Psyllid ID: psy5888


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MVMPNTGHSSPKQASVYPLSIRVSESQEQPSEEMPFDLSQNTTRSHNGPHMSPAGKPPSSPDSERHEEQPLDLRVDHKKVFLSRNMEDENRNLILRSPTPSENLEVNYRSSPASTKDELQVQDDDRSSPPNIKSRSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYLPHQEDAENNNNINSKKEILSPSEKDNYSSRSSTSSLGSTHAVPHPPRTKDVPESTREKTPDPVTNT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccHcEcccccccccccccccEEccccHHHEHcHccccccccccccccccEcccccHHHHHHHHcccccccccccccccEcccccHHHcccEcccccccccEEccccccccccccccccccccccccccccEEEEEEcccccccccccccccEccccHHHEHEEEccccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHEEcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccHHEHEcccccccccccccccEEccccEEEEcc
mvmpntghsspkqasvyplsirvsesqeqpseempfdlsqnttrshngphmspagkppsspdserheeqpldlrvdhKKVFLSRNmedenrnlilrsptpsenlevnyrsspastkdelqvqdddrssppniksrslstypvlfphpVMLEAMYRArdkvprlplpysmnsppgypgrpaypfinsgllnghpiqsptidlirsqlpplanspkqfqesisnntgkpkdryackfcgkvfprsanltrhlrthtgeqpykckycersfsissNLQRHVRnihnkekpfkcplcdrcfgqqtnldrhlkkheadgptilddrnggipspsmihnrcrppsgilnddSYFEEIRSFMGKVSADGNRLVQRVSSLSranynyylphqedaennnninskkeilspsekdnyssrsstsslgsthavphpprtkdvpestrektpdpvtnt
mvmpntghsspkqasvyPLSIRVSESQEQPSEEMPFDLSQNTTRSHNGPHMSPAGKPPSSPDSERHEeqpldlrvdhKKVFlsrnmedenrnlilrsptpsenlevnyrsspastkdelqvqdddrssppniksrslstypvlfpHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQEsisnntgkpkdRYACKFCGKVfprsanltrhlrthtgeqpykCKYCERSFSISSNLQRHVRNIHnkekpfkcplCDRCFGQQTNLDRHLKkheadgptilddrnGGIPSpsmihnrcrppsgILNDDSYFEEIRSFMgkvsadgnRLVQRVSSLSRANYNYYLphqedaennnniNSKKEILSPSEKDNYSSRsstsslgsthavphpprtkdvpestrektpdpvtnt
MVMPNTGHSSPKQASVYPLSIRVsesqeqpseeMPFDLSQNTTRSHNGPHMSPAGKPPSSPDSERHEEQPLDLRVDHKKVFLSRNMEDENRNLILRSPTPSENLEVNYRSSPASTKDELQVQDDDRSSPPNIKSRSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYLPHQEDAennnninskkeilsPSEKDNYssrsstsslgsTHAVPHPPRTKDVPESTREKTPDPVTNT
******************************************************************************************************************************************TYPVLFPHPVMLEAMYRARDKV*******************AYPFINSGLLNGHPI****IDL****************************RYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNL*************************************ILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYL******************************************************************
***************************************************************************************************************************************************VML**********************PGYPGRPAYPF***************************************NTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNG******************LNDDSYFEEIRSFMGKVSA***************************************************************************************
**************SVYPLSIRVS*********************************************PLDLRVDHKKVFLSRNMEDENRNLILRSPTPSENLEVN*************************KSRSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYLPHQEDAENNNNINSKKEI************************************************
****************************************NTTRSHNGPHMSPAGKPPSSPDSERHEEQPLDLRVDHKKVFLSRNMEDENRNLILRSPTPSENLEVNYRSSPASTKDELQVQDDDRSSPPNIKSRSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYLPHQEDAENNNNINSKKEILSPSEKDNYSSRSSTSSLGSTHAVPHPPRTKDVPESTREKTPDP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMPNTGHSSPKQASVYPLSIRVSESQEQPSEEMPFDLSQNTTRSHNGPHMSPAGKPPSSPDSERHEEQPLDLRVDHKKVFLSRNMEDENRNLILRSPTPSENLEVNYRSSPASTKDELQVQDDDRSSPPNIKSRSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPYSMNSPPGYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSRANYNYYLPHQEDAENNNNINSKKEILSPSEKDNYSSRSSTSSLGSTHAVPHPPRTKDVPESTREKTPDPVTNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query447 2.2.26 [Sep-21-2011]
B7ZRU9 1055 MDS1 and EVI1 complex loc N/A N/A 0.673 0.285 0.369 6e-50
B7ZRM8 1050 MDS1 and EVI1 complex loc N/A N/A 0.668 0.284 0.365 3e-49
P14404 1042 MDS1 and EVI1 complex loc no N/A 0.275 0.118 0.684 9e-49
Q03112 1051 MDS1 and EVI1 complex loc yes N/A 0.275 0.117 0.684 1e-48
Q8I7Z8990 Transcription factor haml no N/A 0.263 0.119 0.684 3e-47
A2A935 1275 PR domain zinc finger pro no N/A 0.651 0.228 0.4 1e-46
Q9HAZ2 1276 PR domain zinc finger pro no N/A 0.288 0.101 0.637 3e-45
P08155 845 Krueppel homologous prote no N/A 0.284 0.150 0.392 2e-20
A2T812754 Zinc finger protein 287 O N/A N/A 0.243 0.144 0.436 7e-20
Q9HBT7754 Zinc finger protein 287 O no N/A 0.243 0.144 0.436 8e-20
>sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 Back     alignment and function desciption
 Score =  198 bits (504), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 135/365 (36%), Positives = 185/365 (50%), Gaps = 64/365 (17%)

Query: 16  VYPLSIRVSESQEQPSEEMPFDLSQNTTRSHNGPHM-SPAGKPPSSPDSERHEEQPLDLR 74
           + P S + ++  ++   E PFDL+         P++ S +G P SS     + +QPLDL 
Sbjct: 535 IEPESPKETKKVQKGKTESPFDLTTKRKEEKASPNVPSKSGAPTSS-----NHDQPLDL- 588

Query: 75  VDHKKVFLSRNMEDENRNLILRSPTPSENLEVNYRSSPASTKDELQVQDDDRSSPPNIKS 134
                     +M   +R    +   P +N                 + ++ +   P +  
Sbjct: 589 ----------SMGSRSRAATTKQTEPRKN----------------HIFNEKKDMDPELPK 622

Query: 135 RSLSTYPVLFPHPVMLEAMYRARDKVPRLPLPY----SMNSPPGYPGRPAYPF------- 183
            S        P P  ++ +YR   + P  PL       +   PG+   P +P        
Sbjct: 623 TSEHCLQHARPAPFFMDPIYRVEKRKPMDPLEILKEKYLRPSPGFLFHPQFPMPDQRTWM 682

Query: 184 -----INSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGK 238
                +   L + + ++    +LI+S +P + N          N   K K+RY C++CGK
Sbjct: 683 SAIENMAEKLESFNALKPEANNLIQS-VPSMFNFRASSSALPENLLRKGKERYTCRYCGK 741

Query: 239 VFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFG 298
           +FPRSANLTRHLRTHTGEQPY+CKYC+RSFSISSNLQRHVRNIHNKEKPFKC LCDRCFG
Sbjct: 742 IFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFG 801

Query: 299 QQTNLDRHLKKHEADGPTILDDRNGGI--PSPSMIHNRCRPPSGILN--DDSYFEEIRSF 354
           QQTNLDRHLKKHE          NG +   + S  H+       IL+  +DSYF EIR+F
Sbjct: 802 QQTNLDRHLKKHE----------NGNLSGTAASSPHSEIEGTGPILDEKEDSYFNEIRNF 851

Query: 355 MGKVS 359
           +G  S
Sbjct: 852 IGNSS 856




Transcriptional repressor during pronephros development. Plays a role in regionalization of the pronephros; may promote formation of the distal tubule and duct over formation of the glomus and proximal tubule.
Xenopus laevis (taxid: 8355)
>sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 Back     alignment and function description
>sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 Back     alignment and function description
>sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 Back     alignment and function description
>sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 Back     alignment and function description
>sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 Back     alignment and function description
>sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 Back     alignment and function description
>sp|P08155|KRUH_DROME Krueppel homologous protein 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 Back     alignment and function description
>sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 Back     alignment and function description
>sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
242020555480 conserved hypothetical protein [Pediculu 0.738 0.687 0.569 1e-100
189240185451 PREDICTED: similar to CG10348 CG10348-PA 0.724 0.718 0.581 6e-95
270012296427 hypothetical protein TcasGA2_TC006419 [T 0.724 0.758 0.570 1e-94
328722031 640 PREDICTED: hypothetical protein LOC10016 0.510 0.356 0.621 4e-73
350416228451 PREDICTED: hypothetical protein LOC10074 0.648 0.643 0.465 3e-72
340711673452 PREDICTED: hypothetical protein LOC10064 0.648 0.641 0.464 3e-72
380030371458 PREDICTED: uncharacterized protein LOC10 0.689 0.672 0.477 5e-70
189240183 819 PREDICTED: similar to conserved hypothet 0.550 0.300 0.488 8e-58
270012294 933 hypothetical protein TcasGA2_TC006417 [T 0.545 0.261 0.485 8e-58
328783956 1202 PREDICTED: hypothetical protein LOC72579 0.284 0.105 0.748 2e-56
>gi|242020555|ref|XP_002430718.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515908|gb|EEB17980.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 220/386 (56%), Positives = 260/386 (67%), Gaps = 56/386 (14%)

Query: 1   MVMPNTGHSSPKQASVYPLSIRVSESQEQ--PSEEMPFDLSQNTTRSHNGPHMSPAGKPP 58
           M++P++GHSSPKQA+VYPL+IRV +  +Q    +EMPFDLS+NT  +  GPHMSPAG+PP
Sbjct: 35  MLVPSSGHSSPKQAAVYPLTIRVPDDNQQHNAGDEMPFDLSRNTRSA--GPHMSPAGRPP 92

Query: 59  SSPDSERHEEQPLDLRVDHKKVFLSRN-MEDENRNLILRSPTPSENLEVNYRSSPASTKD 117
             P  E   EQPLDLRVD+KK+ L R  +EDEN+N+ILRSP+P+ +     +  PAS   
Sbjct: 93  PGPTDE---EQPLDLRVDYKKLSLQRRRIEDENQNVILRSPSPTSSPPSKEQIIPASDIR 149

Query: 118 ELQVQDDDRSSPPNIKSRSLSTYPVLFPH----PVMLEAMYRARDKVPRLPLPYSMNSPP 173
           +  V    +SS    K    S YP+LFPH    P MLEAMYR  DK  RLP+P+ + SPP
Sbjct: 150 QSPVSPRSQSSSERSKESPSSPYPLLFPHQPLHPFMLEAMYRNVDKSARLPIPFPV-SPP 208

Query: 174 GYPGRPAYPFINSGLLNGHPIQSPTIDLIRSQLPPLANSPKQFQESISNNTGKPKDRYAC 233
           GY   P  PF+           SP                           GK KDRYAC
Sbjct: 209 GY-APPTRPFV---------FPSP---------------------------GKLKDRYAC 231

Query: 234 KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLC 293
           KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKC LC
Sbjct: 232 KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCQLC 291

Query: 294 DRCFGQQTNLDRHLKKHEADGPTILDD----RNGGIPSPSMIHNRCRPPS-GILNDDSYF 348
           +RCFGQQTNLDRHLKKHEADGPTILDD    R+     P   H     PS GI++D+SYF
Sbjct: 292 ERCFGQQTNLDRHLKKHEADGPTILDDHRHSRSSMYQHPKQGHRLSLLPSQGIMSDESYF 351

Query: 349 EEIRSFMGKVSADGNRLVQRVSSLSR 374
           EEIRSFMGKV+++G R+V  +++L R
Sbjct: 352 EEIRSFMGKVTSEG-RMVDPMAALLR 376




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189240185|ref|XP_001815516.1| PREDICTED: similar to CG10348 CG10348-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270012296|gb|EFA08744.1| hypothetical protein TcasGA2_TC006419 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328722031|ref|XP_001947307.2| PREDICTED: hypothetical protein LOC100167703 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350416228|ref|XP_003490881.1| PREDICTED: hypothetical protein LOC100748733 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711673|ref|XP_003394396.1| PREDICTED: hypothetical protein LOC100646056 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380030371|ref|XP_003698822.1| PREDICTED: uncharacterized protein LOC100872987 [Apis florea] Back     alignment and taxonomy information
>gi|189240183|ref|XP_975197.2| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270012294|gb|EFA08742.1| hypothetical protein TcasGA2_TC006417 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328783956|ref|XP_001121599.2| PREDICTED: hypothetical protein LOC725792 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
FB|FBgn0032707540 CG10348 [Drosophila melanogast 0.284 0.235 0.742 3.8e-56
UNIPROTKB|D6RFY31177 PRDM16 "PR domain zinc finger 0.335 0.127 0.582 1.6e-49
UNIPROTKB|D6RDW01178 PRDM16 "PR domain zinc finger 0.335 0.127 0.582 1.7e-49
UNIPROTKB|D3YTA51256 PRDM16 "PR domain zinc finger 0.335 0.119 0.582 2.5e-49
UNIPROTKB|F8WEV3 1275 PRDM16 "PR domain zinc finger 0.335 0.117 0.582 2.7e-49
UNIPROTKB|Q9HAZ2 1276 PRDM16 "PR domain zinc finger 0.335 0.117 0.582 2.7e-49
UNIPROTKB|J9P0I61156 PRDM16 "Uncharacterized protei 0.335 0.129 0.576 3.9e-49
UNIPROTKB|F1Q029 1259 PRDM16 "Uncharacterized protei 0.335 0.119 0.576 6.7e-49
UNIPROTKB|H0YA13 1084 PRDM16 "PR domain zinc finger 0.335 0.138 0.582 8.7e-49
UNIPROTKB|F1P809 1114 MECOM "Uncharacterized protein 0.469 0.188 0.491 1.2e-48
FB|FBgn0032707 CG10348 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 523 (189.2 bits), Expect = 3.8e-56, Sum P(2) = 3.8e-56
 Identities = 98/132 (74%), Positives = 108/132 (81%)

Query:   228 KDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKP 287
             KDRY CKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE+P
Sbjct:   308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERP 367

Query:   288 FKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSY 347
             FKC +C+RCFGQQTNLDRHLKKHE+D  + L   +G       I   C  P+    ++SY
Sbjct:   368 FKCEICERCFGQQTNLDRHLKKHESDAVS-LSALSGVSERMHCIRRFCENPT----EESY 422

Query:   348 FEEIRSFMGKVS 359
             FEEIRSFMGKV+
Sbjct:   423 FEEIRSFMGKVT 434


GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|D6RFY3 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RDW0 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D3YTA5 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8WEV3 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HAZ2 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0I6 PRDM16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q029 PRDM16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YA13 PRDM16 "PR domain zinc finger protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P809 MECOM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-07
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 6e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 7e-05
smart0035523 smart00355, ZnF_C2H2, zinc finger 2e-04
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 0.002
smart0035523 smart00355, ZnF_C2H2, zinc finger 0.002
pfam1389424 pfam13894, zf-C2H2_4, C2H2-type zinc finger 0.002
pfam1389424 pfam13894, zf-C2H2_4, C2H2-type zinc finger 0.003
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 45.5 bits (108), Expect = 4e-07
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 245 NLTRHLRTHTGEQPYKCKYCERSFS 269
           NL RH+RTHTGE+PYKC  C +SFS
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFS 25


Length = 26

>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
>gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger Back     alignment and domain information
>gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 447
KOG2462|consensus279 99.89
KOG2462|consensus279 99.87
KOG1074|consensus 958 99.75
KOG3576|consensus267 99.73
KOG1074|consensus 958 99.61
KOG3608|consensus467 99.55
KOG3623|consensus 1007 99.51
KOG3623|consensus1007 99.5
KOG3576|consensus267 99.49
KOG3608|consensus467 99.44
PLN03086567 PRLI-interacting factor K; Provisional 99.01
PLN03086567 PRLI-interacting factor K; Provisional 98.96
PHA00733128 hypothetical protein 98.89
PHA00733128 hypothetical protein 98.78
KOG3993|consensus500 98.69
PHA0276855 hypothetical protein; Provisional 98.6
PHA0276855 hypothetical protein; Provisional 98.47
KOG3993|consensus500 98.28
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.27
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.97
PHA0061644 hypothetical protein 97.96
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.83
PHA0061644 hypothetical protein 97.83
PHA0073279 hypothetical protein 97.79
PHA0073279 hypothetical protein 97.78
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.56
COG5189423 SFP1 Putative transcriptional repressor regulating 97.48
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.28
COG5189423 SFP1 Putative transcriptional repressor regulating 97.21
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.13
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.11
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.05
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.85
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.76
KOG2231|consensus 669 96.69
COG5048467 FOG: Zn-finger [General function prediction only] 96.62
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.5
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.37
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.37
KOG2231|consensus 669 96.29
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.23
smart0035526 ZnF_C2H2 zinc finger. 95.72
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.63
PRK04860160 hypothetical protein; Provisional 95.6
smart0035526 ZnF_C2H2 zinc finger. 95.46
KOG2482|consensus423 95.13
KOG1146|consensus 1406 95.03
PRK04860160 hypothetical protein; Provisional 94.99
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.91
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.42
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.29
KOG2785|consensus390 94.04
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.95
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.75
KOG1146|consensus 1406 93.43
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.94
COG5048467 FOG: Zn-finger [General function prediction only] 92.64
KOG2482|consensus423 92.31
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.82
KOG4173|consensus253 91.36
KOG2893|consensus 341 90.45
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.44
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 89.14
KOG4167|consensus907 89.03
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 88.35
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.93
KOG4173|consensus253 87.92
KOG2893|consensus 341 86.14
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.96
KOG4377|consensus480 83.78
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.33
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 82.54
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 82.17
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 80.91
>KOG2462|consensus Back     alignment and domain information
Probab=99.89  E-value=3e-24  Score=204.47  Aligned_cols=138  Identities=26%  Similarity=0.499  Sum_probs=125.0

Q ss_pred             CCCccCCCCCCccCChHHHHHHHHHhcC---CCcccCCCCCCcccchhhHHHHhhhhccCCCCCCCCCCCcccCCchhHH
Q psy5888         228 KDRYACKFCGKVFPRSANLTRHLRTHTG---EQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLD  304 (447)
Q Consensus       228 ~k~~~C~~Cgk~F~~~~~L~~H~r~H~~---ekp~~C~~C~k~F~s~~~L~~H~~~~H~~~kp~~C~~C~k~F~~~~~L~  304 (447)
                      ..+|+|..||+.|.+..+|.+|..+|..   .+-+.|++|+|.|.+-..|+.|++ +|+  -+++|.+||+.|.+...|+
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhh
Confidence            4579999999999999999999999975   567999999999999999999999 787  4799999999999999999


Q ss_pred             HHHhhhcCCCCcccCCCCCCCCChhhhhhccCCCCCCCCCCCchhhhccccccccCChhHHHHHHHhhcc
Q psy5888         305 RHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVSADGNRLVQRVSSLSR  374 (447)
Q Consensus       305 ~Hlr~H~~ekp~~C~~C~k~f~s~~~l~~H~~~h~~~~~~~~~~~~~c~~Cgk~f~~~~~L~~H~~~~~~  374 (447)
                      .|+|+|+|||||.|..|++.|...++|+-|++.|..+    +.|  .|..|+|.|..++.|.+|.+.-..
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~----K~~--qC~~C~KsFsl~SyLnKH~ES~C~  268 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDV----KKH--QCPRCGKSFALKSYLNKHSESACL  268 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhhcCC----ccc--cCcchhhHHHHHHHHHHhhhhccc
Confidence            9999999999999999999999999999999999853    333  569999999999999999775443



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4377|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-18
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-15
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-15
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-14
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-14
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-14
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-14
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-14
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-13
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 7e-13
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-12
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-10
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 8e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 8e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 3e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 9e-08
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-07
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 5e-07
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 6e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 7e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 8e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 2e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-05
2drp_A66 The Crystal Structure Of A Two Zinc-Finger Peptide 7e-05
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 3e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 4e-04
2ema_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2epr_A48 Solution Structure Of The Secound Zinc Finger Domai 6e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 6e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 89.4 bits (220), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Query: 231 YACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKC 290 Y C CGK F +S+NL +H RTHTGE+PYKC C +SFS SS+LQ+H R H EKP+KC Sbjct: 5 YKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQR-THTGEKPYKC 63 Query: 291 PLCDRCFGQQTNLDRHLKKHE 311 P C + F + +L RH + H+ Sbjct: 64 PECGKSFSRSDHLSRHQRTHQ 84
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2DRP|A Chain A, The Crystal Structure Of A Two Zinc-Finger Peptide Reveals An Extension To The Rules For Zinc-FingerDNA RECOGNITION Length = 66 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2EMA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 312- 344) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EPR|A Chain A, Solution Structure Of The Secound Zinc Finger Domain Of Zinc Finger Protein 278 Length = 48 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-33
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-32
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-32
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-32
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-31
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-31
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-30
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-29
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-25
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-28
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-26
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-26
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-21
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-24
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-24
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-23
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-23
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-23
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-23
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-23
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-18
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-20
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-19
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-18
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-16
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-15
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-15
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-15
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-14
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-14
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-12
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-10
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-10
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 7e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 4e-08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 5e-07
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 2e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-07
1ard_A29 Yeast transcription factor ADR1; transcription reg 7e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 6e-06
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 2e-04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 4e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 4e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 4e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 6e-04
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 6e-04
1paa_A30 Yeast transcription factor ADR1; transcription reg 7e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-04
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 7e-04
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 8e-04
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
 Score =  120 bits (304), Expect = 1e-33
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 5/88 (5%)

Query: 224 TG-KPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIH 282
               P   + C+ CGK F R   L  H+R HTG +PYKCK C+ + + SS+L +H+R IH
Sbjct: 4   GSSGP---HKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLR-IH 59

Query: 283 NKEKPFKCPLCDRCFGQQTNLDRHLKKH 310
           + E+PFKC +C       + L  HL+ H
Sbjct: 60  SDERPFKCQICPYASRNSSQLTVHLRSH 87


>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Length = 33 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Length = 29 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.81
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.74
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.67
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.66
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.66
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.62
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.62
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.57
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.57
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.53
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.43
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.42
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.41
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.39
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.38
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.36
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.35
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.35
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.32
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.32
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.3
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.28
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.27
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.26
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.26
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.26
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.2
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.09
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.06
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.0
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.99
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.99
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.98
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.97
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.96
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.95
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.95
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.94
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.93
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.92
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.91
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.9
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.86
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.83
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.83
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.83
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.83
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.81
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.81
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.8
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.8
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.79
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.79
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.78
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.78
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.76
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.76
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.75
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.75
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.74
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.73
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.73
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.72
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.69
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.68
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.67
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.65
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.65
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.64
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.64
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.62
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.6
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.49
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.46
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.44
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.41
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.39
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.36
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.33
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.32
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.31
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.29
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.29
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.22
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.09
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.01
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.98
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.93
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.91
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.91
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.88
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.88
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.87
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.87
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.86
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.84
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.83
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.82
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.82
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.82
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.81
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.8
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.8
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.79
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.75
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.75
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.73
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.71
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.71
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.7
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.87
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.66
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.66
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.66
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.81
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.64
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.81
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.64
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.63
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.77
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.59
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.57
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.57
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.56
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.56
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.44
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.54
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.53
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.2
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.17
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.03
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.44
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.47
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.37
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.36
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.88
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.69
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.64
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.78
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 82.93
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.91  E-value=2e-25  Score=204.98  Aligned_cols=165  Identities=30%  Similarity=0.546  Sum_probs=140.2

Q ss_pred             hhhhccCCCCCCCchhhhhcccccCCCCCCCccCCCCCCccCChHHHHHHHHHhcCCCcccCCCCCCcccchhhHHHHhh
Q psy5888         200 DLIRSQLPPLANSPKQFQESISNNTGKPKDRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR  279 (447)
Q Consensus       200 ~~~~~~~p~~~~s~~~~~~~~~~~~~~~~k~~~C~~Cgk~F~~~~~L~~H~r~H~~ekp~~C~~C~k~F~s~~~L~~H~~  279 (447)
                      ...|..|...+.....+..++....+  .++|.|.+|++.|.....|..|+++|.++++|.|.+|++.|.+...|..|++
T Consensus        21 ~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   98 (190)
T 2i13_A           21 PYACPECGKSFSRSDHLAEHQRTHTG--EKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQR   98 (190)
T ss_dssp             ----------CCSSHHHHHGGGCC-----CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHH
T ss_pred             CCcCCCCccccCCHHHHHHHHHHcCC--CCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHH
Confidence            35678888888888888888765443  4679999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCCCCCCCCCCcccCCchhHHHHHhhhcCCCCcccCCCCCCCCChhhhhhccCCCCCCCCCCCchhhhcccccccc
Q psy5888         280 NIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADGPTILDDRNGGIPSPSMIHNRCRPPSGILNDDSYFEEIRSFMGKVS  359 (447)
Q Consensus       280 ~~H~~~kp~~C~~C~k~F~~~~~L~~Hlr~H~~ekp~~C~~C~k~f~s~~~l~~H~~~h~~~~~~~~~~~~~c~~Cgk~f  359 (447)
                       .|.++++|.|.+|++.|.....|..|+++|+++++|.|..|++.|.....|..|++.|.+    +..|  .|..|++.|
T Consensus        99 -~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~----~~~~--~C~~C~~~f  171 (190)
T 2i13_A           99 -THTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTG----EKPY--KCPECGKSF  171 (190)
T ss_dssp             -HHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHC----CCCE--ECTTTCCEE
T ss_pred             -hcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCC----CCCe--ECCCCCCcc
Confidence             799999999999999999999999999999999999999999999999999999988764    2334  569999999


Q ss_pred             CChhHHHHHHHhhc
Q psy5888         360 ADGNRLVQRVSSLS  373 (447)
Q Consensus       360 ~~~~~L~~H~~~~~  373 (447)
                      .....|..|++.+.
T Consensus       172 ~~~~~L~~H~~~H~  185 (190)
T 2i13_A          172 SRRDALNVHQRTHT  185 (190)
T ss_dssp             SSHHHHHHHHTTC-
T ss_pred             CCHHHHHHHHHhcC
Confidence            99999999988654



>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 447
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-13
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-13
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 8e-13
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-12
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-11
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-09
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 8e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-08
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.003
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-07
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 6e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.003
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-07
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.004
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-07
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.003
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 2e-04
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 7e-04
d1klra_30 g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 96 7e-04
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 0.002
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 0.002
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 0.003
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.2 bits (149), Expect = 3e-13
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 254 TGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPL 292
           +  +PY C+ C + FS   +L  H++ +H  E+P KC +
Sbjct: 1   SVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.43
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.42
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.88
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.83
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.82
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.74
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.72
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.72
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.72
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.68
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.67
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.66
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.66
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.65
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.61
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.61
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.6
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.59
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.54
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.47
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.4
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.34
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.3
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.28
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.28
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.26
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.26
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.19
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.17
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.99
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.92
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.89
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.84
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.84
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.82
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.79
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.69
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.43
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.31
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.14
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.11
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.96
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.77
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.64
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.63
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.55
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.55
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.54
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.47
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.46
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.29
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.17
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.13
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.03
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.02
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.95
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.92
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.91
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.91
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.82
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.81
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.43
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.28
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.02
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.92
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.8
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.57
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.54
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.16
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.01
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.73
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.48
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.25
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.99
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.91
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.83
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.69
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.44
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 91.4
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.14
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 90.73
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.6
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.03
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 89.91
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.84
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.02
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 88.44
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 88.03
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 87.18
d1y0jb136 U-shaped transcription factor, different fingers { 87.07
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 86.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.97
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.4
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.49
d1y0jb136 U-shaped transcription factor, different fingers { 81.22
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.43  E-value=3.7e-14  Score=102.29  Aligned_cols=52  Identities=37%  Similarity=0.893  Sum_probs=35.8

Q ss_pred             CCccCCCCCCccCChHHHHHHHHHhcCCCcccCCCCCCcccchhhHHHHhhhhc
Q psy5888         229 DRYACKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIH  282 (447)
Q Consensus       229 k~~~C~~Cgk~F~~~~~L~~H~r~H~~ekp~~C~~C~k~F~s~~~L~~H~~~~H  282 (447)
                      ++|.|+ ||+.|.....|..|+++|++++||.|.+|++.|.....|..|++ +|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r-~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK-IH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT-TT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh-cC
Confidence            566773 77777777777777777777777777777777777777777766 44



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure