Psyllid ID: psy5849
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 59 | ||||||
| 170047853 | 507 | cytochrome P450 4d10 [Culex quinquefasci | 1.0 | 0.116 | 0.525 | 5e-10 | |
| 290349628 | 510 | cytochrome P450 [Culex quinquefasciatus] | 1.0 | 0.115 | 0.508 | 1e-09 | |
| 170047851 | 510 | cytochrome P450 4d10 [Culex quinquefasci | 1.0 | 0.115 | 0.508 | 1e-09 | |
| 6224862 | 148 | cytochrome P450 [Culex pipiens pallens] | 1.0 | 0.398 | 0.508 | 2e-09 | |
| 158291006 | 505 | AGAP002419-PA [Anopheles gambiae str. PE | 1.0 | 0.116 | 0.491 | 3e-09 | |
| 18139591 | 151 | cytochrome P450 CYP4D22 [Anopheles gambi | 1.0 | 0.390 | 0.491 | 3e-09 | |
| 6224794 | 148 | cytochrome P450 [Culex pipiens pallens] | 1.0 | 0.398 | 0.491 | 3e-09 | |
| 328707583 | 664 | PREDICTED: cytochrome P450 4C1-like [Acy | 0.983 | 0.087 | 0.525 | 4e-09 | |
| 290349626 | 507 | cytochrome P450 [Culex quinquefasciatus] | 1.0 | 0.116 | 0.508 | 4e-09 | |
| 195133608 | 611 | GI16116 [Drosophila mojavensis] gi|19390 | 0.983 | 0.094 | 0.482 | 5e-09 |
| >gi|170047853|ref|XP_001851422.1| cytochrome P450 4d10 [Culex quinquefasciatus] gi|167870114|gb|EDS33497.1| cytochrome P450 4d10 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 68.2 bits (165), Expect = 5e-10, Method: Compositional matrix adjust.
Identities = 31/59 (52%), Positives = 41/59 (69%)
Query: 1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK 59
+LA HP++Q++VYDE+ V GDDP T + EL+ L VIKETLRLYP+ PI +K
Sbjct: 328 VLAKHPEVQKKVYDEVRNVFGDDPSKPATLAMLNELNYLDMVIKETLRLYPSVPIFGRK 386
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|290349628|dbj|BAI77922.1| cytochrome P450 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170047851|ref|XP_001851421.1| cytochrome P450 4d10 [Culex quinquefasciatus] gi|167870113|gb|EDS33496.1| cytochrome P450 4d10 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|6224862|gb|AAF05986.1|AF191728_1 cytochrome P450 [Culex pipiens pallens] | Back alignment and taxonomy information |
|---|
| >gi|158291006|ref|XP_312527.4| AGAP002419-PA [Anopheles gambiae str. PEST] gi|157018168|gb|EAA44936.4| AGAP002419-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|18139591|gb|AAL58562.1| cytochrome P450 CYP4D22 [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|6224794|gb|AAF05952.1|AF190775_1 cytochrome P450 [Culex pipiens pallens] | Back alignment and taxonomy information |
|---|
| >gi|328707583|ref|XP_001952439.2| PREDICTED: cytochrome P450 4C1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|290349626|dbj|BAI77921.1| cytochrome P450 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195133608|ref|XP_002011231.1| GI16116 [Drosophila mojavensis] gi|193907206|gb|EDW06073.1| GI16116 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 59 | ||||||
| FB|FBgn0031925 | 511 | Cyp4d21 "Cyp4d21" [Drosophila | 0.966 | 0.111 | 0.456 | 6.3e-09 | |
| FB|FBgn0035344 | 510 | Cyp4d20 "Cyp4d20" [Drosophila | 0.966 | 0.111 | 0.456 | 1.7e-08 | |
| FB|FBgn0005670 | 512 | Cyp4d1 "Cytochrome P450-4d1" [ | 0.983 | 0.113 | 0.379 | 2.2e-08 | |
| UNIPROTKB|F1NZ08 | 476 | CYP27C1 "Uncharacterized prote | 0.881 | 0.109 | 0.5 | 6.8e-08 | |
| FB|FBgn0023541 | 507 | Cyp4d14 "Cyp4d14" [Drosophila | 0.983 | 0.114 | 0.448 | 1.2e-07 | |
| WB|WBGene00021412 | 503 | cyp-29A3 [Caenorhabditis elega | 0.983 | 0.115 | 0.431 | 2e-07 | |
| FB|FBgn0015033 | 463 | Cyp4d8 "Cytochrome P450-4d8" [ | 0.983 | 0.125 | 0.431 | 2.9e-07 | |
| WB|WBGene00021167 | 516 | cyp-32B1 [Caenorhabditis elega | 0.983 | 0.112 | 0.396 | 3.4e-07 | |
| FB|FBgn0038236 | 492 | Cyp313a1 "Cyp313a1" [Drosophil | 1.0 | 0.119 | 0.474 | 6.6e-07 | |
| FB|FBgn0036778 | 510 | Cyp312a1 "Cyp312a1" [Drosophil | 0.983 | 0.113 | 0.396 | 9e-07 |
| FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 142 (55.0 bits), Expect = 6.3e-09, P = 6.3e-09
Identities = 26/57 (45%), Positives = 40/57 (70%)
Query: 2 LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK 58
++ HPK+Q+ +Y+E+V VLG DP+ T ++ EL L VIKET+RL+P PI+ +
Sbjct: 332 ISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGR 388
|
|
| FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005670 Cyp4d1 "Cytochrome P450-4d1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZ08 CYP27C1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021412 cyp-29A3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021167 cyp-32B1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038236 Cyp313a1 "Cyp313a1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036778 Cyp312a1 "Cyp312a1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 59 | |||
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 8e-16 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 7e-11 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 4e-09 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 2e-08 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 4e-08 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 9e-08 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 5e-07 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 1e-06 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 3e-06 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 6e-04 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 7e-04 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 7e-04 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 7e-04 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 0.004 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
Score = 68.8 bits (169), Expect = 8e-16
Identities = 26/53 (49%), Positives = 37/53 (69%), Gaps = 2/53 (3%)
Query: 2 LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAP 54
LA HP++Q+++ +EI +V+GD PTYD +Q + L VIKETLRL+P P
Sbjct: 288 LAKHPEVQEKLREEIDEVIGDK--RSPTYDDLQNMPYLDAVIKETLRLHPVVP 338
|
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461 |
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 59 | |||
| KOG0156|consensus | 489 | 99.78 | ||
| KOG0158|consensus | 499 | 99.78 | ||
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.76 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.73 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.73 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.72 | |
| KOG0159|consensus | 519 | 99.72 | ||
| PLN02500 | 490 | cytochrome P450 90B1 | 99.72 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.71 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.71 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.71 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.7 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.69 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.69 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.69 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.68 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.68 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.68 | |
| KOG0157|consensus | 497 | 99.68 | ||
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.67 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.67 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.65 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.65 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.65 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.64 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.63 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.61 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.58 | |
| PLN02648 | 480 | allene oxide synthase | 99.56 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.54 | |
| KOG0684|consensus | 486 | 99.51 | ||
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 98.44 | |
| PF05952 | 57 | ComX: Bacillus competence pheromone ComX; InterPro | 87.19 |
| >KOG0156|consensus | Back alignment and domain information |
|---|
Probab=99.78 E-value=3.9e-19 Score=96.51 Aligned_cols=57 Identities=33% Similarity=0.577 Sum_probs=51.2
Q ss_pred CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCcc-cccC
Q psy5849 1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPI-IAKK 59 (59)
Q Consensus 1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~-~~r~ 59 (59)
+|++||++|+|+++||+.++|. +..++.+|..++||++|+|+|++|++|++|. ++|.
T Consensus 312 ~Ll~~Pev~~K~qeEId~vvG~--~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~ 369 (489)
T KOG0156|consen 312 ELLNNPEVQKKLQEEIDEVVGK--GRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRE 369 (489)
T ss_pred HHHhCHHHHHHHHHHHHHHhCC--CCCCChhhhccCHHHHHHHHHHHhcCCCcccccccc
Confidence 4789999999999999999985 4448899999999999999999999999998 6663
|
|
| >KOG0158|consensus | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF05952 ComX: Bacillus competence pheromone ComX; InterPro: IPR009233 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 59 | ||||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 1e-05 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 1e-05 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 1e-05 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 2e-04 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 2e-04 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 5e-04 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 5e-04 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 5e-04 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 5e-04 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 5e-04 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 5e-04 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 5e-04 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 5e-04 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 5e-04 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 5e-04 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 5e-04 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 5e-04 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 5e-04 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 5e-04 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 5e-04 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 5e-04 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 5e-04 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 5e-04 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 5e-04 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 5e-04 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 5e-04 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 5e-04 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 5e-04 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 5e-04 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 5e-04 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 5e-04 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 5e-04 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 5e-04 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 5e-04 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 6e-04 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 6e-04 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 6e-04 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 8e-04 |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
|
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 59 | |||
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 1e-20 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 3e-20 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 4e-19 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 4e-19 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 4e-19 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 6e-19 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 1e-17 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 4e-17 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 6e-17 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 1e-16 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 2e-16 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 3e-16 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 1e-15 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 2e-14 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 4e-14 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 1e-12 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 2e-09 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 7e-08 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 2e-07 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 5e-07 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 2e-06 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 3e-06 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 3e-06 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 5e-06 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 6e-06 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 1e-05 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 2e-05 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 2e-05 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 3e-05 |
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
Score = 81.9 bits (203), Expect = 1e-20
Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
Query: 2 LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIA 57
L+ P+I + E+ +V+G ++ + L L++V+KE+LRLYP A
Sbjct: 270 LSRQPEIVARLQAEVDEVIGSKRY--LDFEDLGRLQYLSQVLKESLRLYPPAWGTF 323
|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 59 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 99.74 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 99.73 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 99.72 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.72 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.7 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.7 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.69 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.69 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.69 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.68 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.68 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.68 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.68 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.68 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.68 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 99.67 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.65 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.65 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 99.65 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.65 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.65 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.61 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.58 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.57 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.57 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.53 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.43 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.41 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.02 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 98.96 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 98.95 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 98.94 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 98.93 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 98.93 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 98.93 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 98.91 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 98.91 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 98.9 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 98.9 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 98.88 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 98.87 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 98.87 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 98.87 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 98.86 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 98.85 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 98.84 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 98.84 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 98.83 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 98.83 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 98.82 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 98.81 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 98.81 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 98.81 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 98.81 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 98.8 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 98.79 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 98.78 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 98.78 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 98.76 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 98.75 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 98.74 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 98.72 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 98.71 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 98.71 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 98.71 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 98.69 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 98.66 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 98.65 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 98.64 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 98.63 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 98.62 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 98.61 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 98.56 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 98.42 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 98.37 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 97.76 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 90.39 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=99.74 E-value=3.1e-18 Score=90.43 Aligned_cols=56 Identities=29% Similarity=0.446 Sum_probs=50.1
Q ss_pred CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCccccc
Q psy5849 1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK 58 (59)
Q Consensus 1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~~~r 58 (59)
+|+.||++|+|+++|++.+++. +..++++++.+|||++||++|++|++|+++...|
T Consensus 298 ~L~~~P~~q~kl~~Ei~~~~~~--~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~ 353 (479)
T 3tbg_A 298 LMILHPDVQRRVQQEIDDVIGQ--VRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVT 353 (479)
T ss_dssp HHHHCHHHHHHHHHHHHHHTCS--SSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCC
T ss_pred HhccCHHHHHHHHHHHHHHHhh--ccccchhhhccccccccceeeeccccccccccce
Confidence 3788999999999999999875 5678999999999999999999999999988443
|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 59 | |||
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.67 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 99.64 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.63 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 99.6 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.58 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.5 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.16 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 98.62 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 97.81 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 97.72 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 96.69 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 95.92 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 95.15 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 95.08 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 95.06 | |
| d1mo6a2 | 60 | RecA protein, C-terminal domain {Mycobacterium tub | 90.02 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 89.63 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 89.03 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 88.8 | |
| d1xp8a2 | 59 | RecA protein, C-terminal domain {Deinococcus radio | 82.97 | |
| d1u94a2 | 60 | RecA protein, C-terminal domain {Escherichia coli | 80.07 |
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome p450 2c9 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.67 E-value=2.3e-17 Score=85.15 Aligned_cols=56 Identities=23% Similarity=0.396 Sum_probs=50.0
Q ss_pred CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCccccc
Q psy5849 1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK 58 (59)
Q Consensus 1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~~~r 58 (59)
+|+.||++|+++++|++++++. +..+++.++.++||++||++|++|++|+++.+.|
T Consensus 287 ~L~~~p~~~~~l~~Ei~~~~~~--~~~~~~~~~~~l~yL~a~i~E~lRl~p~~~~~~r 342 (467)
T d1r9oa_ 287 LLLKHPEVTAKVQEEIERVIGR--NRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLP 342 (467)
T ss_dssp HHHHCHHHHHHHHHHHHHHTCS--SSCCCGGGGGGCHHHHHHHHHHHHHHTSSTTCSC
T ss_pred HhhcCchHHHHHHhhhhhhcCC--CCCCcHHHhhhhhhhhhhccccccccccCCcccc
Confidence 3688999999999999999975 5678888999999999999999999999988655
|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1mo6a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a2 d.48.1.1 (A:269-328) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|