Psyllid ID: psy5886

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MTPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFATSYL
cccccccccccccccccEEEEEEccccccccEEEEEEEEcccccccEEEEEEEEEccccccccEEEccccccEEEEEEccccEEEEEEEEEEEEccccccEEEcccEEEEccccccccEEEEEEEEcccccccEEEEEEEcccccEEEEccEEEEEEccccccccccEEEEEEEEEEccccccc
cccEEEEEEEEccccccEEEEEEcccccccEEEEEEEEEccccccccEEEEEEcccccccccEEEEcccccEEEEEEcccccccEEEEEEEEEEcccccccEccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEcccccEEEEccccEEEEEccccHHHHccEEEEEEEEcccccccc
mtpcpipsalemtsdslfygamardkHELGVTLMQVkatdkdsgkfglVEYRlldnntdaasyfnldpatehqgpiqdegglsstatVNIRvtdindknpefqslpyefsvpegqdglavgrvhatdadegqnavvyysvpedipfvvdantgdirtnkalDYEKQQLYLERVFLISKFATSYL
mtpcpipsalemTSDSLFYGAMARDKHELGVTLMQvkatdkdsgkFGLVEYRLLDNNTDAASYFNLDPATEHQgpiqdegglssTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFATSYL
MTPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFATSYL
****************LFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNL*********************VNIRVTDI*********LPYEFSV****DGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFA****
MTPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKF**S**
MTPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFATSYL
*TPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKF*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPCPIPSALEMTSDSLFYGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATEHQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLYLERVFLISKFATSYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q3SWX5 790 Cadherin-6 OS=Bos taurus yes N/A 0.820 0.191 0.324 1e-14
Q9ULB4 789 Cadherin-9 OS=Homo sapien yes N/A 0.826 0.192 0.328 2e-14
P97326 790 Cadherin-6 OS=Mus musculu yes N/A 0.820 0.191 0.329 4e-14
P55285 790 Cadherin-6 OS=Homo sapien no N/A 0.820 0.191 0.319 4e-14
P55280 789 Cadherin-6 OS=Rattus norv yes N/A 0.820 0.191 0.319 5e-14
P55289 794 Cadherin-12 OS=Homo sapie no N/A 0.820 0.190 0.340 5e-14
P79995 789 Cadherin-10 OS=Gallus gal no N/A 0.842 0.196 0.322 7e-14
P70407 786 Cadherin-9 OS=Mus musculu no N/A 0.826 0.193 0.322 1e-13
Q5RJH3 794 Cadherin-12 OS=Mus muscul no N/A 0.820 0.190 0.335 2e-13
Q9Y6N8 788 Cadherin-10 OS=Homo sapie no N/A 0.842 0.196 0.333 2e-13
>sp|Q3SWX5|CADH6_BOVIN Cadherin-6 OS=Bos taurus GN=CDH6 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 90/188 (47%), Gaps = 37/188 (19%)

Query: 19  YGAMARDKHELGVTLMQVKATDKDSGKFG---LVEYRLLDNNTDAASYFNLDPAT----- 70
           Y A   +  ++G  ++QV ATD D   +G    V Y +L        YF+++  T     
Sbjct: 164 YTATVPEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQ----GQPYFSVESETGIIKT 219

Query: 71  -----------EHQGPIQDE------GGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPE 113
                      ++Q  IQ +      GGLS T TVNI +TD+ND  P F    Y+F  PE
Sbjct: 220 ALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPE 279

Query: 114 GQ-DGLAVGRVHATDADEGQNAVVYYSVPE-------DIPFVVDANTGDIRTNKALDYEK 165
               G  +GR+ A+DAD G+NA + YS+ E       D+    +   G I   K LD+EK
Sbjct: 280 SSPPGTPIGRIKASDADVGENAEIEYSITEGEGLDMFDVITDQETQEGIITVKKLLDFEK 339

Query: 166 QQLYLERV 173
           +++Y  +V
Sbjct: 340 KKVYTLKV 347
Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Bos taurus (taxid: 9913)
>sp|Q9ULB4|CADH9_HUMAN Cadherin-9 OS=Homo sapiens GN=CDH9 PE=2 SV=2 Back     alignment and function description
>sp|P97326|CADH6_MOUSE Cadherin-6 OS=Mus musculus GN=Cdh6 PE=1 SV=2 Back     alignment and function description
>sp|P55285|CADH6_HUMAN Cadherin-6 OS=Homo sapiens GN=CDH6 PE=1 SV=1 Back     alignment and function description
>sp|P55280|CADH6_RAT Cadherin-6 OS=Rattus norvegicus GN=Cdh6 PE=2 SV=1 Back     alignment and function description
>sp|P55289|CAD12_HUMAN Cadherin-12 OS=Homo sapiens GN=CDH12 PE=2 SV=2 Back     alignment and function description
>sp|P79995|CAD10_CHICK Cadherin-10 OS=Gallus gallus GN=CDH10 PE=2 SV=1 Back     alignment and function description
>sp|P70407|CADH9_MOUSE Cadherin-9 OS=Mus musculus GN=Cdh9 PE=2 SV=2 Back     alignment and function description
>sp|Q5RJH3|CAD12_MOUSE Cadherin-12 OS=Mus musculus GN=Cdh12 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y6N8|CAD10_HUMAN Cadherin-10 OS=Homo sapiens GN=CDH10 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
312385778 1232 hypothetical protein AND_00373 [Anophele 0.505 0.075 0.673 5e-30
345486640 1618 PREDICTED: LOW QUALITY PROTEIN: protocad 0.369 0.042 0.655 3e-27
347967593 1762 AGAP002310-PA [Anopheles gambiae str. PE 0.505 0.052 0.621 7e-27
170037432 1631 protocadherin-15 [Culex quinquefasciatus 0.505 0.057 0.621 8e-27
157118805 1736 cadherin [Aedes aegypti] gi|108875581|gb 0.505 0.053 0.621 1e-26
91091750 1516 PREDICTED: similar to cadherin [Triboliu 0.418 0.050 0.655 3e-26
270001289 1539 protocadherin 15 [Tribolium castaneum] 0.418 0.050 0.655 3e-26
195444020 1731 GK11655 [Drosophila willistoni] gi|19416 0.505 0.053 0.652 4e-26
383865554 1434 PREDICTED: cadherin-87A-like, partial [M 0.369 0.047 0.645 4e-26
242023771 1512 protocadherin-15 precursor, putative [Pe 0.391 0.047 0.681 4e-26
>gi|312385778|gb|EFR30197.1| hypothetical protein AND_00373 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 2/95 (2%)

Query: 77  QDEGGLSSTATVNIRVTDINDKNPEF--QSLPYEFSVPEGQDGLAVGRVHATDADEGQNA 134
           +D GGL+S+ATVNIRVTDINDKNPEF  + LPY F+V EGQ+G+A+G VHATDADEG NA
Sbjct: 475 EDNGGLASSATVNIRVTDINDKNPEFDERKLPYVFAVDEGQEGVAIGTVHATDADEGMNA 534

Query: 135 VVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLY 169
            + Y++P DIPF +D+ TG+IRT  ALDYEKQ+ Y
Sbjct: 535 EISYTIPSDIPFRIDSRTGEIRTKLALDYEKQKEY 569

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345486640|ref|XP_003425515.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin-15-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|347967593|ref|XP_312660.5| AGAP002310-PA [Anopheles gambiae str. PEST] gi|333468389|gb|EAA07876.6| AGAP002310-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170037432|ref|XP_001846562.1| protocadherin-15 [Culex quinquefasciatus] gi|167880555|gb|EDS43938.1| protocadherin-15 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157118805|ref|XP_001653269.1| cadherin [Aedes aegypti] gi|108875581|gb|EAT39806.1| AAEL008421-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91091750|ref|XP_968422.1| PREDICTED: similar to cadherin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001289|gb|EEZ97736.1| protocadherin 15 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195444020|ref|XP_002069681.1| GK11655 [Drosophila willistoni] gi|194165766|gb|EDW80667.1| GK11655 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|383865554|ref|XP_003708238.1| PREDICTED: cadherin-87A-like, partial [Megachile rotundata] Back     alignment and taxonomy information
>gi|242023771|ref|XP_002432304.1| protocadherin-15 precursor, putative [Pediculus humanus corporis] gi|212517727|gb|EEB19566.1| protocadherin-15 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0039709 1706 Cad99C "Cadherin 99C" [Drosoph 0.505 0.054 0.621 2e-28
UNIPROTKB|E1C264 789 CDH9 "Uncharacterized protein" 0.510 0.119 0.450 8.5e-18
UNIPROTKB|D6RJG0436 CDH10 "Cadherin-10" [Homo sapi 0.510 0.215 0.431 5.7e-17
UNIPROTKB|E1C235 796 CDH12 "Uncharacterized protein 0.510 0.118 0.411 6.2e-17
UNIPROTKB|E2R790 794 CDH12 "Uncharacterized protein 0.510 0.118 0.411 7.9e-17
UNIPROTKB|P55289 794 CDH12 "Cadherin-12" [Homo sapi 0.510 0.118 0.411 1e-16
UNIPROTKB|F1NQC1 789 CDH10 "Cadherin-10" [Gallus ga 0.510 0.119 0.421 1.6e-16
UNIPROTKB|F1N7M2 619 CDH12 "Uncharacterized protein 0.510 0.151 0.411 1.6e-16
UNIPROTKB|P79995 789 CDH10 "Cadherin-10" [Gallus ga 0.510 0.119 0.411 2e-16
MGI|MGI:109503 794 Cdh12 "cadherin 12" [Mus muscu 0.510 0.118 0.401 2.1e-16
FB|FBgn0039709 Cad99C "Cadherin 99C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.0e-28, Sum P(2) = 2.0e-28
 Identities = 59/95 (62%), Positives = 73/95 (76%)

Query:    77 QDEGGLSSTATVNIRVTDINDKNPEFQS--LPYEFSVPEGQDGLAVGRVHATDADEGQNA 134
             +D GGLSS+ATVNI+VTDINDKNPEF++  LPY F V EG+   +VG VHATDADEG NA
Sbjct:   679 EDTGGLSSSATVNIKVTDINDKNPEFEASTLPYVFQVEEGKAQASVGVVHATDADEGINA 738

Query:   135 VVYYSVPEDIPFVVDANTGDIRTNKALDYEKQQLY 169
              + YS+P DIPF ++A +G+I T K LDYE+   Y
Sbjct:   739 EITYSIPTDIPFTINATSGEILTAKELDYEQLNEY 773
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0048100 "wing disc anterior/posterior pattern formation" evidence=IMP
GO:0016021 "integral to membrane" evidence=ISS
GO:0005509 "calcium ion binding" evidence=ISS
GO:0007155 "cell adhesion" evidence=ISS
GO:0007224 "smoothened signaling pathway" evidence=IMP
GO:0007304 "chorion-containing eggshell formation" evidence=IMP
GO:0005902 "microvillus" evidence=IDA
GO:0032529 "follicle cell microvillus organization" evidence=IMP
GO:0032533 "regulation of follicle cell microvillus length" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0007305 "vitelline membrane formation involved in chorion-containing eggshell formation" evidence=IMP
UNIPROTKB|E1C264 CDH9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D6RJG0 CDH10 "Cadherin-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C235 CDH12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R790 CDH12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55289 CDH12 "Cadherin-12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQC1 CDH10 "Cadherin-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7M2 CDH12 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P79995 CDH10 "Cadherin-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:109503 Cdh12 "cadherin 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 5e-18
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-15
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 4e-12
smart0011281 smart00112, CA, Cadherin repeats 5e-11
smart0011281 smart00112, CA, Cadherin repeats 9e-09
pfam0002892 pfam00028, Cadherin, Cadherin domain 0.003
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 74.7 bits (184), Expect = 5e-18
 Identities = 32/68 (47%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 106 PYEFSVPEGQD-GLAVGRVHATDADEGQNAVVYYSV---PEDIPFVVDANTGDIRTNKAL 161
            YE SVPE    G  V  V ATD D G+N  V YS+    ED  F +D +TG+I T K L
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTAKPL 60

Query: 162 DYEKQQLY 169
           D E+Q  Y
Sbjct: 61  DREEQSSY 68

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.97
KOG4289|consensus 2531 99.97
KOG4289|consensus 2531 99.95
KOG1219|consensus 4289 99.95
KOG1219|consensus 4289 99.94
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.71
KOG1834|consensus 952 99.64
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.51
cd00031 199 CA Cadherin repeat domain; Cadherins are glycoprot 99.41
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.28
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.15
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.63
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.35
KOG1834|consensus 952 95.73
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 95.71
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 94.27
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 94.17
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 93.66
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 90.9
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 89.92
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 85.25
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 84.64
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information 
Probab=99.97  E-value=1.3e-29  Score=192.26  Aligned_cols=160  Identities=41%  Similarity=0.554  Sum_probs=147.8

Q ss_pred             EEEEEeCCCCCCcEEEEEEEEeCCCCCCcEEEEEEecCCCCCcccEEEcCCCC-----------------eEEEEEeCCC
Q psy5886          19 YGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATE-----------------HQGPIQDEGG   81 (184)
Q Consensus        19 y~~~v~E~~~~gt~v~~v~a~D~D~~~n~~~~y~i~~~~~~~~~~F~id~~tg-----------------~~v~a~d~~~   81 (184)
                      |.+.|.||++.|+.|+++.|.|+|.+.|+.++|+|.++...  .+|.|++.+|                 +.|+|.|.|.
T Consensus         2 ~~~~i~En~~~g~~v~~~~a~D~D~~~~~~~~y~i~~~~~~--~~F~i~~~tG~l~~~~~lD~e~~~~~~l~v~a~D~g~   79 (199)
T cd00031           2 YSVSVPENAPPGTVVGTVSATDPDSGENGRVTYSILGGNED--GLFSIDPNTGVITTTKPLDREEQSEYTLTVVASDGGG   79 (199)
T ss_pred             eEEEEeCCCCCCCEEEEEEEECCCCCCCceEEEEEeCCCCc--ccEEEeCCCCEEEECCCCCCcCCceEEEEEEEEECCc
Confidence            78999999999999999999999999899999999998543  7899999988                 4789999775


Q ss_pred             C--eeEEEEEEEEEeCCCCCCEEecCceEEEEeCCCC-CcEEEEEEEEeCCCCCCcEEEEEeCCCC---CEEEECCCcEE
Q psy5886          82 L--SSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQD-GLAVGRVHATDADEGQNAVVYYSVPEDI---PFVVDANTGDI  155 (184)
Q Consensus        82 ~--~~~~~v~I~V~d~ND~~P~f~~~~~~~~v~e~~~-g~~v~~v~a~D~D~~~n~~i~y~l~~~~---~F~Id~~tG~i  155 (184)
                      .  ++...+.|.|.|+||++|.|....|.+.+.|+.+ |+.++++.|+|+|.+.++.++|+|..+.   .|.|++.+|.|
T Consensus        80 ~~~~~~~~v~I~V~d~Nd~~P~~~~~~~~~~v~e~~~~~~~i~~~~a~D~D~~~~~~~~y~l~~~~~~~~f~i~~~~G~i  159 (199)
T cd00031          80 PPLSSTATVTVTVLDVNDNPPVFEQSSYEASVPENAPPGTVVGTVTATDADSGENAKLTYSILSGNDKELFSIDPNTGII  159 (199)
T ss_pred             CcceeEEEEEEEEccCCCCCCcccccceEEEEeCCCCCCCEEEEEEEEcCCCCCCccEEEEEeCCCCCCEEEEeCCceEE
Confidence            4  3899999999999999999999999999999995 9999999999999988999999998754   79999999999


Q ss_pred             EeCccCCccCCCeEEEEEEEEeCCC
Q psy5886         156 RTNKALDYEKQQLYLERVFLISKFA  180 (184)
Q Consensus       156 ~~~~~LD~E~~~~y~l~V~a~D~~~  180 (184)
                      .+.+.||+|....|+|.|.|+|..+
T Consensus       160 ~~~~~ld~e~~~~~~l~v~a~D~~~  184 (199)
T cd00031         160 TLAKPLDREEKSSYELTVVATDGGG  184 (199)
T ss_pred             EeCCccCCccCceEEEEEEEEECCC
Confidence            9999999999999999999999873

>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 8e-10
2a62_A 322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 2e-06
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 3e-09
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 3e-09
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 4e-09
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 4e-09
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 2e-08
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 3e-06
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 3e-06
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 2e-05
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 2e-05
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 3e-05
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 3e-05
1l3w_A 546 C-Cadherin Ectodomain Length = 546 9e-05
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 1e-04
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 3e-04
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 3e-04
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 3e-04
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 3e-04
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 3e-04
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 3e-04
1q1p_A212 E-Cadherin Activation Length = 212 3e-04
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 3e-04
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 3e-04
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 3e-04
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 4e-04
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 4e-04
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 4e-04
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 4e-04
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 86/185 (46%), Gaps = 31/185 (16%)
Query: 19  YGAMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPAT-------- 70
           Y A   +   LG ++  V ATD D   +G    +L+ +  +   YF+++P T        
Sbjct: 111 YHATVPEMSILGTSVTNVTATDADDPVYG-NSAKLVYSILEGQPYFSIEPETAIIKTALP 169
Query: 71  --------EHQGPIQDE------GGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQD 116
                   E+   IQ +      GGLS T T+ + +TD+ND  P+F    Y FSVPE   
Sbjct: 170 NMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVV 229
Query: 117 -GLAVGRVHATDADEGQNAVVYYSVPE-------DIPFVVDANTGDIRTNKALDYEKQQL 168
            G A+GRV A D D G+NA   Y + +       +I     A  G IR  K LD+E ++ 
Sbjct: 230 LGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKS 289
Query: 169 YLERV 173
           Y  +V
Sbjct: 290 YTLKV 294
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 1e-38
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 3e-14
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 4e-10
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 4e-34
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 3e-28
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 4e-10
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 3e-04
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-33
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 6e-16
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 1e-07
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 2e-32
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 5e-11
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 1e-10
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 5e-32
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 5e-16
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 6e-08
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 5e-32
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 2e-07
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 1e-31
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 1e-09
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 1e-06
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-31
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-26
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 6e-26
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 8e-23
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-18
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-18
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-05
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-31
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-28
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 5e-28
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-22
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-12
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-07
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-31
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-26
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-25
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 8e-24
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-10
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-05
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-31
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-12
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-07
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 2e-30
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-25
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 5e-10
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-08
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 9e-29
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-28
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-28
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-22
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-13
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-08
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-28
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 7e-26
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 6e-22
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-07
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-05
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-25
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-11
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-09
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 4e-23
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 3e-09
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 4e-23
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 1e-10
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 2e-17
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 4e-04
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 1e-16
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 6e-11
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 9e-15
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 2e-07
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-14
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 1e-06
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 9e-14
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 2e-07
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 2e-13
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 2e-09
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 4e-11
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 2e-10
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
 Score =  130 bits (329), Expect = 1e-38
 Identities = 44/161 (27%), Positives = 65/161 (40%), Gaps = 25/161 (15%)

Query: 28  ELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPAT---------------EH 72
            +G ++ Q+ A D D+     + + +         +F ++P T               E 
Sbjct: 24  PVGSSVTQLLARDMDNDP---LVFGVSGEEAS--RFFAVEPDTGVVWLRQPLDRETKSEF 78

Query: 73  QGPIQ--DEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQD-GLAVGRVHATDAD 129
                  D      T  VNI+V D+ND  P F + PY   +PE    G  +  V+ATD D
Sbjct: 79  TVEFSVSD-HQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPD 137

Query: 130 EGQNAVVYYSVPEDIP-FVVDANTGDIRTNKALDYEKQQLY 169
            G    V YS     P F +D+  G +   + LDYE  Q Y
Sbjct: 138 LGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAY 178
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.98
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.97
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.97
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.97
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.97
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.97
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.97
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.97
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.97
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.96
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.96
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.95
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.91
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.9
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.82
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.73
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.72
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.69
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.69
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.69
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.67
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.66
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.65
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.65
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.64
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.6
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.59
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.58
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.56
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.54
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.49
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.48
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.45
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.45
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.44
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.43
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.39
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.37
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.33
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.32
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.32
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.3
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.26
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.23
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.09
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 94.5
3pe9_A98 Fibronectin(III)-like module; CBHA, beta-sandwich, 81.62
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
Probab=100.00  E-value=2.9e-35  Score=225.20  Aligned_cols=166  Identities=29%  Similarity=0.463  Sum_probs=146.1

Q ss_pred             CCCCCCCCceEE--EEEeCCCCCCcEEEEEEEEeCCCCCCcEEEEEEecCCCCCcccEEEcCCCC---------------
Q psy5886           9 ALEMTSDSLFYG--AMARDKHELGVTLMQVKATDKDSGKFGLVEYRLLDNNTDAASYFNLDPATE---------------   71 (184)
Q Consensus         9 ~~~~~~~~~~y~--~~v~E~~~~gt~v~~v~a~D~D~~~n~~~~y~i~~~~~~~~~~F~id~~tg---------------   71 (184)
                      .+|.+.+ ..|.  +.|+|++++|+.|+++.|+|+|.+   .+.|+|.+++  ..++|.|++.+|               
T Consensus         4 ~~P~F~~-~~y~~~~~V~E~~~~Gt~v~~v~A~D~D~~---~~~y~i~~~~--~~~~F~Id~~tG~i~~~~~LD~E~~~~   77 (210)
T 3mvs_A            4 RLPFFTN-HFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVSGEE--ASRFFAVEPDTGVVWLRQPLDRETKSE   77 (210)
T ss_dssp             CCCEECC-GGGTSCEEEETTCCTTCEEEECCEECTTCC---CCEEEEESHH--HHHHEEECTTTCEEEESSCCCTTTCCE
T ss_pred             CCCccCC-CccceEEEEeCCCCCCCEEEEEEEEeCCCC---cEEEEEeCCC--CCCcEEEeCCCCEEEECCccCCcccce
Confidence            3334443 3565  799999999999999999999954   5899998763  247899999998               


Q ss_pred             --eEEEEEeCCCCeeEEEEEEEEEeCCCCCCEEecCceEEEEeCCCC-CcEEEEEEEEeCCCCCCcEEEEEeCCC-CCEE
Q psy5886          72 --HQGPIQDEGGLSSTATVNIRVTDINDKNPEFQSLPYEFSVPEGQD-GLAVGRVHATDADEGQNAVVYYSVPED-IPFV  147 (184)
Q Consensus        72 --~~v~a~d~~~~~~~~~v~I~V~d~ND~~P~f~~~~~~~~v~e~~~-g~~v~~v~a~D~D~~~n~~i~y~l~~~-~~F~  147 (184)
                        +.|.|+|.++ .+++.+.|.|.|+|||+|.|.+..|.+.|+|+.+ |+.|+++.|+|+|.|.|+.++|+|..+ ..|.
T Consensus        78 y~l~v~a~D~~~-~~~~~v~I~V~DvNDn~P~f~~~~y~~~v~E~~~~gt~v~~v~A~D~D~g~n~~v~Y~i~~~~~~F~  156 (210)
T 3mvs_A           78 FTVEFSVSDHQG-VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFA  156 (210)
T ss_dssp             EEEEEEEECSSC-EEEEEEEEEEECCCCCCCEECSCSEEEEEETTCCTTCEEEECCEECCSSGGGGCEEEEESSCCSSEE
T ss_pred             EEEEEEEEeCCC-CEEEEEEEEEEeCCCCCCcCCCceEEEEEECCCCCCCEEEEEEEEeCCCCCCceEEEEEeCCCCCEE
Confidence              4789999765 4678999999999999999999999999999996 999999999999999999999999875 5799


Q ss_pred             EECCCcEEEeCccCCccCCCeEEEEEEEEeCCCC
Q psy5886         148 VDANTGDIRTNKALDYEKQQLYLERVFLISKFAT  181 (184)
Q Consensus       148 Id~~tG~i~~~~~LD~E~~~~y~l~V~a~D~~~~  181 (184)
                      |++.+|.|++.++||||....|.|+|+|+|+.+.
T Consensus       157 Id~~tG~i~~~~~LD~E~~~~y~l~V~a~D~g~~  190 (210)
T 3mvs_A          157 IDSARGIVTVIQELDYEVTQAYQLTVNATDQDKT  190 (210)
T ss_dssp             ECTTTCEEEECSCCCTTTCSEEEEEEEEEECCSS
T ss_pred             EeCCcEEEEECCcCCCcccceEEEEEEEEECCCC
Confidence            9999999999999999999999999999999853
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>3pe9_A Fibronectin(III)-like module; CBHA, beta-sandwich, cellulosome, unknown function; 1.69A {Clostridium thermocellum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 2e-09
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 8e-06
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 2e-08
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 3e-06
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 2e-08
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 5e-07
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 7e-07
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-04
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 4e-05
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 0.001
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.5 bits (120), Expect = 2e-09
 Identities = 15/81 (18%), Positives = 31/81 (38%), Gaps = 7/81 (8%)

Query: 100 PEFQSLPYEFSVPEGQDGLAVGRVHATDADEGQNAVVYYSVPEDIP-------FVVDANT 152
           P    +    S PE + G     +    +++ +   V+YS+            F+++  T
Sbjct: 1   PLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERET 60

Query: 153 GDIRTNKALDYEKQQLYLERV 173
           G ++  + LD E+   Y    
Sbjct: 61  GWLKVTEPLDRERIATYTLFS 81
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.82
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.81
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.79
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.79
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.69
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.67
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.55
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.53
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.52
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.51
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.49
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.49
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.48
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.46
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.38
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.14
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.09
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.07
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.05
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.0
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.82  E-value=1.2e-20  Score=128.70  Aligned_cols=87  Identities=33%  Similarity=0.371  Sum_probs=78.0

Q ss_pred             CCCCCCEEecCceEEEEeCCCC-CcEEEEEEEEeCCCC---CCcEEEEEeCCC-------CCEEEECCCcEEEeC-ccCC
Q psy5886          95 INDKNPEFQSLPYEFSVPEGQD-GLAVGRVHATDADEG---QNAVVYYSVPED-------IPFVVDANTGDIRTN-KALD  162 (184)
Q Consensus        95 ~ND~~P~f~~~~~~~~v~e~~~-g~~v~~v~a~D~D~~---~n~~i~y~l~~~-------~~F~Id~~tG~i~~~-~~LD  162 (184)
                      .|||+|.|.+..|.+.|+|+++ |+.|+++.|.|+|.+   .|+.++|+|..+       ..|.|++.+|.|++. +.||
T Consensus         1 eNDn~P~F~~~~y~~~V~En~~~gt~v~~v~A~D~D~~~~~~n~~i~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~LD   80 (113)
T d1l3wa2           1 QNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFTINRETGVISLIGTGLD   80 (113)
T ss_dssp             CSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSCCSCSCSEEECTTTCEEEECSCCCC
T ss_pred             CCCCCCccCCCeEEEEEECCCCCCCEEEEEEeecccccccccceEEEEEEecCCCCccccceeeeeecceeEEEeccccC
Confidence            5999999999999999999996 999999999999986   567899999642       469999999999885 6899


Q ss_pred             ccCCCeEEEEEEEEeCCCC
Q psy5886         163 YEKQQLYLERVFLISKFAT  181 (184)
Q Consensus       163 ~E~~~~y~l~V~a~D~~~~  181 (184)
                      ||....|.|.|+|+|..+.
T Consensus        81 ~E~~~~y~l~V~a~D~~~~   99 (113)
T d1l3wa2          81 REKFPEYTLTVQATDLEGA   99 (113)
T ss_dssp             TTTCCEEEEEEEEEHHHHT
T ss_pred             cccCCEEEEEEEEEECCCC
Confidence            9999999999999996544
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure