Psyllid ID: psy5813

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MKVKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
ccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccEEEEEccccEEEEEEEccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccc
ccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHccccHHHHHHHHHHHHHHEEccccccccccccccccccccccccccccHHccHHHHHHHHHHccccHHHEEEEEEcEEEEEEEccccccccccEEEEEcccccccccccEEEHHHHHHHccccccEEEEcccccccEEEEEccEEEEcccHHHHHHHHHHHHHccccEEEEEcccccc
mkvkkkntyLDFMNILSydyhsafepavnhhsplfpleedgeynfeAQLSIVSYDIHRYLDFMNILSydyhsafepavnhhsplfpleedgeynfeaQLSIDHTIKHYlksgadpdklvlgiptygrsytlfnpesnqigapadgpgeqgdatreKGYLAYYEICSSlksddwsvehpnpramgpyafkgnqwvgyddqeIAKDKakyvndqklGGIMFWSIDNDD
mkvkkkntylDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
MKVKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
*******TYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFN***********************GYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSI****
*KVKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
MKVKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAP*********ATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
**VKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVKKKNTYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIVSYDIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q6TMG6361 Chitinase-3-like protein N/A N/A 0.725 0.454 0.473 4e-40
P30922383 Chitinase-3-like protein yes N/A 0.730 0.430 0.473 2e-39
Q7YS85361 Chitinase-3-like protein N/A N/A 0.725 0.454 0.473 2e-39
Q29411383 Chitinase-3-like protein yes N/A 0.730 0.430 0.467 3e-39
Q8SPQ0383 Chitinase-3-like protein N/A N/A 0.730 0.430 0.467 5e-39
P36222383 Chitinase-3-like protein yes N/A 0.743 0.438 0.463 4e-38
Q9D7Q1 464 Chitotriosidase-1 OS=Mus yes N/A 0.721 0.351 0.444 7e-37
Q9WTV1381 Chitinase-3-like protein yes N/A 0.730 0.433 0.450 7e-37
Q5RBP6410 Chitinase-3-like protein yes N/A 0.743 0.409 0.451 9e-37
Q61362381 Chitinase-3-like protein no N/A 0.730 0.433 0.421 3e-36
>sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 Back     alignment and function desciption
 Score =  164 bits (416), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 112/171 (65%), Gaps = 7/171 (4%)

Query: 56  IHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADP 115
           I R+LDF+++L+YD+H A+   V HHSPLF   ED    F    + D+ + + L+ GA  
Sbjct: 173 ISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFS---NADYAVSYMLRLGAPA 229

Query: 116 DKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSV 175
           +KLV+GIPT+GRS+TL + +++ +GAP  GPG  G  T+EKG LAYYEIC  L     + 
Sbjct: 230 NKLVMGIPTFGRSFTLASSKTD-VGAPVSGPGVPGRFTKEKGILAYYEICDFLHG---AT 285

Query: 176 EHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
            H       PYA KGNQWV YDDQE  K+KA+Y+ +++L G M W++D DD
Sbjct: 286 THRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDD 336
Carbohydrate-binding lectin with a preference for chitin. May play a role in defense against pathogens, or in tissue remodeling. May play an important role in the capacity of cells to respond to and cope with changes in their environment.
Ovis aries (taxid: 9940)
>sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 Back     alignment and function description
>sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=2 Back     alignment and function description
>sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 Back     alignment and function description
>sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 Back     alignment and function description
>sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 Back     alignment and function description
>sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 Back     alignment and function description
>sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 Back     alignment and function description
>sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 Back     alignment and function description
>sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
328721868 1720 PREDICTED: hypothetical protein LOC10016 0.761 0.1 0.768 2e-77
170052833 2681 brain chitinase and chia [Culex quinquef 0.756 0.063 0.738 4e-76
347963356 3613 AGAP000198-PA [Anopheles gambiae str. PE 0.756 0.047 0.761 5e-76
270004517 2369 hypothetical protein TcasGA2_TC003876 [T 0.747 0.071 0.745 1e-75
91079784 2106 PREDICTED: similar to brain chitinase an 0.747 0.080 0.745 2e-75
242008672 2703 hypothetical protein Phum_PHUM175040 [Pe 0.756 0.063 0.760 5e-75
157132639 2816 brain chitinase and chia [Aedes aegypti] 0.756 0.060 0.738 5e-75
345489180 2259 PREDICTED: hypothetical protein LOC10011 0.765 0.076 0.715 1e-74
307180957 4106 Chitotriosidase-1 [Camponotus floridanus 0.765 0.042 0.711 1e-74
307192624 2183 Acidic mammalian chitinase [Harpegnathos 0.765 0.079 0.723 7e-74
>gi|328721868|ref|XP_001942596.2| PREDICTED: hypothetical protein LOC100160065 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 133/173 (76%), Positives = 156/173 (90%), Gaps = 1/173 (0%)

Query: 55  DIHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGAD 114
           +++++LDFMN+L+YDYHS+FEPAVNHHSPL+PLEED EYNF+A+L+IDHTIKHYL SGAD
Sbjct: 213 ELNKHLDFMNLLTYDYHSSFEPAVNHHSPLYPLEEDSEYNFDAKLNIDHTIKHYLASGAD 272

Query: 115 PDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDD-W 173
            +KLVLGIPTYGRSYTLFN ES  IGAP+DGPGE+G+ATREKGYLAYYEIC +LK DD W
Sbjct: 273 KEKLVLGIPTYGRSYTLFNRESKDIGAPSDGPGEKGEATREKGYLAYYEICGNLKKDDSW 332

Query: 174 SVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
           ++E P P+AMGPYA+K NQWVGYDD+E  K KAKYVN+  LGGIMFWSIDNDD
Sbjct: 333 TIEQPKPKAMGPYAYKDNQWVGYDDEEFVKLKAKYVNENDLGGIMFWSIDNDD 385

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170052833|ref|XP_001862401.1| brain chitinase and chia [Culex quinquefasciatus] gi|167873623|gb|EDS37006.1| brain chitinase and chia [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347963356|ref|XP_001687765.2| AGAP000198-PA [Anopheles gambiae str. PEST] gi|333467238|gb|EDO64352.2| AGAP000198-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270004517|gb|EFA00965.1| hypothetical protein TcasGA2_TC003876 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91079784|ref|XP_967813.1| PREDICTED: similar to brain chitinase and chia [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008672|ref|XP_002425126.1| hypothetical protein Phum_PHUM175040 [Pediculus humanus corporis] gi|212508800|gb|EEB12388.1| hypothetical protein Phum_PHUM175040 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157132639|ref|XP_001662588.1| brain chitinase and chia [Aedes aegypti] gi|108871133|gb|EAT35358.1| AAEL012467-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|345489180|ref|XP_001601999.2| PREDICTED: hypothetical protein LOC100117876 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307180957|gb|EFN68745.1| Chitotriosidase-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307192624|gb|EFN75798.1| Acidic mammalian chitinase [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
FB|FBgn0263132 4541 Cht6 "Cht6" [Drosophila melano 0.765 0.038 0.677 2.6e-65
FB|FBgn0035398 1013 Cht7 "Cht7" [Drosophila melano 0.747 0.166 0.436 1.1e-46
UNIPROTKB|G3H3K7 719 I79_004795 "Chitinase-3-like p 0.703 0.221 0.443 5.6e-36
FB|FBgn0250907 2286 Cht3 "Chitinase 3" [Drosophila 0.747 0.073 0.414 3.2e-40
UNIPROTKB|Q6TMG6361 CHI3L1 "Chitinase-3-like prote 0.725 0.454 0.473 3.7e-39
UNIPROTKB|F1S7U3383 CHI3L1 "Chitinase-3-like prote 0.730 0.430 0.473 3.7e-39
UNIPROTKB|G3X7D2391 LOC788983 "Uncharacterized pro 0.730 0.421 0.473 6.1e-39
UNIPROTKB|P30922383 CHI3L1 "Chitinase-3-like prote 0.730 0.430 0.473 6.1e-39
UNIPROTKB|Q29411383 CHI3L1 "Chitinase-3-like prote 0.730 0.430 0.467 1.3e-38
UNIPROTKB|Q7YS85361 CHI3L1 "Chitinase-3-like prote 0.725 0.454 0.473 2.1e-38
FB|FBgn0263132 Cht6 "Cht6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 684 (245.8 bits), Expect = 2.6e-65, P = 2.6e-65
 Identities = 120/177 (67%), Positives = 151/177 (85%)

Query:    54 YDI---HRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLK 110
             YD+   ++YLD+ N+L+YD+HS+ EP+VNHH+PL+ LEED EYN++A+L+ID++IK+YLK
Sbjct:   230 YDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLK 289

Query:   111 SGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKS 170
             +GAD DKLVLGIPTYGRSYTL N ES ++GAPA+GPGEQGDATREKGYLAYYEIC +LK 
Sbjct:   290 AGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKD 349

Query:   171 D-DWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
             D +W+V  PN   MGPYA++ NQWVGYDD+ I + KA+YV  Q LGGIMFW+IDNDD
Sbjct:   350 DPEWTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDD 406
GO:0004568 "chitinase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0008061 "chitin binding" evidence=IEA
GO:0006032 "chitin catabolic process" evidence=IEA
FB|FBgn0035398 Cht7 "Cht7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3H3K7 I79_004795 "Chitinase-3-like protein 1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
FB|FBgn0250907 Cht3 "Chitinase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6TMG6 CHI3L1 "Chitinase-3-like protein 1" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7U3 CHI3L1 "Chitinase-3-like protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7D2 LOC788983 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P30922 CHI3L1 "Chitinase-3-like protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29411 CHI3L1 "Chitinase-3-like protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YS85 CHI3L1 "Chitinase-3-like protein 1" [Bubalus bubalis (taxid:89462)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 2e-75
smart00636334 smart00636, Glyco_18, Glyco_18 domain 2e-55
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 8e-44
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 1e-31
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 3e-28
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 2e-23
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 4e-23
cd02878345 cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni 3e-09
cd02875358 cd02875, GH18_chitobiase, Chitobiase (also known a 5e-06
cd02874313 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm 3e-04
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 0.002
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information 
 Score =  231 bits (592), Expect = 2e-75
 Identities = 90/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (3%)

Query: 53  SYDIH---RYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYL 109
           +YDI    +YLDF+N+++YD+H ++E    H+SPL+    D        L++D+ IK++L
Sbjct: 170 AYDIPEISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQ--KYLNVDYAIKYWL 227

Query: 110 KSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLK 169
             GA P+KLVLGIPTYGRS+TL +P +  +GAPA GPG  G  TRE G+LAYYEIC  LK
Sbjct: 228 SKGAPPEKLVLGIPTYGRSFTLASPSNTGVGAPASGPGTAGPYTREAGFLAYYEICEFLK 287

Query: 170 SDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
           S  W+V   +     PYA+KGNQWVGYDD+E    K +Y+  + LGG M WSID DD
Sbjct: 288 S-GWTVVW-DDEQKVPYAYKGNQWVGYDDEESIALKVQYLKSKGLGGAMVWSIDLDD 342

The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit Back     alignment and domain information
>gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 100.0
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 100.0
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 100.0
KOG2806|consensus432 100.0
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 100.0
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 100.0
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 100.0
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 100.0
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 100.0
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 100.0
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 100.0
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 100.0
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 99.96
COG3858423 Predicted glycosyl hydrolase [General function pre 99.93
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 99.89
KOG2091|consensus392 99.65
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 99.02
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 98.29
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 98.27
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 97.64
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 97.47
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 97.36
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 96.69
KOG2806|consensus432 96.55
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 96.34
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 96.2
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 96.2
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 95.93
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 95.68
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 95.34
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 94.94
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 93.44
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 91.43
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 91.14
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 89.73
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 89.35
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 87.17
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information 
Probab=100.00  E-value=1.4e-42  Score=296.53  Aligned_cols=171  Identities=51%  Similarity=0.976  Sum_probs=154.6

Q ss_pred             ccccc---ccccceeeeeeecCCCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCCeeeeccceeee
Q psy5813          52 VSYDI---HRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRS  128 (226)
Q Consensus        52 ~~yd~---~~~~D~v~vMtYD~~g~w~~~~g~~apl~~~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~Yg~~  128 (226)
                      ..||+   +++||||+|||||+||+|++.+||+|||+..+.++..  ....+++.+|++|++.|+|++||+||||+|||.
T Consensus       169 ~~~d~~~l~~~vD~v~vmtYD~~~~~~~~~g~~spl~~~~~~~~~--~~~~~v~~~v~~~~~~gvp~~KlvlGlp~YG~~  246 (362)
T cd02872         169 AAYDIPEISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGD--QKYLNVDYAIKYWLSKGAPPEKLVLGIPTYGRS  246 (362)
T ss_pred             hcCCHHHHhhhcceEEEecccCCCCCCCCCCCCCCCCCCCCCccc--cccccHHHHHHHHHHcCCCHHHeEeccccccce
Confidence            45776   8999999999999999999999999999976543221  245689999999999999999999999999999


Q ss_pred             eeecCCCCCCCCCCCCCCCCCCCCCCCCcceeHHHHHhhcCCCCceEeecCCCceeeEEEeCCEEEEeCCHHHHHHHHHH
Q psy5813         129 YTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKY  208 (226)
Q Consensus       129 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~g~~~y~~i~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i~ydd~~Si~~K~~~  208 (226)
                      |++.+..+.++|+|..|++..|.++.+.|.++|.|||+.+ ..+|+..| |+.+++||+|++++||+|||++||+.|++|
T Consensus       247 ~~~~~~~~~~~g~~~~g~~~~g~~~~~~g~~~y~ei~~~~-~~~~~~~~-D~~~~~~y~~~~~~~v~ydd~~Si~~K~~~  324 (362)
T cd02872         247 FTLASPSNTGVGAPASGPGTAGPYTREAGFLAYYEICEFL-KSGWTVVW-DDEQKVPYAYKGNQWVGYDDEESIALKVQY  324 (362)
T ss_pred             eeecCCccCCCCCccCCCCCCCCCcCCCccchHHHHHHhh-cCCcEEEE-eCCcceeEEEECCEEEEeCCHHHHHHHHHH
Confidence            9999888888999999988888889999999999999988 66787655 888899999999999999999999999999


Q ss_pred             HHHcCCceEEEeeccCCC
Q psy5813         209 VNDQKLGGIMFWSIDNDD  226 (226)
Q Consensus       209 ~~~~glgGv~~W~l~~DD  226 (226)
                      |+++||||+++|+|++||
T Consensus       325 ~~~~~lgGv~iW~l~~DD  342 (362)
T cd02872         325 LKSKGLGGAMVWSIDLDD  342 (362)
T ss_pred             HHhCCCceEEEEeeecCc
Confidence            999999999999999998

The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 3e-41
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 3e-41
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 3e-41
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 5e-41
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 1e-40
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 2e-40
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 3e-40
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 3e-40
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 1e-39
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 4e-39
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 7e-37
1guv_A366 Structure Of Human Chitotriosidase Length = 366 9e-37
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 1e-36
1waw_A 445 Specificity And Affinity Of Natural Product Cyclope 1e-36
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 2e-36
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 1e-31
3fxy_A395 Acidic Mammalian Chinase, Catalytic Domain Length = 1e-30
2ybt_A381 Crystal Structure Of Human Acidic Chitinase In Comp 2e-30
1e9l_A377 The Crystal Structure Of Novel Mammalian Lectin Ym1 5e-26
3alf_A353 Crystal Structure Of Class V Chitinase From Nicotia 3e-14
3alg_A353 Crystal Structure Of Class V Chitinase (E115q Mutan 3e-14
2wly_A548 Chitinase A From Serratia Marcescens Atcc990 In Com 5e-14
2wk2_A540 Chitinase A From Serratia Marcescens Atcc990 In Com 5e-14
1rd6_A563 Crystal Structure Of S. Marcescens Chitinase A Muta 5e-14
1nh6_A540 Structure Of S. Marcescens Chitinase A, E315l, Comp 5e-14
1edq_A540 Crystal Structure Of Chitinase A From S. Marcescens 1e-13
1ehn_A540 Crystal Structure Of Chitinase A Mutant E315q Compl 2e-13
1eib_A540 Crystal Structure Of Chitinase A Mutant D313a Compl 2e-13
1ctn_A540 Crystal Structure Of A Bacterial Chitinase At 2.3 A 2e-13
1ll7_A392 Structure Of The E171q Mutant Of C. Immitis Chitina 3e-13
1ffr_A540 Crystal Structure Of Chitinase A Mutant Y390f Compl 3e-13
1d2k_A392 C. Immitis Chitinase 1 At 2.2 Angstroms Resolution 3e-13
1ll6_A392 Structure Of The D169n Mutant Of C. Immitis Chitina 3e-13
1kfw_A435 Structure Of Catalytic Domain Of Psychrophilic Chit 5e-13
1k9t_A540 Chitinase A Complexed With Tetra-N-Acetylchitotrios 1e-12
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 3e-12
1itx_A419 Catalytic Domain Of Chitinase A1 From Bacillus Circ 3e-12
1w9p_A433 Specificity And Affinity Of Natural Product Cyclope 5e-12
1wno_A395 Crystal Structure Of A Native Chitinase From Asperg 5e-12
3aqu_A356 Crystal Structure Of A Class V Chitinase From Arabi 3e-11
1h0g_A499 Complex Of A Chitinase With The Natural Product Cyc 8e-11
1ogb_A499 Chitinase B From Serratia Marcescens Mutant D142n L 8e-11
1e6n_B499 Chitinase B From Serratia Marcescens Inactive Mutan 8e-11
1e15_A499 Chitinase B From Serratia Marcescens Length = 499 8e-11
1goi_A499 Crystal Structure Of The D140n Mutant Of Chitinase 8e-11
1ur9_A499 Interactions Of A Family 18 Chitinase With The Desi 9e-11
1e6z_A498 Chitinase B From Serratia Marcescens Wildtype In Co 9e-11
3g6l_A406 The Crystal Structure Of A Chitinase Crchi1 From Th 2e-09
3ars_A584 Crystal Structure Analysis Of Chitinase A From Vibr 2e-06
3b9a_A584 Crystal Structure Of Vibrio Harveyi Chitinase A Com 3e-06
3b8s_A584 Crystal Structure Of Wild-Type Chitinase A From Vib 3e-06
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
Query: 56  IHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADP 115
           I R+LDF+++L+YD+H A+   V HHSPLF  +ED    F    + D+ + + L+ GA  
Sbjct: 173 ISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFS---NADYAVSYMLRLGAPA 229
Query: 116 DKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSV 175
           +KLV+GIPT+G+S+TL + +++ +GAP  GPG  G  T+EKG LAYYEIC  L+    + 
Sbjct: 230 NKLVMGIPTFGKSFTLASSKTD-VGAPVSGPGIPGQFTKEKGILAYYEICDFLQG---AT 285
Query: 176 EHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
            H       PYA KGNQWV YDDQE  K+KA+Y+ +++L G M W++D DD
Sbjct: 286 THRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDD 336
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure
>pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 Back     alignment and structure
>pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 Back     alignment and structure
>pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 Back     alignment and structure
>pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 Back     alignment and structure
>pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 Back     alignment and structure
>pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 Back     alignment and structure
>pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 Back     alignment and structure
>pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 Back     alignment and structure
>pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 Back     alignment and structure
>pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 Back     alignment and structure
>pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 Back     alignment and structure
>pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 Back     alignment and structure
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure
>pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 Back     alignment and structure
>pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 Back     alignment and structure
>pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 Back     alignment and structure
>pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 Back     alignment and structure
>pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 Back     alignment and structure
>pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 Back     alignment and structure
>pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 Back     alignment and structure
>pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 Back     alignment and structure
>pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 Back     alignment and structure
>pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 Back     alignment and structure
>pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 Back     alignment and structure
>pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 Back     alignment and structure
>pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 Back     alignment and structure
>pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 Back     alignment and structure
>pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 3e-73
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 7e-73
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 3e-72
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 6e-72
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 1e-70
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 3e-68
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 4e-05
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 5e-68
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 4e-06
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 7e-64
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 3e-61
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 5e-60
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 9e-60
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 2e-59
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 4e-59
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 2e-58
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 2e-58
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 8e-58
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 2e-53
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 8e-52
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 1e-38
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 2e-05
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 5e-33
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 9e-20
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 1e-13
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 4e-12
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
 Score =  228 bits (582), Expect = 3e-73
 Identities = 70/177 (39%), Positives = 105/177 (59%), Gaps = 9/177 (5%)

Query: 53  SYD---IHRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYL 109
            Y+   I + LDF+N+++YD+H ++E    H+SPL+  +E+      A L++D  ++ +L
Sbjct: 173 GYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAA--ASLNVDAAVQQWL 230

Query: 110 KSGADPDKLVLGIPTYGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLK 169
           + G    KL+LG+PTYGRS+TL +    ++GAPA G G  G  T+E G LAYYE+C    
Sbjct: 231 QKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVC---S 287

Query: 170 SDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKYVNDQKLGGIMFWSIDNDD 226
               + +        PY F+ NQWVG+DD E  K K  Y+  + LGG M W++D DD
Sbjct: 288 WKGATKQR-IQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDD 343
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 100.0
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 100.0
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 100.0
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 100.0
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 100.0
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 100.0
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 100.0
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 100.0
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 100.0
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 100.0
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 100.0
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 100.0
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 100.0
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 100.0
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 100.0
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 100.0
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.98
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 99.41
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 99.31
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 99.1
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 99.07
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 98.94
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 98.92
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 98.86
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 98.59
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 98.37
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 98.33
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 98.21
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 98.12
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 98.06
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 97.85
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 97.22
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 97.2
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 97.09
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 97.0
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 96.99
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 96.99
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 96.95
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 96.87
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 96.87
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 96.79
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 96.76
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 96.74
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 96.63
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 96.62
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 96.55
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 96.55
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 96.41
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 96.34
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 96.09
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 94.14
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 93.72
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 91.84
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 90.0
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 86.97
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 86.41
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 86.26
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 85.96
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 85.72
2nlv_A112 XISI protein-like; XISI-like protein, structural g 84.61
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 84.41
2nwv_A114 XISI protein-like; YP_323822.1, structural genomic 83.73
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 83.17
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-45  Score=315.67  Aligned_cols=171  Identities=39%  Similarity=0.772  Sum_probs=154.9

Q ss_pred             ccccc---ccccceeeeeeecCCCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCCeeeeccceeee
Q psy5813          52 VSYDI---HRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRS  128 (226)
Q Consensus        52 ~~yd~---~~~~D~v~vMtYD~~g~w~~~~g~~apl~~~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~Yg~~  128 (226)
                      .+||+   +++||||||||||+||+|+..+||+|||+..+.+...  ....+++.+|++|+++|+|++|||||||+|||.
T Consensus       172 ~~~d~~~l~~~vD~inlMtYD~~g~w~~~~g~~apl~~~~~~~~~--~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~  249 (395)
T 3fy1_A          172 SGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGS--NAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHN  249 (395)
T ss_dssp             HHCCHHHHHHHCSEEEECCCCCSCGGGSBCCCSSCSSCCTTCCGG--GGGCSHHHHHHHHHHTTCCGGGEEEEEESEEEE
T ss_pred             cchhHHHHHhhcceeeeecccccCCCCCCCCCCCcCcCCCCCccc--cccccHHHHHHHHHHcCCCHHHEEEEeccccce
Confidence            45776   8999999999999999999999999999987654321  234689999999999999999999999999999


Q ss_pred             eeecCCCCCCCCCCCCCCCCCCCCCCCCcceeHHHHHhhcCCCCceEeecCCCceeeEEEeCCEEEEeCCHHHHHHHHHH
Q psy5813         129 YTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKY  208 (226)
Q Consensus       129 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~g~~~y~~i~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i~ydd~~Si~~K~~~  208 (226)
                      |++.++.+.++|+|+.|++..|.++.+.|+++|.|||+.++. +++.. ||+.+++||+|++++||+|||++|+++|++|
T Consensus       250 ~~~~~~~~~~~g~p~~g~~~~G~~t~~~G~~~y~ei~~~~~~-g~~~~-~D~~~~~~y~~~~~~~v~ydd~~Si~~K~~~  327 (395)
T 3fy1_A          250 FILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKN-GATQG-WDAPQEVPYAYQGNVWVGYDNVKSFDIKAQW  327 (395)
T ss_dssp             EEESSTTCCSTTCBEEEECCCCTTTCCTTEEEHHHHHHHHHT-TCEEE-EETTTTEEEEEETTEEEECCCHHHHHHHHHH
T ss_pred             eEecCCCCCCCCCcccCCCCCCcccCCCceeeHHHHHHHhcc-CCeEE-EecccceEEEEECCEEEEeCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999988764 55654 5889999999999999999999999999999


Q ss_pred             HHHcCCceEEEeeccCCC
Q psy5813         209 VNDQKLGGIMFWSIDNDD  226 (226)
Q Consensus       209 ~~~~glgGv~~W~l~~DD  226 (226)
                      |+++||||+|+|+|++||
T Consensus       328 ~~~~gLgG~~~W~ld~DD  345 (395)
T 3fy1_A          328 LKHNKFGGAMVWAIDLDD  345 (395)
T ss_dssp             HHHTTCSEEEEECGGGSC
T ss_pred             HHhCCCCEEEEEccccCc
Confidence            999999999999999998
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>2nlv_A XISI protein-like; XISI-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.30A {Anabaena variabilis} SCOP: d.326.1.1 Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>2nwv_A XISI protein-like; YP_323822.1, structural genomics, PSI-2, structure initiative, joint center for structural genomics; 1.85A {Anabaena variabilis} SCOP: d.326.1.1 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1wb0a268 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo 1e-24
d1vf8a270 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo 2e-24
d2pi6a268 d.26.3.1 (A:240-307) Signal processing protein (SP 4e-24
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 3e-23
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 1e-21
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 0.002
d1jnda292 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 3e-19
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 4e-16
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 2e-04
d1itxa272 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul 9e-16
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 1e-14
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 9e-05
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 9e-14
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 9e-07
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 9e-13
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 2e-09
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 4e-12
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 3e-09
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 4e-12
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 6e-08
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 7e-12
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 9e-10
d1kfwa261 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar 4e-11
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 7e-11
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 3e-10
d1edqa373 d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc 6e-10
d2ebna_285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 5e-07
d1nara_289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 3e-04
d1edta_265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 0.003
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: Chitinase insertion domain
family: Chitinase insertion domain
domain: Chitotriosidase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.7 bits (225), Expect = 1e-24
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 125 YGRSYTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMG 184
           YGRS+TL +    ++GAPA G G  G  T+E G LAYYE+CS   +              
Sbjct: 1   YGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQ----RIQDQKV 56

Query: 185 PYAFKGNQWVGY 196
           PY F+ NQWVG+
Sbjct: 57  PYIFRDNQWVGF 68
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 99.95
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.94
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.94
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.93
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 99.93
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.93
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 99.92
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 99.92
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 99.91
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 99.9
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 99.76
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.7
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 99.68
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.48
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.45
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 99.4
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.24
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 99.04
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 99.03
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 98.81
d1ll7a262 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 98.68
d1w9pa262 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 98.67
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 98.56
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 98.23
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 97.67
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 97.31
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 97.12
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 97.05
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 96.94
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 96.78
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 96.77
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 96.7
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 96.57
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 96.56
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 96.48
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 96.3
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 96.13
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 81.66
d2nlva1111 Hypothetical protein Ava3825 {Anabaena variabilis 81.07
d2nwva1112 Hypothetical protein Ava3320 {Anabaena variabilis 80.94
d2nvma1117 XisI {Anabaena variabilis [TaxId: 1172]} 80.04
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Signal processing protein (SPC-40, MGP-40)
species: Sheep (Ovis aries) [TaxId: 9940]

Probab=99.95  E-value=3.3e-28  Score=199.05  Aligned_cols=100  Identities=46%  Similarity=0.826  Sum_probs=90.2

Q ss_pred             ccccc---ccccceeeeeeecCCCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCCeeeeccceeee
Q psy5813          52 VSYDI---HRYLDFMNILSYDYHSAFEPAVNHHSPLFPLEEDGEYNFEAQLSIDHTIKHYLKSGADPDKLVLGIPTYGRS  128 (226)
Q Consensus        52 ~~yd~---~~~~D~v~vMtYD~~g~w~~~~g~~apl~~~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~Yg~~  128 (226)
                      .+|++   .++||||+|||||+||.|++.+||+|||+.....+.   ....+++.+|++|++.|+|++||+||||     
T Consensus       166 ~~~~~~~l~~~vD~invMtYD~~g~~~~~~g~~apL~~~~~~~~---~~~~~v~~~v~~~~~~Gvp~~KlvlGip-----  237 (292)
T d2pi6a1         166 RGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDAS---SRFSNADYAVSYMLRLGAPANKLVMGIP-----  237 (292)
T ss_dssp             HHCCHHHHHHHCSEEEEETTCCSCTTCCBCCCSSCSSCCSSSCS---CTTSSHHHHHHHHHHTTCCGGGEEEEEE-----
T ss_pred             ccccHHHHHhhCCEEEEecccccCCCCCccccCCCCCCCCcccC---cCCccHHHHHHHHHHCCCCHHHeEEEec-----
Confidence            45666   889999999999999999999999999997655432   2446899999999999999999999987     


Q ss_pred             eeecCCCCCCCCCCCCCCCCCCCCCCCCcceeHHHHHhhcCCCCceEeecCCCceeeEEEeCCEEEEeCCHHHHHHHHHH
Q psy5813         129 YTLFNPESNQIGAPADGPGEQGDATREKGYLAYYEICSSLKSDDWSVEHPNPRAMGPYAFKGNQWVGYDDQEIAKDKAKY  208 (226)
Q Consensus       129 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~g~~~y~~i~~~~~~~~~~~~~~d~~~~~~y~~~~~~~i~ydd~~Si~~K~~~  208 (226)
                                                                                         |||++||++|++|
T Consensus       238 -------------------------------------------------------------------ydd~~Si~~K~~~  250 (292)
T d2pi6a1         238 -------------------------------------------------------------------TDDQESVKNKARY  250 (292)
T ss_dssp             -------------------------------------------------------------------SCCHHHHHHHHHH
T ss_pred             -------------------------------------------------------------------CCCHHHHHHHHHH
Confidence                                                                               6999999999999


Q ss_pred             HHHcCCceEEEeeccCCC
Q psy5813         209 VNDQKLGGIMFWSIDNDD  226 (226)
Q Consensus       209 ~~~~glgGv~~W~l~~DD  226 (226)
                      |+++||||||+|+|++||
T Consensus       251 ~~~~~lgGv~iW~l~~DD  268 (292)
T d2pi6a1         251 LKNRQLAGAMVWALDLDD  268 (292)
T ss_dssp             HHHTTCSEEEEECGGGSC
T ss_pred             HHHCCCceEEEEeccccc
Confidence            999999999999999998
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d2nlva1 d.326.1.1 (A:1-111) Hypothetical protein Ava3825 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2nwva1 d.326.1.1 (A:2-113) Hypothetical protein Ava3320 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2nvma1 d.326.1.1 (A:2-118) XisI {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure