Psyllid ID: psy5849

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------6
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK
cccccHHHHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHccccccccccccc
cccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccEEccc
MLALHPKIQQEVYDEIVQVlgddpetvptydQIQELHLLTRVIKETLrlypaapiiakk
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKEtlrlypaapiiakk
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK
*********QEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPII***
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK
*LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query59 2.2.26 [Sep-21-2011]
O18596 513 Cytochrome P450 4d10 OS=D N/A N/A 0.983 0.113 0.465 4e-09
Q9VLZ7 511 Probable cytochrome P450 yes N/A 0.966 0.111 0.456 2e-08
O16805 512 Cytochrome P450 4d1 OS=Dr N/A N/A 0.983 0.113 0.379 8e-08
P33269 512 Cytochrome P450 4d1 OS=Dr no N/A 0.983 0.113 0.379 8e-08
O46051 507 Probable cytochrome P450 no N/A 0.983 0.114 0.448 1e-07
Q9W011 510 Probable cytochrome P450 no N/A 0.966 0.111 0.456 2e-07
Q9VVN6 510 Probable cytochrome P450 no N/A 0.983 0.113 0.396 7e-07
Q9VFJ0 492 Probable cytochrome P450 no N/A 1.0 0.119 0.474 7e-07
Q9VS79 463 Cytochrome P450 4d8 OS=Dr no N/A 0.983 0.125 0.431 8e-07
Q9VA27 535 Cytochrome P450 4c3 OS=Dr no N/A 0.983 0.108 0.362 3e-06
>sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 41/58 (70%)

Query: 2   LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK 59
           +AL+P+ Q++  +EIV VLG D ET  TYD +  L+ +   IKETLR+YP+ P++ +K
Sbjct: 333 IALYPECQRKCVEEIVSVLGKDTETPVTYDLLNNLNYMDLCIKETLRMYPSVPLLGRK 390
May play an important role in the maintenance of specific insect-host plant relationships. May be involved in xenobiotic metabolism.
Drosophila mettleri (taxid: 7228)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 Back     alignment and function description
>sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 Back     alignment and function description
>sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 Back     alignment and function description
>sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 Back     alignment and function description
>sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 Back     alignment and function description
>sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VFJ0|CP131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 Back     alignment and function description
>sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 Back     alignment and function description
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
170047853 507 cytochrome P450 4d10 [Culex quinquefasci 1.0 0.116 0.525 5e-10
290349628 510 cytochrome P450 [Culex quinquefasciatus] 1.0 0.115 0.508 1e-09
170047851 510 cytochrome P450 4d10 [Culex quinquefasci 1.0 0.115 0.508 1e-09
6224862148 cytochrome P450 [Culex pipiens pallens] 1.0 0.398 0.508 2e-09
158291006 505 AGAP002419-PA [Anopheles gambiae str. PE 1.0 0.116 0.491 3e-09
18139591151 cytochrome P450 CYP4D22 [Anopheles gambi 1.0 0.390 0.491 3e-09
6224794148 cytochrome P450 [Culex pipiens pallens] 1.0 0.398 0.491 3e-09
328707583 664 PREDICTED: cytochrome P450 4C1-like [Acy 0.983 0.087 0.525 4e-09
290349626 507 cytochrome P450 [Culex quinquefasciatus] 1.0 0.116 0.508 4e-09
195133608 611 GI16116 [Drosophila mojavensis] gi|19390 0.983 0.094 0.482 5e-09
>gi|170047853|ref|XP_001851422.1| cytochrome P450 4d10 [Culex quinquefasciatus] gi|167870114|gb|EDS33497.1| cytochrome P450 4d10 [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 1   MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAKK 59
           +LA HP++Q++VYDE+  V GDDP    T   + EL+ L  VIKETLRLYP+ PI  +K
Sbjct: 328 VLAKHPEVQKKVYDEVRNVFGDDPSKPATLAMLNELNYLDMVIKETLRLYPSVPIFGRK 386

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|290349628|dbj|BAI77922.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170047851|ref|XP_001851421.1| cytochrome P450 4d10 [Culex quinquefasciatus] gi|167870113|gb|EDS33496.1| cytochrome P450 4d10 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|6224862|gb|AAF05986.1|AF191728_1 cytochrome P450 [Culex pipiens pallens] Back     alignment and taxonomy information
>gi|158291006|ref|XP_312527.4| AGAP002419-PA [Anopheles gambiae str. PEST] gi|157018168|gb|EAA44936.4| AGAP002419-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|18139591|gb|AAL58562.1| cytochrome P450 CYP4D22 [Anopheles gambiae] Back     alignment and taxonomy information
>gi|6224794|gb|AAF05952.1|AF190775_1 cytochrome P450 [Culex pipiens pallens] Back     alignment and taxonomy information
>gi|328707583|ref|XP_001952439.2| PREDICTED: cytochrome P450 4C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|290349626|dbj|BAI77921.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195133608|ref|XP_002011231.1| GI16116 [Drosophila mojavensis] gi|193907206|gb|EDW06073.1| GI16116 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
FB|FBgn0031925 511 Cyp4d21 "Cyp4d21" [Drosophila 0.966 0.111 0.456 6.3e-09
FB|FBgn0035344 510 Cyp4d20 "Cyp4d20" [Drosophila 0.966 0.111 0.456 1.7e-08
FB|FBgn0005670 512 Cyp4d1 "Cytochrome P450-4d1" [ 0.983 0.113 0.379 2.2e-08
UNIPROTKB|F1NZ08 476 CYP27C1 "Uncharacterized prote 0.881 0.109 0.5 6.8e-08
FB|FBgn0023541 507 Cyp4d14 "Cyp4d14" [Drosophila 0.983 0.114 0.448 1.2e-07
WB|WBGene00021412 503 cyp-29A3 [Caenorhabditis elega 0.983 0.115 0.431 2e-07
FB|FBgn0015033 463 Cyp4d8 "Cytochrome P450-4d8" [ 0.983 0.125 0.431 2.9e-07
WB|WBGene00021167 516 cyp-32B1 [Caenorhabditis elega 0.983 0.112 0.396 3.4e-07
FB|FBgn0038236 492 Cyp313a1 "Cyp313a1" [Drosophil 1.0 0.119 0.474 6.6e-07
FB|FBgn0036778 510 Cyp312a1 "Cyp312a1" [Drosophil 0.983 0.113 0.396 9e-07
FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 6.3e-09, P = 6.3e-09
 Identities = 26/57 (45%), Positives = 40/57 (70%)

Query:     2 LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK 58
             ++ HPK+Q+ +Y+E+V VLG DP+   T  ++ EL  L  VIKET+RL+P  PI+ +
Sbjct:   332 ISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGR 388
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0007618 "mating" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005670 Cyp4d1 "Cytochrome P450-4d1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ08 CYP27C1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00021412 cyp-29A3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00021167 cyp-32B1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0038236 Cyp313a1 "Cyp313a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036778 Cyp312a1 "Cyp312a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
pfam00067 461 pfam00067, p450, Cytochrome P450 8e-16
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 7e-11
PLN02426 502 PLN02426, PLN02426, cytochrome P450, family 94, su 4e-09
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-08
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-08
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 9e-08
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 5e-07
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-06
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 3e-06
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 6e-04
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 7e-04
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 7e-04
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 7e-04
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 0.004
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 68.8 bits (169), Expect = 8e-16
 Identities = 26/53 (49%), Positives = 37/53 (69%), Gaps = 2/53 (3%)

Query: 2   LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAP 54
           LA HP++Q+++ +EI +V+GD     PTYD +Q +  L  VIKETLRL+P  P
Sbjct: 288 LAKHPEVQEKLREEIDEVIGDK--RSPTYDDLQNMPYLDAVIKETLRLHPVVP 338

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 59
KOG0156|consensus 489 99.78
KOG0158|consensus 499 99.78
PLN02971 543 tryptophan N-hydroxylase 99.76
PLN02290 516 cytokinin trans-hydroxylase 99.73
PLN02394 503 trans-cinnamate 4-monooxygenase 99.73
PLN02183 516 ferulate 5-hydroxylase 99.72
KOG0159|consensus 519 99.72
PLN02500 490 cytochrome P450 90B1 99.72
PTZ00404 482 cytochrome P450; Provisional 99.71
PLN03234 499 cytochrome P450 83B1; Provisional 99.71
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.71
PLN02738 633 carotene beta-ring hydroxylase 99.7
PLN02966 502 cytochrome P450 83A1 99.69
PLN02774 463 brassinosteroid-6-oxidase 99.69
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.69
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.68
PLN00168 519 Cytochrome P450; Provisional 99.68
PLN03112 514 cytochrome P450 family protein; Provisional 99.68
KOG0157|consensus 497 99.68
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.67
PLN02687 517 flavonoid 3'-monooxygenase 99.67
PLN02936 489 epsilon-ring hydroxylase 99.65
PLN03018 534 homomethionine N-hydroxylase 99.65
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.65
PLN02655 466 ent-kaurene oxidase 99.64
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.63
PLN02196 463 abscisic acid 8'-hydroxylase 99.61
PLN02302 490 ent-kaurenoic acid oxidase 99.58
PLN02648 480 allene oxide synthase 99.56
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.54
KOG0684|consensus 486 99.51
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.44
PF0595257 ComX: Bacillus competence pheromone ComX; InterPro 87.19
>KOG0156|consensus Back     alignment and domain information 
Probab=99.78  E-value=3.9e-19  Score=96.51  Aligned_cols=57  Identities=33%  Similarity=0.577  Sum_probs=51.2

Q ss_pred             CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCcc-cccC
Q psy5849           1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPI-IAKK   59 (59)
Q Consensus         1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~-~~r~   59 (59)
                      +|++||++|+|+++||+.++|.  +..++.+|..++||++|+|+|++|++|++|. ++|.
T Consensus       312 ~Ll~~Pev~~K~qeEId~vvG~--~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~  369 (489)
T KOG0156|consen  312 ELLNNPEVQKKLQEEIDEVVGK--GRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRE  369 (489)
T ss_pred             HHHhCHHHHHHHHHHHHHHhCC--CCCCChhhhccCHHHHHHHHHHHhcCCCcccccccc
Confidence            4789999999999999999985  4448899999999999999999999999998 6663

>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05952 ComX: Bacillus competence pheromone ComX; InterPro: IPR009233 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
1w0e_A 485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-05
1tqn_A 486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-05
3ua1_A 487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-05
3ld6_A 461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-04
3cbd_A 455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-04
3hf2_A 482 Crystal Structure Of The I401p Mutant Of Cytochrome 5e-04
1fah_A 471 Structure Of Cytochrome P450 Length = 471 5e-04
3kx4_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-04
3ekd_A 470 Crystal Structure Of The A264m Heme Domain Of Cytoc 5e-04
3ekb_A 470 Crystal Structure Of The A264c Mutant Heme Domain O 5e-04
1jpz_A 473 Crystal Structure Of A Complex Of The Heme Domain O 5e-04
3psx_A 487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 5e-04
2ij4_A 470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 5e-04
1smi_A 471 A Single Mutation Of P450 Bm3 Induces The Conformat 5e-04
3kx3_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-04
2nnb_A 471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 5e-04
2ij2_A 470 Atomic Structure Of The Heme Domain Of Flavocytochr 5e-04
3kx5_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-04
2hpd_A 471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 5e-04
3ekf_A 470 Crystal Structure Of The A264q Heme Domain Of Cytoc 5e-04
3ben_A 470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 5e-04
2ij3_A 470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 5e-04
3npl_A 470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 5e-04
4duc_A 472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 5e-04
1yqp_A 455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-04
1p0w_A 455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-04
4dud_A 471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 5e-04
1yqo_A 455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-04
1bvy_A 458 Complex Of The Heme And Fmn-Binding Domains Of The 5e-04
1p0v_A 455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-04
2bmh_A 455 Modeling Protein-Substrate Interactions In The Heme 5e-04
4duf_A 471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 5e-04
2x7y_A 455 P450 Bm3 F87a In Complex With Dmso Length = 455 5e-04
3dgi_A 461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 5e-04
1p0x_A 455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-04
1jme_A 455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 6e-04
2uwh_A 458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-04
3m4v_A 482 Crystal Structure Of The A330p Mutant Of Cytochrome 8e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
Query: 2   LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAA 53
           LA HP +QQ++ +EI  VL +  +  PTYD + ++  L  V+ ETLRL+P A
Sbjct: 299 LATHPDVQQKLQEEIDAVLPN--KAPPTYDTVLQMEYLDMVVNETLRLFPIA 348
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-20
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-20
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 4e-19
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-19
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-19
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-19
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-17
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-17
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-17
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-16
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-16
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-16
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-15
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-14
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 4e-14
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-12
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-09
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 7e-08
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-07
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 5e-07
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-06
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-06
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-06
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-06
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-05
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-05
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-05
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-05
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score = 81.9 bits (203), Expect = 1e-20
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 2   LALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIA 57
           L+  P+I   +  E+ +V+G        ++ +  L  L++V+KE+LRLYP A    
Sbjct: 270 LSRQPEIVARLQAEVDEVIGSKRY--LDFEDLGRLQYLSQVLKESLRLYPPAWGTF 323
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.74
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.73
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.72
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.72
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.7
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.7
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.69
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.69
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.69
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.68
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.68
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.68
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.68
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.68
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.68
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.67
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.65
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.65
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.65
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.65
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.65
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.61
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.58
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.57
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.57
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.53
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.43
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.41
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.02
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 98.96
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.95
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.94
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 98.93
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.93
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 98.93
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.91
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 98.91
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.9
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.9
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.88
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 98.87
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 98.87
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 98.87
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.86
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 98.85
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.84
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.84
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 98.83
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.83
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.82
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.81
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 98.81
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 98.81
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.81
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 98.8
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.79
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.78
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.78
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.76
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 98.75
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 98.74
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.72
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.71
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 98.71
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 98.71
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.69
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.66
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.65
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.64
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.63
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.62
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.61
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 98.56
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.42
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.37
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 97.76
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 90.39
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.74  E-value=3.1e-18  Score=90.43  Aligned_cols=56  Identities=29%  Similarity=0.446  Sum_probs=50.1

Q ss_pred             CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCccccc
Q psy5849           1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK   58 (59)
Q Consensus         1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~~~r   58 (59)
                      +|+.||++|+|+++|++.+++.  +..++++++.+|||++||++|++|++|+++...|
T Consensus       298 ~L~~~P~~q~kl~~Ei~~~~~~--~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~  353 (479)
T 3tbg_A          298 LMILHPDVQRRVQQEIDDVIGQ--VRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVT  353 (479)
T ss_dssp             HHHHCHHHHHHHHHHHHHHTCS--SSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCC
T ss_pred             HhccCHHHHHHHHHHHHHHHhh--ccccchhhhccccccccceeeeccccccccccce
Confidence            3788999999999999999875  5678999999999999999999999999988443
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.67
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.64
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.63
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.6
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.58
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.5
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.16
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.62
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 97.81
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.72
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 96.69
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 95.92
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 95.15
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 95.08
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 95.06
d1mo6a260 RecA protein, C-terminal domain {Mycobacterium tub 90.02
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 89.63
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 89.03
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 88.8
d1xp8a259 RecA protein, C-terminal domain {Deinococcus radio 82.97
d1u94a260 RecA protein, C-terminal domain {Escherichia coli 80.07
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.67  E-value=2.3e-17  Score=85.15  Aligned_cols=56  Identities=23%  Similarity=0.396  Sum_probs=50.0

Q ss_pred             CcccCHHHHHHHHHHHHHhhCCCCCCCCCHHHHhhcHHHHHHHHHHhccCCCCccccc
Q psy5849           1 MLALHPKIQQEVYDEIVQVLGDDPETVPTYDQIQELHLLTRVIKETLRLYPAAPIIAK   58 (59)
Q Consensus         1 ~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~~~~~~a~~~e~~R~~~~~~~~~r   58 (59)
                      +|+.||++|+++++|++++++.  +..+++.++.++||++||++|++|++|+++.+.|
T Consensus       287 ~L~~~p~~~~~l~~Ei~~~~~~--~~~~~~~~~~~l~yL~a~i~E~lRl~p~~~~~~r  342 (467)
T d1r9oa_         287 LLLKHPEVTAKVQEEIERVIGR--NRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLP  342 (467)
T ss_dssp             HHHHCHHHHHHHHHHHHHHTCS--SSCCCGGGGGGCHHHHHHHHHHHHHHTSSTTCSC
T ss_pred             HhhcCchHHHHHHhhhhhhcCC--CCCCcHHHhhhhhhhhhhccccccccccCCcccc
Confidence            3688999999999999999975  5678888999999999999999999999988655
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo6a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a2 d.48.1.1 (A:269-328) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure