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 5e-27
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 3e-51
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 7e-37
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 3e-23
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-51
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-41
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-27
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 6e-51
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 2e-41
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-27
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 1e-26
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 4e-26
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 3e-25
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 1e-15
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 2e-06
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 2e-08
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 1e-05
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 3e-05
1ajj_A37 Ldl Receptor Ligand-Binding Module 5, Calcium-Coord 4e-04
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure

Iteration: 1

Score = 441 bits (1134), Expect = e-123, Method: Compositional matrix adjust. Identities = 225/595 (37%), Positives = 337/595 (56%), Gaps = 58/595 (9%) Query: 172 TAIIRNLHNVLAVDYHYKKNLLVWN------------------THIVHTGMQSVGSLSVD 213 T ++ L + AVD+ + L+ W+ ++V +G+ S L+ D Sbjct: 25 TIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACD 84 Query: 214 WVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKI 273 W+ + ++WTD+ R+E +LDG RK+L +D+PRA+ + P F++WTDWG+ PKI Sbjct: 85 WLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKI 144 Query: 274 ERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLDGSRRQQVITKG 333 ER MDGS+R +I+ I+WPNGLT+D+EE +LYW +AK +FI S+LDG+ RQ V+ Sbjct: 145 ERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGS 204 Query: 334 LPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIRSYHPHRQPNYQ 393 LPHPF +TL+ED ++WTDW T SI + NKYTG ++ +HS + PM+I ++ RQPN Sbjct: 205 LPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNAT 264 Query: 394 SHCA--PKVCSHICL--PNKHRFTCQCPLGLTLSPDNKSCSESPEELLIYARQKDLRISQ 449 + C CSH+CL P K + C CP G+ L + K+C + ELL+ AR+ DLR Sbjct: 265 NPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRIS 324 Query: 450 LTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHINGTFQYNVIRHNT 509 L P T + VL + +++ +AI ++ +YW D E I R+ I+G+ V+ Sbjct: 325 LDTPDFT-DIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQI 383 Query: 510 KKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDIAVNPIGGIMYW 569 P G+A+DW LYWT++ + IEV+ L+GT +L ++L EPR I ++P+ G MYW Sbjct: 384 AHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYW 443 Query: 570 CSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGLKTIEFTNLDGT 629 WG++ KIE A +DGS R +L + SL P GLA+D + ++YW + IE N DGT Sbjct: 444 TDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGT 503 Query: 630 RKQTLIA-----LHHLKVMTKVVGLTD-----IDIFHRRRSKK----------------- 662 ++ L+ + ++ V TD I+ H+R +++ Sbjct: 504 GRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATN 563 Query: 663 ------THPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTCSENPSKFLL 711 ++PC E NGGCSHLCL P+ G+RC CP G L D +TC P FLL Sbjct: 564 VHRVIGSNPCAEENGGCSHLCLYRPQ-GLRCACPIGFELISDMKTCIV-PEAFLL 616
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|1AJJ|A Chain A, Ldl Receptor Ligand-Binding Module 5, Calcium-Coordinating Length = 37 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1332
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-153
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-140
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-122
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-73
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 3e-46
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-142
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-137
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-127
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-67
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-109
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 6e-65
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 4e-62
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-55
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 2e-38
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 3e-24
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 8e-22
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-20
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 2e-14
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 1e-106
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 3e-68
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-66
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-56
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 8e-39
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 4e-25
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 6e-22
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-21
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-15
3v65_B386 Low-density lipoprotein receptor-related protein; 7e-92
3v65_B386 Low-density lipoprotein receptor-related protein; 4e-74
3v65_B386 Low-density lipoprotein receptor-related protein; 3e-70
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-63
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 6e-89
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 1e-72
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 6e-64
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 3e-54
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-20
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 8e-89
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 8e-73
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 3e-66
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 3e-55
3p5b_L400 Low density lipoprotein receptor variant; B-propel 4e-86
3p5b_L400 Low density lipoprotein receptor variant; B-propel 7e-68
3p5b_L400 Low density lipoprotein receptor variant; B-propel 8e-68
3p5b_L400 Low density lipoprotein receptor variant; B-propel 4e-61
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 2e-82
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 8e-74
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 1e-68
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 1e-60
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-76
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 7e-61
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 7e-53
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-40
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 1e-33
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-31
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 2e-27
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 6e-20
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 2e-19
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-17
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 6e-12
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 6e-12
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 3e-11
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 2e-10
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 3e-10
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-07
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-06
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-04
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-26
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 8e-19
2fyj_A82 Low-density lipoprotein receptor-related protein 1 5e-25
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-06
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-15
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-07
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 2e-14
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 6e-06
2xrc_A565 Human complement factor I; immune system, hydrolas 1e-13
2xrc_A565 Human complement factor I; immune system, hydrolas 3e-11
2xrc_A565 Human complement factor I; immune system, hydrolas 7e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 2e-13
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 9e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-13
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 4e-13
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-12
2i1p_A48 Low-density lipoprotein receptor-related protein 2 4e-08
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-12
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 7e-08
1cr8_A42 Protein (LOW density lipoprotein receptor related 5e-12
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-09
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 7e-12
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 3e-08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 9e-07
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 9e-05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-04
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 8e-12
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-11
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-11
2knx_A50 Prolow-density lipoprotein receptor-related prote; 6e-08
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-09
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 8e-08
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-06
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 4e-11
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 5e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 6e-07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 7e-07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 7e-07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 9e-07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-06
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-05
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-05
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 5e-11
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 1e-08
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 5e-07
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 9e-05
2wph_E59 Coagulation factor IXA light chain; serine proteas 1e-10
2wph_E59 Coagulation factor IXA light chain; serine proteas 1e-09
2wph_E59 Coagulation factor IXA light chain; serine proteas 4e-05
2wph_E59 Coagulation factor IXA light chain; serine proteas 8e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-10
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 7e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 2e-10
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 6e-07
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 4e-10
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 3e-09
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 8e-05
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 1e-04
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 4e-10
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-07
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 5e-10
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 8e-08
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 2e-06
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 5e-04
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 6e-10
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 4e-09
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 2e-05
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 2e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 4e-09
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 7e-07
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 1e-08
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 2e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 9e-07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 5e-04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 9e-04
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 3e-06
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 3e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-06
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 8e-06
2p4o_A306 Hypothetical protein; putative lactonase, structur 2e-05
2p4o_A306 Hypothetical protein; putative lactonase, structur 3e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 3e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 5e-04
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 5e-05
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 1e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 9e-04
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 2e-04
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-04
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-04
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
 Score =  475 bits (1224), Expect = e-153
 Identities = 220/597 (36%), Positives = 328/597 (54%), Gaps = 59/597 (9%)

Query: 163 RVSLSNKK--YTAIIRNLHNVLAVDYHYKKNLLVW------------------NTHIVHT 202
            V  +N K   T ++  L +  AVD+ +   L+ W                    ++V +
Sbjct: 22  LVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVS 81

Query: 203 GMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFV 262
           G+ S   L+ DW+ + ++WTD+   R+E  +LDG  RK+L    +D+PRA+ + P   F+
Sbjct: 82  GLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFM 141

Query: 263 FWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSDLD 322
           +WTDWG+ PKIER  MDGS+R +I+   I+WPNGLT+D+EE +LYW +AK +FI  S+LD
Sbjct: 142 YWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLD 201

Query: 323 GSRRQQVITKGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFPMNIR 382
           G+ RQ V+   LPHPF +TL+ED ++WTDW T SI + NKYTG  ++ +HS +  PM+I 
Sbjct: 202 GTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIH 261

Query: 383 SYHPHRQPNYQSHCAPKV--CSHICL--PNKHRFTCQCPLGLTLSPDNKSCSESPEELLI 438
           ++   RQPN  + C      CSH+CL  P K  + C CP G+ L  + K+C +   ELL+
Sbjct: 262 AFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLL 321

Query: 439 YARQKDLRISQLTEPSPTFETVLPVMNVKSVVAIAWESANDSLYWADVENGEINRAHING 498
            AR+ DLR   L  P  T   VL + +++  +AI ++     +YW D E   I R+ I+G
Sbjct: 322 LARRTDLRRISLDTPDFTD-IVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG 380

Query: 499 TFQYNVIRHNTKKPAGVAIDWRTNKLYWTESEYNWIEVSNLDGTYPTLLFWQNLSEPRDI 558
           +    V+      P G+A+DW    LYWT++  + IEV+ L+GT   +L  ++L EPR I
Sbjct: 381 SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI 440

Query: 559 AVNPIGGIMYWCSWGDLHKIEMAGMDGSHRHILASDSLKNPTGLAIDLENSRLYWANVGL 618
            ++P+ G MYW  WG++ KIE A +DGS R +L + SL  P GLA+D +  ++YW +   
Sbjct: 441 VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT 500

Query: 619 KTIEFTNLDGTRKQTLIALHHL---------------------------------KVMTK 645
             IE  N DGT ++ L+                                       ++ +
Sbjct: 501 DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQ 560

Query: 646 VVGLTDIDIFHRRRSKKTHPCNENNGGCSHLCLIAPKDGIRCVCPAGNLLREDRRTC 702
           +  L  +   +  R   ++PC E NGGCSHLCL  P  G+RC CP G  L  D +TC
Sbjct: 561 LPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRP-QGLRCACPIGFELISDMKTC 616


>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Length = 333 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Length = 305 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1332
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.96
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.95
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.89
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.87
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.83
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.82
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.76
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.74
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.73
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.73
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.71
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.68
3kya_A496 Putative phosphatase; structural genomics, joint c 99.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.67
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.66
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.66
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.65
3kya_A496 Putative phosphatase; structural genomics, joint c 99.65
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.65
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.64
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.63
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.6
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.6
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.56
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.55
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.52
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.52
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.49
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.48
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.47
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.47
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.44
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.44
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.43
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.4
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.4
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.35
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.34
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.33
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.32
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.32
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.32
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.28
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.28
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.27
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.27
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.27
2qe8_A343 Uncharacterized protein; structural genomics, join 99.26
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.24
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.24
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.24
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.24
2xrc_A565 Human complement factor I; immune system, hydrolas 99.24
2qe8_A343 Uncharacterized protein; structural genomics, join 99.23
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.23
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.23
2xrc_A565 Human complement factor I; immune system, hydrolas 99.21
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.21
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.21
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.2
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.19
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.18
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.18
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.16
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.14
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.14
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.13
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.1
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.1
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.09
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.08
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.07
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.07
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.05
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 99.03
2m0p_A52 Low-density lipoprotein receptor-related protein; 99.03
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 99.02
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.02
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 99.02
3a7q_B44 Low-density lipoprotein receptor-related protein; 99.01
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.01
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.01
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.0
2m0p_A52 Low-density lipoprotein receptor-related protein; 99.0
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.99
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.99
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.99
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.99
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.97
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.97
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.94
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.93
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.93
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.92
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.92
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.92
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.92
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.91
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.91
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.9
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.9
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.9
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.9
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.89
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.89
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.87
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.87
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.85
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.85
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.84
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.81
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.81
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.79
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.76
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.75
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.74
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.73
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.73
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.72
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.71
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.68
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.67
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.66
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.65
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.64
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.64
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.64
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.62
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.61
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.6
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.6
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.57
2ece_A462 462AA long hypothetical selenium-binding protein; 98.57
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.55
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.48
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.46
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.46
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.45
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.42
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.38
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.36
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.36
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.36
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.33
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.33
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.31
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.29
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.29
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.29
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.27
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.27
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.27
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 98.26
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.25
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.24
2ece_A462 462AA long hypothetical selenium-binding protein; 98.24
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.23
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.21
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 98.21
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.15
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.15
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.15
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.09
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.07
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.07
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.01
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.98
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.84
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.84
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.83
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.83
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 97.82
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.82
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 97.73
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.72
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.71
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.7
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.7
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.67
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.63
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.54
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.51
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.51
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.47
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.47
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.41
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.39
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.36
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.33
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.31
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.26
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.26
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.25
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.25
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.23
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.22
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.2
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.19
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.18
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.18
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.15
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.15
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.13
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.12
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.09
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.08
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.08
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.06
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.06
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.05
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.02
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 97.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.0
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.0
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.99
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.99
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.98
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.93
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.88
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.86
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.85
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.85
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.81
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.8
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.8
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 96.77
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.75
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.73
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.63
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.6
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.59
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.58
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.56
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.54
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.5
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.5
3jrp_A379 Fusion protein of protein transport protein SEC13 96.49
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.48
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.46
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.44
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.42
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.39
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.35
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.31
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 96.3
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.3
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.29
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.29
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.27
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.24
1szb_A170 Mannose binding lectin-associated serine protease- 96.23
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.21
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.2
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.19
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.17
3jrp_A379 Fusion protein of protein transport protein SEC13 96.14
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.12
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.12
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.11
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.06
1nzi_A159 Complement C1S component; calcium, innate immunity 96.04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.92
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.9
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.88
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 95.84
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.82
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.82
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.82
1szb_A170 Mannose binding lectin-associated serine protease- 95.8
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.78
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 95.72
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.71
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.7
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.65
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 95.6
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 95.58
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 95.43
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.37
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.36
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.3
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 95.29
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.22
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.2
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 95.2
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 95.18
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 95.16
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.12
2vh0_B134 Activated factor XA light chain; serine protease, 95.11
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.11
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 95.09
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 95.08
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.98
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 94.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.95
2vh0_B134 Activated factor XA light chain; serine protease, 94.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.94
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 94.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.87
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.86
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.84
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.76
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.71
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.69
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.67
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.63
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.59
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.57
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 94.57
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.56
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 94.5
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 94.49
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.48
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 94.47
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 94.45
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.45
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.43
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.35
1nzi_A159 Complement C1S component; calcium, innate immunity 94.25
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.2
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.18
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 94.11
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.0
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.98
3jro_A 753 Fusion protein of protein transport protein SEC13 93.95
3jro_A 753 Fusion protein of protein transport protein SEC13 93.87
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.79
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.57
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.51
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 93.51
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 93.42
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 93.37
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 93.15
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.87
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 92.4
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 92.37
2bou_A143 EGF-like module containing mucin-like hormone rece 92.18
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.13
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.08
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.05
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 91.52
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.45
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 91.07
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.72
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 90.66
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 89.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 89.94
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 89.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 89.85
1a3p_A45 Epidermal growth factor; disulfide connectivities, 89.55
2pm7_B297 Protein transport protein SEC13, protein transport 89.53
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 89.51
2pm7_B297 Protein transport protein SEC13, protein transport 89.51
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 89.03
2k2s_B61 Micronemal protein 6; microneme protein complex, c 88.7
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 88.33
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 88.03
1nql_B53 Epidermal growth factor; cell surface receptor, ty 88.0
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 87.68
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.58
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 87.14
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 87.06
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 86.93
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 86.74
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 86.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 85.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 85.24
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 84.45
2bou_A143 EGF-like module containing mucin-like hormone rece 83.86
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 83.27
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 82.06
3ott_A 758 Two-component system sensor histidine kinase; beta 81.3
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 80.73
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 80.41
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
Probab=100.00  E-value=4.6e-98  Score=942.95  Aligned_cols=594  Identities=32%  Similarity=0.574  Sum_probs=544.2

Q ss_pred             CCccceEeeccceeEEEecCCCCCcceeeecccccceeEEeecCCCceEEEEecCCCceEEEecCCCCceEEEeCCCCCc
Q psy5806         705 NPSKFLLVSQTDKIRQISLDVEYRYPIVLPLRQLKMVASVDVDTKNEYIYWSDISEKTIERVRFDMTGRERLVVNDLNRT  784 (1332)
Q Consensus       705 ~~~~~ll~s~~~~i~~i~l~~~~~~~~~~~~~~~~~~~~id~d~~~~~lYwsD~~~~~I~r~~~~g~~~~~vi~~~~~~p  784 (1332)
                      .|++||+|+++.+|++++++... ...++|++++.++.+||||+.+++|||+|...+.|+|+.++|+..++++..++..|
T Consensus         4 ~p~~~Ll~s~~~~I~~i~l~~~~-~~~~~~~~~~~~~~~l~~d~~~~~lywtD~~~~~I~r~~~~g~~~~~v~~~g~~~P   82 (628)
T 4a0p_A            4 VPEAFLLFSRRADIRRISLETNN-NNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYP   82 (628)
T ss_dssp             -CCCEEEEEETTEEEEEESSCTT-CEEECCCCSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEECSSCSCC
T ss_pred             CCCcEEEEEeCCcEEEEECCCCC-cceEEEcCCCCceEEEEEECCCCEEEEEECCCCeEEEEECCCCCcEEEEeCCCCCc
Confidence            47899999999999999998754 34567888899999999999999999999999999999999999999999899999


Q ss_pred             cceeEecCCCeEEEEeCCCCeEEEEeCCCCceEEEEecCCCCCeEEEEeCCCCeEEEEecccCcCCCCceEEEecCCCCc
Q psy5806         785 ESIAVDAIGRKIYWTDMNAQTIMVSDIDGKNAKVLFWLNLYRPRSIVVHYGLGLMVWADWSRTRLTNNRIEMAHMDGTNR  864 (1332)
Q Consensus       785 ~glAvD~~~~nLYwtD~~~~~I~v~~ldG~~~~~l~~~~~~~P~~Iavdp~~g~lywtd~g~~~~~~~~I~r~~~dG~~~  864 (1332)
                      .|||+||.+++|||+|...++|++++++|+.+++++...+..|++|||||.+|+|||+||+..    ++|+|+.|||+++
T Consensus        83 ~GlAvD~~~~~LY~tD~~~~~I~v~~~dG~~~~~l~~~~l~~P~~iavdp~~G~lY~tD~g~~----~~I~r~~~dG~~~  158 (628)
T 4a0p_A           83 EGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGK----PKIDRAAMDGSER  158 (628)
T ss_dssp             CEEEEETTTTEEEEEETTTTEEEEEETTSTTCEEEECSSCCCEEEEEEETTTTEEEEEECSSS----CEEEEEETTSCSC
T ss_pred             ceEEEEeCCCEEEEEECCCCEEEEEecCCCcEEEEEeCCCCCcccEEEccCCCeEEEeCCCCC----CEEEEEeCCCCce
Confidence            999999999999999999999999999999999998888999999999999999999999876    8999999999999


Q ss_pred             EEEecccccCceeEEeCCCCCeEEEEeCCCCeEEEEccCCCceeEEeccCCcceEEEEeCCEEEEEeCCCCEEEEEECCC
Q psy5806         865 AVFETEVIWPSCLAIDYSDNPKLYWVDTSKHTIEYKTLATGRAKRAYAVQSHPYTLTVLDYYVYWTDVQHSKIYRANKYD  944 (1332)
Q Consensus       865 ~~l~~~l~~P~gl~iD~~~~~~lYw~d~~~~~I~~~~~dG~~~~~l~~~~~~P~~la~~~~~iywtD~~~~~i~~~~~~~  944 (1332)
                      +++++.+.+|+||++|+.+ ++|||+|+..++|++++++|..++++...+.||+||++++++|||+||.+++|.+++|.+
T Consensus       159 ~~l~~~~~~P~GlalD~~~-~~LY~aD~~~~~I~~~d~dG~~~~v~~~~l~~P~glav~~~~ly~tD~~~~~I~~~dk~t  237 (628)
T 4a0p_A          159 TTLVPNVGRANGLTIDYAK-RRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTS  237 (628)
T ss_dssp             EEEECSCSSEEEEEEETTT-TEEEEEETTTTEEEEEETTSCSCEEEEECCSCEEEEEEETTEEEEEETTTTEEEEEETTT
T ss_pred             EEEECCCCCcceEEEcccc-CEEEEEECCCCEEEEEcCCCCceEEeeccCCCceEEEEECCEEEEecCCCCEEEEEECCC
Confidence            9999889999999999998 999999999999999999999998777789999999999999999999999999999998


Q ss_pred             C---eEEEeeee--cCcceEEeccccCCCCCcccCCCCCCccccccCC-CCccccCCCCeeEccCCccccccCcceEEEE
Q psy5806         945 V---KDIVEFAQ--VDRPWLVRAAQNISFPNACGSNNGGCSHLCLRNP-TNFTCACPTGILLSADRRSCFSRTREFLLYT 1018 (1332)
Q Consensus       945 g---~~i~~~~~--~~i~~~~~~~~~~~~~n~C~~~nGgCshlCl~~p-~~~~C~Cp~g~~l~~d~~tC~~~p~~~ll~~ 1018 (1332)
                      |   +++..++.  ++|+ +|++..+.+ .|+|+.+||+|+|||+++| ++|+|+||.||.|..|+++|.+ +++||||+
T Consensus       238 g~~~~~l~~~~~~p~~i~-v~~~~~q~~-~n~C~~~ng~C~~~C~~~~~~~~~C~C~~g~~l~~d~~~C~~-~~~~Ll~s  314 (628)
T 4a0p_A          238 GQNRTIIQGHLDYVMDIL-VFHSSRQSG-WNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA-PTTFLLFS  314 (628)
T ss_dssp             CCSCEEEECSCCSCCEEE-EECGGGSCC-CCTTTTTGGGCSSEEEEETTTEEEEECSTTCEECTTSSCEEC-CSSEEEEE
T ss_pred             CCceEEEecCCCCcceee-eeeeccccc-ceEeccCCCCcchhhhcCCCCCeeEEcCCCcEecccCCcCcc-ccceeeee
Confidence            8   66766654  8999 998765555 8999999999999999999 7799999999999999999995 68999999


Q ss_pred             eecceEEEEeCCCCCCCCcccccCCccceEEEEEeCCCcEEEEEeCCCCeEEEEECCCCCCceeEeec------CCCCce
Q psy5806        1019 SRFGVIRRISLDTADLLPVTLPFPEYMSSIFFDYHYSKNLIYFADMRSGNLRTFDMSDSTRIKPIPLM------NDTIRD 1092 (1332)
Q Consensus      1019 ~~~~~i~~i~l~~~~~~~~~~pi~~~~~~~~id~d~~~~~lY~sd~~~~~I~~~~l~~g~~~~~i~~~------~~~~p~ 1092 (1332)
                      ++.. |+++.++.......++|+++++++.+||||+.+++|||+|...++|++++++ |+..+.++..      ++..|+
T Consensus       315 ~~~~-i~~i~l~~~~~~~~~l~~~~~~~~~~ld~d~~~~~iy~sD~~~~~I~r~~~~-g~~~~~v~~~~~~~~~~~~~p~  392 (628)
T 4a0p_A          315 QKSA-INRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQED-GSQGFTVVVSSVPSQNLEIQPY  392 (628)
T ss_dssp             ETTE-EEEECCCTTCCCCEECCCTTCSCEEEEEEETTTTEEEEEETTTTEEEEEETT-SCSCEEEEC--------CCCEE
T ss_pred             ccce-EEEEecccccCceEEEEehhcCCceEEEEecCCCeEEEEecCcceEEEEEcC-CCCceEEEEcccccccccCCcc
Confidence            9999 9999998766666788999999999999999999999999999999999987 7776666644      567899


Q ss_pred             eeEEEecCCeEEEEcCCCceEEEEeeCCceEEE-EecCCCCceEEEEcCCCcEEEEEecCCCCCCCCC-cEEEEecCCCc
Q psy5806        1093 NFVIDWVANNIYYIDSQMHTINVARSDGQHKKI-LVNDLMEPLAIAVYPRRGLLFYSHWGLYDNSPTT-KIEKVYLDGSY 1170 (1332)
Q Consensus      1093 glAvDw~~~~LY~td~~~~~I~v~~ldG~~~~~-~~~~~~~P~~iavdp~~g~Lywtd~~~~~~~~~~-~I~r~~ldG~~ 1170 (1332)
                      ||||||++++|||+|...++|++++++|+.+.+ +..++..|++|||||.+|+||||||+.     .+ +|+|++|||+.
T Consensus       393 glAvD~~~~nLY~td~~~~~I~v~~~~G~~~~~l~~~~l~~Pr~iavdp~~g~ly~tD~g~-----~~~~I~r~~~dG~~  467 (628)
T 4a0p_A          393 DLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQE-----RSPKIERAALDGTE  467 (628)
T ss_dssp             EEEEETTTTEEEEEETTTTEEEEEETTSCEEEEEEECTTCCEEEEEEETTTTEEEEEEEET-----TEEEEEEEETTSCS
T ss_pred             eEEeeccCCeEEEEcCCCCEEEEEECCCCeEEEEEeCCCCceeeEEEecCCCeEEEeecCC-----CCCeEEEEeCCCCC
Confidence            999999999999999999999999999998877 556789999999999999999999987     33 89999999999


Q ss_pred             eEEEEecCCCCcceEEEecCCCEEEEEEcCCCeEEEEecCCCceEEEEe--ecccceEEEecCCccccccEEEEEECCCC
Q psy5806        1171 RTVLVEEDLAFPNELAIDFKQRRLFWADSTNKRIEYCDFFGRSRKIVIS--KVAPYGLSVRQSPGKAFIVELYWTDWEAM 1248 (1332)
Q Consensus      1171 ~~~l~~~~l~~p~glaiD~~~~~LY~~d~~~~~I~~~d~dG~~~~~~~~--~~~P~glav~~~~~~~~~~~lYwtd~~~~ 1248 (1332)
                      +++|+.+++.+|+||+||+++++|||+|+..++|+++++||+.|+++..  +.+|+|||+       ++++||||||.++
T Consensus       468 ~~~l~~~~l~~P~gla~D~~~~~LYw~D~~~~~I~~~~~dG~~r~~~~~~~~~~P~glav-------~~~~ly~tD~~~~  540 (628)
T 4a0p_A          468 REVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTV-------FENWLYWIDKQQQ  540 (628)
T ss_dssp             CEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEECSSCSCEEEEEE-------ETTEEEEEETTTT
T ss_pred             cEEEEeccCCCccEEEEeCCCCEEEEEeCCCCEEEEEeCCCCceEEEEcCCCCCcEEEEE-------ECCEEEEEECCCC
Confidence            9999998899999999999999999999999999999999999999985  899999999       9999999999999


Q ss_pred             EEEEEEecCCCCcceEEEEecCCCCeeeEEEEeCCCC--CCCCCCCCCCCCCCccceeccCCCCceeeCCCCCC---CCc
Q psy5806        1249 SVVIAREKSDTGQWDVHLIRSNQEDFLNIKAISASKQ--LTWNPCAQDNGGCSHLCFYKGRTKGYVCGCPDDLE---PNE 1323 (1332)
Q Consensus      1249 ~V~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~q--~~~n~C~~~ng~C~~lC~~~~~~~~~~C~C~~~~~---~~~ 1323 (1332)
                      +|++++|.+|   ++.++++.++..+++|++++...+  .+.|||..+||+|+|||++.+ .+.++|+||+||+   ++.
T Consensus       541 ~i~~~~k~~G---~~~~~i~~~~~~~~~i~~~~~~~~~~~~~n~c~~~ng~C~~~C~~~~-~~~~~C~C~~g~~l~~d~~  616 (628)
T 4a0p_A          541 MIEKIDMTGR---EGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKG-DGTTRCSCPMHLVLLQDEL  616 (628)
T ss_dssp             EEEEEETTSS---SCCEEEECCCTTEEEEEEECCCCHHHHHHSTTTTGGGGCSSEEEECT-TSCEEEECCTTEEECTTSS
T ss_pred             eEEEEECcCC---CCcEEEeccCCCCcceEEEeecccCccccccCCCCCCCcchhcccCC-CCCeeeeCCCCCEECCCCC
Confidence            9999999999   788899999999999999987654  478999999999999999983 4568999999983   333


Q ss_pred             cc
Q psy5806        1324 EC 1325 (1332)
Q Consensus      1324 ~c 1325 (1332)
                      +|
T Consensus       617 ~~  618 (628)
T 4a0p_A          617 SC  618 (628)
T ss_dssp             CE
T ss_pred             cC
Confidence            66



>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1332
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-54
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-39
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-32
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-28
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 4e-20
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-18
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 1e-16
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 9e-13
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 9e-51
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 7e-47
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 4e-36
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 7e-34
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 2e-17
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 1e-12
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-13
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-13
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 4e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 1e-12
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 4e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-12
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-12
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-12
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-06
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 5e-12
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 2e-10
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 5e-06
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 9e-06
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 6e-12
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 4e-09
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 2e-07
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 1e-04
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 7e-12
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 4e-09
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 2e-07
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 2e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 1e-11
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 6e-09
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 1e-07
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 3e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-11
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-11
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-08
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 4e-11
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-10
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-06
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 4e-05
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 4e-11
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 8e-08
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 3e-06
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 1e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 6e-11
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-10
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-06
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 3e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-10
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 6e-07
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-10
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-10
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-06
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-10
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-07
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-10
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 1e-09
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 1e-05
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 2e-09
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 1e-06
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 1e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 9e-09
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 4e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 1e-08
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 6e-07
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 4e-06
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 4e-08
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 9e-07
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 4e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 7e-08
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-05
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-07
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 4e-06
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 5e-06
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-06
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 5e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 3e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 0.001
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-06
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 3e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 8e-04
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 1e-04
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 1e-04
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 3e-04
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 0.001
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 0.001
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 4e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.001
d2p4oa1302 b.68.6.3 (A:4-305) Hypothetical protein All0351 ho 0.002
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  188 bits (479), Expect = 2e-54
 Identities = 87/252 (34%), Positives = 138/252 (54%), Gaps = 23/252 (9%)

Query: 162 KRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVW---------------------NTHIV 200
           ++++L   +YT++I NL NV+A+D     N + W                        ++
Sbjct: 13  RKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVI 72

Query: 201 HTGMQSVGSLSVDWVHDFVFWTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDA 260
              +Q+   L+VDW+H  ++WTD+    V   D  G  RK L   N  KPRA++V P   
Sbjct: 73  SRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHG 132

Query: 261 FVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTIDFEEDRLYWTEAKHHFIESSD 320
           F++WTDWG   KI++  ++G +   ++TENI WPNG+T+D    RLYW ++K H I S D
Sbjct: 133 FMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSID 192

Query: 321 LDGSRRQQVIT--KGLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFP 378
           ++G  R+ ++   K L HPF + ++ED VFWTD   ++I SAN+ TG ++  +   L  P
Sbjct: 193 VNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSP 252

Query: 379 MNIRSYHPHRQP 390
            ++  +H   QP
Sbjct: 253 EDMVLFHNLTQP 264


>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1332
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.78
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.69
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.62
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.62
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.58
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.52
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.44
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.38
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.31
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.3
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.28
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.28
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.18
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.17
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.14
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.13
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.12
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.12
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.12
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.11
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.1
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.06
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 99.06
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.06
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.04
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.04
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 99.03
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.01
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.99
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.98
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.98
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.98
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.97
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.97
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.96
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.96
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.95
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.95
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.95
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.92
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.91
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.9
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.9
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.9
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.89
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.88
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.87
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.87
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.85
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.84
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.8
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.8
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.79
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.77
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.77
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.77
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.77
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.76
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.76
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.72
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.72
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.67
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.65
d1nt0a345 Mannose-binding protein associated serine protease 98.65
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.63
d1szba245 Mannose-binding protein associated serine protease 98.62
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.55
d1szba245 Mannose-binding protein associated serine protease 98.51
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.51
d1nt0a345 Mannose-binding protein associated serine protease 98.5
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.44
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.37
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.29
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.29
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.27
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.24
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.24
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.04
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.04
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.04
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.03
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.0
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.0
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.93
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.9
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.72
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.69
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.67
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.59
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.53
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.47
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.42
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.35
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.11
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.99
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.97
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.93
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.6
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.34
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.11
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.06
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.0
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.97
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.83
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.83
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.53
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.51
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.48
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.36
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.08
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.97
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.88
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.84
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 94.78
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 94.39
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 94.3
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 93.88
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 93.11
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 92.92
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 92.87
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.81
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 92.73
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 92.54
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 92.5
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 92.39
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 92.32
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 92.22
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.99
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 91.88
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 91.71
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.66
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.06
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.52
d1tbga_340 beta1-subunit of the signal-transducing G protein 87.68
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 87.27
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 86.79
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 86.46
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 86.27
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 85.83
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 85.75
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 85.55
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 85.29
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 85.1
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 84.91
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 83.39
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 80.98
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 80.75
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 80.41
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 80.28
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 80.28
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 80.07
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.2e-41  Score=379.91  Aligned_cols=231  Identities=37%  Similarity=0.763  Sum_probs=215.7

Q ss_pred             CcccccCcceeEEeecccceeEEeeeccceeEEEEE---------------------EEEEecccccCceeeecccCcee
Q psy5806         162 KRVSLSNKKYTAIIRNLHNVLAVDYHYKKNLLVWNT---------------------HIVHTGMQSVGSLSVDWVHDFVF  220 (1332)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~a~d~~~~~~~iywsd---------------------~v~~~g~~~~~~lavDWi~~~lY  220 (1332)
                      +++.+++.++..++.++.+++|||||+.+++|||+|                     .++..++..|.||||||++++||
T Consensus        13 ~~~~l~~~~~~~~~~~~~~~~~id~d~~~~~lYw~D~~~~~I~~~~l~~~~~~~~~~~~~~~~~~~p~glAvD~~~~~lY   92 (266)
T d1ijqa1          13 RKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIY   92 (266)
T ss_dssp             EEEETTSCCCEEEECSCSSEEEEEEETTTTEEEEEETTTTEEEEEEC--------CEEEECSSCSCCCEEEEETTTTEEE
T ss_pred             EEEECCCCcceeeeCCCCceEEEEEEeCCCEEEEEECCCCEEEEEEecCCCCCcceEEEEeCCCCCcceEEEeeccceEE
Confidence            456677778888888999999999999999999999                     23445677899999999999999


Q ss_pred             eecCCCCeEEEEcCCCCceEEEEeCCCCCCceEEEcCCCCeEEEEecCCCCceeEecCCCCCcEEEecCCccCceeeeee
Q psy5806         221 WTDTAARRVEFCDLDGKNRKILIANNIDKPRAVIVHPRDAFVFWTDWGKTPKIERVEMDGSNRKVILTENIFWPNGLTID  300 (1332)
Q Consensus       221 w~d~~~~~I~v~~~dg~~~~~l~~~~~~~pr~iavdp~~g~~fwtd~g~~~~Iera~mdGs~~~~l~~~~~~~p~gl~iD  300 (1332)
                      |+|...++|+|+++||+.+++++...+.+|++|||||.+|+|||++|+..++|+|++|||+++++|+.+.+.+|+||+||
T Consensus        93 ~~d~~~~~I~v~~~~g~~~~~~~~~~~~~P~~l~vd~~~g~ly~~~~~~~~~I~r~~~dGs~~~~l~~~~~~~p~gl~iD  172 (266)
T d1ijqa1          93 WTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLD  172 (266)
T ss_dssp             EEETTTTEEEEEETTSSSEEEEEECTTCCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCCEEEEECSSCSCEEEEEEE
T ss_pred             EEecCCCEEEeEecCCceEEEEEcCCCCCcceEEEEcccCeEEEeccCCCcceeEeccCCCceecccccccceeeEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCeEEEEeCCCCeEEEEeCCCCcEEEEEcC--CCCCceeEEEecCeeEeecCCCcceEEeecccCcceEEEeccCCCc
Q psy5806         301 FEEDRLYWTEAKHHFIESSDLDGSRRQQVITK--GLPHPFGITLYEDFVFWTDWHTKSISSANKYTGRNIKTVHSGLHFP  378 (1332)
Q Consensus       301 ~~~~rlYw~D~~~~~i~~~~~dG~~~~~v~~~--~~~~p~~l~~~~~~~ywtd~~~~~i~~~~k~~g~~~~~i~~~~~~p  378 (1332)
                      +.+++|||+|+..+.|+++++||++++.++..  .+++|++|++++++|||+||..++|++++|.+|++.+.+......|
T Consensus       173 ~~~~~lYw~d~~~~~I~~~~~dG~~~~~~~~~~~~~~~p~~lav~~~~ly~td~~~~~I~~~~~~~g~~~~~~~~~~~~p  252 (266)
T d1ijqa1         173 LLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSP  252 (266)
T ss_dssp             TTTTEEEEEETTTTEEEEEETTSCSCEEEEECTTTTSSEEEEEEETTEEEEEETTTTEEEEEETTTCCCCEEEECSCSCC
T ss_pred             ccccEEEEecCCcCEEEEEECCCCCEEEEEeCCCcccccEEEEEECCEEEEEECCCCeEEEEECCCCcceEEEEcCCCCc
Confidence            99999999999999999999999999888754  4789999999999999999999999999999999999999999999


Q ss_pred             eeEEEecCCCCccc
Q psy5806         379 MNIRSYHPHRQPNY  392 (1332)
Q Consensus       379 ~~i~~~h~~~qp~~  392 (1332)
                      ++|+++||.+||.+
T Consensus       253 ~~i~v~~~~~QP~g  266 (266)
T d1ijqa1         253 EDMVLFHNLTQPRG  266 (266)
T ss_dssp             CCEEEESGGGSCCC
T ss_pred             eEEEEECCccCCCC
Confidence            99999999999964



>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure