Psyllid ID: psy5989
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| 270014557 | 314 | hypothetical protein TcasGA2_TC004590 [T | 0.604 | 0.423 | 0.802 | 5e-56 | |
| 307186410 | 308 | 14-3-3 protein zeta [Camponotus floridan | 0.531 | 0.379 | 0.788 | 1e-54 | |
| 345479702 | 262 | PREDICTED: 14-3-3 protein zeta-like [Nas | 0.531 | 0.446 | 0.781 | 2e-53 | |
| 307207600 | 186 | 14-3-3 protein zeta [Harpegnathos saltat | 0.531 | 0.629 | 0.781 | 1e-52 | |
| 357628813 | 253 | hypothetical protein KGM_17373 [Danaus p | 0.518 | 0.450 | 0.766 | 5e-52 | |
| 170580060 | 331 | 14-3-3-like protein 2 [Brugia malayi] gi | 0.622 | 0.413 | 0.541 | 4e-36 | |
| 365266852 | 247 | 14-3-3 zeta [Bombus terrestris] gi|36526 | 0.563 | 0.502 | 0.541 | 1e-25 | |
| 365266873 | 247 | 14-3-3 zeta [Megachile rotundata] | 0.563 | 0.502 | 0.541 | 1e-25 | |
| 365266863 | 247 | 14-3-3 zeta [Acromyrmex echinatior] | 0.563 | 0.502 | 0.526 | 5e-25 | |
| 365266882 | 247 | 14-3-3 zeta [Atta cephalotes] | 0.563 | 0.502 | 0.526 | 5e-25 |
| >gi|270014557|gb|EFA11005.1| hypothetical protein TcasGA2_TC004590 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 223 bits (567), Expect = 5e-56, Method: Compositional matrix adjust.
Identities = 110/137 (80%), Positives = 116/137 (84%), Gaps = 4/137 (2%)
Query: 11 GAVVDDSQKAYQQAFEISKSKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQVCAH 70
AVVD SQKAYQ AFEISK+KM PTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ+C
Sbjct: 131 NAVVDYSQKAYQDAFEISKAKMTPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQIC-- 188
Query: 71 YFCFYFFLMNDPEFSPLFPCSLAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVF 130
CFYF + + F + + VVEDSQKAYQEAFDIAKSKMQ THPIRLGLALNFSVF
Sbjct: 189 --CFYFEVCSTDSFIIVRFLLIEVVEDSQKAYQEAFDIAKSKMQSTHPIRLGLALNFSVF 246
Query: 131 YYEIINSPARACHLAKQ 147
YYEIINSPARACHLAKQ
Sbjct: 247 YYEIINSPARACHLAKQ 263
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307186410|gb|EFN72044.1| 14-3-3 protein zeta [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345479702|ref|XP_001600046.2| PREDICTED: 14-3-3 protein zeta-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307207600|gb|EFN85264.1| 14-3-3 protein zeta [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|357628813|gb|EHJ77988.1| hypothetical protein KGM_17373 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|170580060|ref|XP_001895095.1| 14-3-3-like protein 2 [Brugia malayi] gi|158598059|gb|EDP36044.1| 14-3-3-like protein 2, putative [Brugia malayi] | Back alignment and taxonomy information |
|---|
| >gi|365266852|gb|AEW70334.1| 14-3-3 zeta [Bombus terrestris] gi|365266856|gb|AEW70337.1| 14-3-3 zeta [Bombus impatiens] gi|365266860|gb|AEW70340.1| 14-3-3 zeta [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|365266873|gb|AEW70349.1| 14-3-3 zeta [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|365266863|gb|AEW70342.1| 14-3-3 zeta [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|365266882|gb|AEW70355.1| 14-3-3 zeta [Atta cephalotes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| FB|FBgn0004907 | 248 | 14-3-3zeta "14-3-3zeta" [Droso | 0.245 | 0.217 | 0.925 | 2.6e-22 | |
| WB|WBGene00003920 | 248 | par-5 [Caenorhabditis elegans | 0.613 | 0.544 | 0.457 | 8e-21 | |
| UNIPROTKB|P41932 | 248 | par-5 "14-3-3-like protein 1" | 0.613 | 0.544 | 0.457 | 8e-21 | |
| UNIPROTKB|P63103 | 245 | YWHAZ "14-3-3 protein zeta/del | 0.268 | 0.240 | 0.786 | 8e-21 | |
| UNIPROTKB|F1PBL1 | 245 | YWHAZ "Uncharacterized protein | 0.268 | 0.240 | 0.786 | 8e-21 | |
| UNIPROTKB|P63104 | 245 | YWHAZ "14-3-3 protein zeta/del | 0.268 | 0.240 | 0.786 | 8e-21 | |
| UNIPROTKB|F2Z558 | 248 | YWHAZ "Uncharacterized protein | 0.268 | 0.237 | 0.786 | 8e-21 | |
| MGI|MGI:109484 | 245 | Ywhaz "tyrosine 3-monooxygenas | 0.268 | 0.240 | 0.786 | 8e-21 | |
| RGD|3980 | 245 | Ywhaz "tyrosine 3-monooxygenas | 0.268 | 0.240 | 0.786 | 8e-21 | |
| UNIPROTKB|E1BDS9 | 123 | LOC100140254 "Uncharacterized | 0.268 | 0.479 | 0.786 | 8e-21 |
| FB|FBgn0004907 14-3-3zeta "14-3-3zeta" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 259 (96.2 bits), Expect = 2.6e-22, P = 2.6e-22
Identities = 50/54 (92%), Positives = 51/54 (94%)
Query: 13 VVDDSQKAYQQAFEISKSKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 66
VVDDSQ AYQ AF+ISK KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ
Sbjct: 144 VVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197
|
|
| WB|WBGene00003920 par-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P41932 par-5 "14-3-3-like protein 1" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63103 YWHAZ "14-3-3 protein zeta/delta" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PBL1 YWHAZ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63104 YWHAZ "14-3-3 protein zeta/delta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z558 YWHAZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109484 Ywhaz "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3980 Ywhaz "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BDS9 LOC100140254 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| cd11310 | 230 | cd11310, 14-3-3_1, 14-3-3 protein domain | 2e-30 | |
| pfam00244 | 236 | pfam00244, 14-3-3, 14-3-3 protein | 3e-30 | |
| cd11310 | 230 | cd11310, 14-3-3_1, 14-3-3 protein domain | 1e-29 | |
| pfam00244 | 236 | pfam00244, 14-3-3, 14-3-3 protein | 1e-28 | |
| cd08774 | 225 | cd08774, 14-3-3, 14-3-3 domain | 2e-28 | |
| cd10022 | 229 | cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is | 9e-28 | |
| cd08774 | 225 | cd08774, 14-3-3, 14-3-3 domain | 9e-27 | |
| cd10023 | 234 | cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in | 3e-26 | |
| cd10023 | 234 | cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in | 3e-25 | |
| cd10022 | 229 | cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is | 4e-25 | |
| cd10025 | 239 | cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- | 7e-22 | |
| COG5040 | 268 | COG5040, BMH1, 14-3-3 family protein [Signal trans | 1e-21 | |
| smart00101 | 244 | smart00101, 14_3_3, 14-3-3 homologues | 1e-21 | |
| cd11309 | 231 | cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai | 1e-21 | |
| smart00101 | 244 | smart00101, 14_3_3, 14-3-3 homologues | 3e-21 | |
| cd11309 | 231 | cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai | 4e-21 | |
| cd10025 | 239 | cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- | 1e-20 | |
| COG5040 | 268 | COG5040, BMH1, 14-3-3 family protein [Signal trans | 1e-20 | |
| cd10024 | 246 | cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of | 1e-20 | |
| cd10026 | 237 | cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | 2e-20 | |
| cd10024 | 246 | cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of | 3e-20 | |
| cd10020 | 230 | cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor | 1e-19 | |
| cd10026 | 237 | cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | 3e-19 | |
| cd10020 | 230 | cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor | 3e-19 | |
| cd10019 | 242 | cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of | 5e-19 | |
| cd10019 | 242 | cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of | 1e-18 | |
| cd11310 | 230 | cd11310, 14-3-3_1, 14-3-3 protein domain | 3e-13 | |
| pfam00244 | 236 | pfam00244, 14-3-3, 14-3-3 protein | 1e-11 | |
| cd10022 | 229 | cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is | 1e-11 | |
| cd10023 | 234 | cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in | 8e-11 | |
| cd08774 | 225 | cd08774, 14-3-3, 14-3-3 domain | 2e-09 | |
| cd10025 | 239 | cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- | 8e-09 | |
| cd10024 | 246 | cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of | 3e-08 | |
| cd10019 | 242 | cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of | 2e-07 | |
| cd10020 | 230 | cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor | 3e-06 | |
| COG5040 | 268 | COG5040, BMH1, 14-3-3 family protein [Signal trans | 4e-06 | |
| smart00101 | 244 | smart00101, 14_3_3, 14-3-3 homologues | 3e-05 | |
| cd10026 | 237 | cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | 1e-04 | |
| cd11309 | 231 | cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai | 6e-04 |
| >gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain | Back alignment and domain information |
|---|
Score = 112 bits (280), Expect = 2e-30
Identities = 50/58 (86%), Positives = 55/58 (94%)
Query: 9 QEGAVVDDSQKAYQQAFEISKSKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 66
+VV+DSQKAYQ+AF+ISK+KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ
Sbjct: 136 TRNSVVEDSQKAYQEAFDISKAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 193
|
This 14-3-3 domain family includes proteins in Caenorhabditis elegans, the silkworm (Bombyx mori) as well as barley (Hordeum vulgare). In C. elegans, 14-3-3 proteins are SIR-2.1 binding partners which induce transcriptional activation of DAF-16 during stress and are required for the life-span extension conferred by extra copies of sir-2.1. In B. mori, the 14-3-3 proteins are expressed widely in larval and adult tissues, including the brain, fat body, Malpighian tube, silk gland, midgut, testis, ovary, antenna, and pheromone gland, and interact with the N-terminal fragment of Hsp60, suggesting that 14-3-3 (a molecular adaptor) and Hsp60 (a molecular chaperone) work together to achieve a wide range of cellular functions in B. mori. In barley aleurone cells, 14-3-3 proteins and members of the ABF transcription factor family have a regulatory function in the gibberellic acid (GA) pathway since the balance of GA and abscisic acid (ABA) is a determining factor during transition of embryogenesis and seed germination. 14-3-3 is an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells. Length = 230 |
| >gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues | Back alignment and domain information |
|---|
| >gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues | Back alignment and domain information |
|---|
| >gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues | Back alignment and domain information |
|---|
| >gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| COG5040 | 268 | BMH1 14-3-3 family protein [Signal transduction me | 100.0 | |
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 100.0 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 99.97 | |
| KOG0841|consensus | 247 | 99.97 | ||
| COG5040 | 268 | BMH1 14-3-3 family protein [Signal transduction me | 99.89 | |
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 99.88 | |
| KOG0841|consensus | 247 | 99.84 | ||
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 99.82 | |
| KOG1840|consensus | 508 | 96.22 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.57 | |
| KOG1840|consensus | 508 | 94.64 | ||
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 94.17 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 91.53 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 91.18 | |
| KOG4626|consensus | 966 | 88.58 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 87.15 | |
| KOG4626|consensus | 966 | 86.74 | ||
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 82.05 |
| >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-36 Score=257.25 Aligned_cols=124 Identities=36% Similarity=0.589 Sum_probs=115.3
Q ss_pred CCccccccccchhHHHHHhhcChHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCccccHHHHHHHHHHHHHHHHHHHhcCC
Q psy5989 35 THPIRLGLALNFSVFYYEILNSPDKACQLAKQVCAHYFCFYFFLMNDPEFSPLFPCSLAVVEDSQKAYQEAFDIAKSKMQ 114 (220)
Q Consensus 35 t~PirLGLaLN~SVF~yEIl~~~~~A~~lAk~A~~d~~~~~~~~~~~~e~~~~~~~k~~~~e~a~~aYq~A~eiA~~~L~ 114 (220)
+|.|.-.-...+-||||.+.+| +|||++++-.|+. ++++.+.++++|+.|-++|..+||
T Consensus 107 ~hlipaa~~~EskvFyyKMKGD--------------YyRYlAEf~~G~~-------~~e~a~~slE~YK~AseiA~teLp 165 (268)
T COG5040 107 KHLIPAATTGESKVFYYKMKGD--------------YYRYLAEFSVGEA-------REEAADSSLEAYKAASEIATTELP 165 (268)
T ss_pred HhcccccccccceEEEEeecch--------------HHHHHHHhccchH-------hHHHHHhHHHHHHHHHHHhhccCC
Confidence 4555555666789999999988 9999999999988 999999999999999999999999
Q ss_pred CCCcchhcccchhHHHHHHHhcChHHHHHHHHHHHHHHHHhhh----hhhhhhhHHHHHhhcccccchh
Q psy5989 115 PTHPIRLGLALNFSVFYYEIINSPARACHLAKQVKYSCIGASR----DTKRSVCLLCEIFHTMSSSGEK 179 (220)
Q Consensus 115 pt~PirLGL~LN~SVF~yEIl~~~~~A~~iAk~AfdeAi~eld----~~~~d~~lilq~L~~~s~~s~r 179 (220)
|||||||||+||||||||||+|+|++||.|||+|||+||.+|| ++|+|+|||||+|||+-.+|.-
T Consensus 166 PT~PirLGLALNfSVFyYEIlnspdkAC~lAKqaFDeAI~ELDtLSEEsYkDSTLIMQLLRDNLTLWTS 234 (268)
T COG5040 166 PTHPIRLGLALNFSVFYYEILNSPDKACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTS 234 (268)
T ss_pred CCCchhhhheecceeeeeecccCcHHHHHHHHHHHHHHHHHHhhhhhhhhcchHHHHHHHHhcceeeec
Confidence 9999999999999999999999999999999999999999998 7899999999999998877754
|
|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >KOG0841|consensus | Back alignment and domain information |
|---|
| >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >KOG0841|consensus | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 220 | ||||
| 2v7d_A | 247 | 14-3-3 Protein Zeta In Complex With Thr758 Phosphor | 9e-23 | ||
| 2v7d_A | 247 | 14-3-3 Protein Zeta In Complex With Thr758 Phosphor | 9e-21 | ||
| 2v7d_A | 247 | 14-3-3 Protein Zeta In Complex With Thr758 Phosphor | 1e-08 | ||
| 2c1j_A | 258 | Molecular Basis For The Recognition Of Phosphorylat | 1e-22 | ||
| 2c1j_A | 258 | Molecular Basis For The Recognition Of Phosphorylat | 9e-21 | ||
| 2c1j_A | 258 | Molecular Basis For The Recognition Of Phosphorylat | 1e-08 | ||
| 1a38_A | 245 | 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 | 1e-22 | ||
| 1a38_A | 245 | 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 | 9e-21 | ||
| 1a38_A | 245 | 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 | 1e-08 | ||
| 3rdh_A | 248 | X-Ray Induced Covalent Inhibition Of 14-3-3 Length | 1e-22 | ||
| 3rdh_A | 248 | X-Ray Induced Covalent Inhibition Of 14-3-3 Length | 1e-20 | ||
| 3rdh_A | 248 | X-Ray Induced Covalent Inhibition Of 14-3-3 Length | 1e-08 | ||
| 4fj3_A | 235 | 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla | 1e-22 | ||
| 4fj3_A | 235 | 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla | 1e-20 | ||
| 4fj3_A | 235 | 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla | 7e-09 | ||
| 2o02_A | 230 | Phosphorylation Independent Interactions Between 14 | 1e-22 | ||
| 2o02_A | 230 | Phosphorylation Independent Interactions Between 14 | 1e-20 | ||
| 2o02_A | 230 | Phosphorylation Independent Interactions Between 14 | 1e-08 | ||
| 2bq0_A | 245 | 14-3-3 Protein Beta (Human) Length = 245 | 5e-22 | ||
| 2bq0_A | 245 | 14-3-3 Protein Beta (Human) Length = 245 | 2e-20 | ||
| 2bq0_A | 245 | 14-3-3 Protein Beta (Human) Length = 245 | 2e-09 | ||
| 4gnt_A | 245 | Complex Of Chrebp And 14-3-3beta Length = 245 | 1e-21 | ||
| 4gnt_A | 245 | Complex Of Chrebp And 14-3-3beta Length = 245 | 2e-20 | ||
| 4gnt_A | 245 | Complex Of Chrebp And 14-3-3beta Length = 245 | 2e-09 | ||
| 4dnk_A | 247 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 3e-21 | ||
| 4dnk_A | 247 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 1e-19 | ||
| 4dnk_A | 247 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 6e-05 | ||
| 2btp_A | 256 | 14-3-3 Protein Theta (Human) Complexed To Peptide L | 2e-20 | ||
| 2btp_A | 256 | 14-3-3 Protein Theta (Human) Complexed To Peptide L | 9e-20 | ||
| 2btp_A | 256 | 14-3-3 Protein Theta (Human) Complexed To Peptide L | 5e-09 | ||
| 2c63_A | 247 | 14-3-3 Protein Eta (Human) Complexed To Peptide Len | 2e-19 | ||
| 2c63_A | 247 | 14-3-3 Protein Eta (Human) Complexed To Peptide Len | 3e-19 | ||
| 2c63_A | 247 | 14-3-3 Protein Eta (Human) Complexed To Peptide Len | 6e-09 | ||
| 3uzd_A | 248 | Crystal Structure Of 14-3-3 Gamma Length = 248 | 7e-19 | ||
| 3uzd_A | 248 | Crystal Structure Of 14-3-3 Gamma Length = 248 | 1e-07 | ||
| 2b05_A | 246 | Crystal Structure Of 14-3-3 Gamma In Complex With A | 7e-19 | ||
| 2b05_A | 246 | Crystal Structure Of 14-3-3 Gamma In Complex With A | 1e-07 | ||
| 4e2e_A | 248 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 5e-18 | ||
| 4e2e_A | 248 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 5e-06 | ||
| 3m50_A | 240 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E | 7e-17 | ||
| 3m50_A | 240 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E | 7e-17 | ||
| 2o98_A | 242 | Structure Of The 14-3-3 H+-Atpase Plant Complex Len | 7e-17 | ||
| 2o98_A | 242 | Structure Of The 14-3-3 H+-Atpase Plant Complex Len | 7e-17 | ||
| 1o9c_A | 260 | Structural View Of A Fungal Toxin Acting On A 14-3- | 8e-17 | ||
| 3smo_A | 235 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 1e-16 | ||
| 3smo_A | 235 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 4e-16 | ||
| 3smo_A | 235 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 6e-06 | ||
| 3p1r_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 1e-16 | ||
| 3p1r_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 4e-16 | ||
| 3p1r_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 7e-06 | ||
| 3axy_C | 240 | Structure Of Florigen Activation Complex Consisting | 1e-16 | ||
| 3axy_C | 240 | Structure Of Florigen Activation Complex Consisting | 7e-16 | ||
| 3p1p_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38nN166H I | 1e-16 | ||
| 3p1p_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38nN166H I | 4e-16 | ||
| 3p1p_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38nN166H I | 1e-05 | ||
| 2br9_A | 234 | 14-3-3 Protein Epsilon (Human) Complexed To Peptide | 2e-16 | ||
| 2br9_A | 234 | 14-3-3 Protein Epsilon (Human) Complexed To Peptide | 3e-16 | ||
| 2br9_A | 234 | 14-3-3 Protein Epsilon (Human) Complexed To Peptide | 2e-04 | ||
| 3ual_A | 232 | Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti | 2e-16 | ||
| 3ual_A | 232 | Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti | 3e-16 | ||
| 3ual_A | 232 | Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti | 3e-04 | ||
| 3ubw_A | 261 | Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope | 2e-16 | ||
| 3ubw_A | 261 | Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope | 3e-16 | ||
| 3ubw_A | 261 | Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope | 4e-05 | ||
| 4dx0_A | 243 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A | 7e-16 | ||
| 4dx0_A | 243 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A | 8e-16 | ||
| 3p1n_A | 235 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 8e-16 | ||
| 3p1n_A | 235 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 3e-15 | ||
| 3p1n_A | 235 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 1e-05 | ||
| 3u9x_A | 235 | Covalent Attachment Of Pyridoxal-Phosphate Derivati | 8e-16 | ||
| 3u9x_A | 235 | Covalent Attachment Of Pyridoxal-Phosphate Derivati | 3e-15 | ||
| 3u9x_A | 235 | Covalent Attachment Of Pyridoxal-Phosphate Derivati | 1e-05 | ||
| 3iqj_A | 236 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 8e-16 | ||
| 3iqj_A | 236 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 3e-15 | ||
| 3iqj_A | 236 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 1e-05 | ||
| 3o8i_A | 239 | Structure Of 14-3-3 Isoform Sigma In Complex With A | 8e-16 | ||
| 3o8i_A | 239 | Structure Of 14-3-3 Isoform Sigma In Complex With A | 3e-15 | ||
| 3o8i_A | 239 | Structure Of 14-3-3 Isoform Sigma In Complex With A | 1e-05 | ||
| 4hqw_A | 236 | Molecular Tweezers Modulate 14-3-3 Protein-protein | 9e-16 | ||
| 4hqw_A | 236 | Molecular Tweezers Modulate 14-3-3 Protein-protein | 3e-15 | ||
| 4hqw_A | 236 | Molecular Tweezers Modulate 14-3-3 Protein-protein | 1e-05 | ||
| 3t0l_A | 235 | Small-Molecule Inhibitors Of 14-3-3 Protein-Protein | 9e-16 | ||
| 3t0l_A | 235 | Small-Molecule Inhibitors Of 14-3-3 Protein-Protein | 3e-15 | ||
| 3t0l_A | 235 | Small-Molecule Inhibitors Of 14-3-3 Protein-Protein | 1e-05 | ||
| 4dat_A | 234 | Structure Of 14-3-3 Sigma In Complex With Padi6 14- | 9e-16 | ||
| 4dat_A | 234 | Structure Of 14-3-3 Sigma In Complex With Padi6 14- | 3e-15 | ||
| 4dat_A | 234 | Structure Of 14-3-3 Sigma In Complex With Padi6 14- | 1e-05 | ||
| 3lw1_A | 253 | Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid | 9e-16 | ||
| 3lw1_A | 253 | Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid | 2e-15 | ||
| 3lw1_A | 253 | Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid | 1e-05 | ||
| 1ywt_A | 248 | Crystal Structure Of The Human Sigma Isoform Of 14- | 1e-15 | ||
| 1ywt_A | 248 | Crystal Structure Of The Human Sigma Isoform Of 14- | 3e-15 | ||
| 1ywt_A | 248 | Crystal Structure Of The Human Sigma Isoform Of 14- | 2e-05 | ||
| 2npm_A | 260 | Crystal Structure Of Cryptosporidium Parvum 14-3-3 | 3e-13 |
| >pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 | Back alignment and structure |
|
| >pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 | Back alignment and structure |
| >pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 | Back alignment and structure |
| >pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 | Back alignment and structure |
| >pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 | Back alignment and structure |
| >pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 | Back alignment and structure |
| >pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 | Back alignment and structure |
| >pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 | Back alignment and structure |
| >pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 | Back alignment and structure |
| >pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 | Back alignment and structure |
| >pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 | Back alignment and structure |
| >pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 | Back alignment and structure |
| >pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 | Back alignment and structure |
| >pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 | Back alignment and structure |
| >pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 | Back alignment and structure |
| >pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 | Back alignment and structure |
| >pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 | Back alignment and structure |
| >pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 | Back alignment and structure |
| >pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 | Back alignment and structure |
| >pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 | Back alignment and structure |
| >pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 | Back alignment and structure |
| >pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 | Back alignment and structure |
| >pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 | Back alignment and structure |
| >pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 | Back alignment and structure |
| >pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 | Back alignment and structure |
| >pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 | Back alignment and structure |
| >pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 | Back alignment and structure |
| >pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 | Back alignment and structure |
| >pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 | Back alignment and structure |
| >pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 | Back alignment and structure |
| >pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 | Back alignment and structure |
| >pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 | Back alignment and structure |
| >pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 | Back alignment and structure |
| >pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 | Back alignment and structure |
| >pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 | Back alignment and structure |
| >pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 | Back alignment and structure |
| >pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 | Back alignment and structure |
| >pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 | Back alignment and structure |
| >pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 | Back alignment and structure |
| >pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 | Back alignment and structure |
| >pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 | Back alignment and structure |
| >pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 | Back alignment and structure |
| >pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 | Back alignment and structure |
| >pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 Regulatory Complex Length = 260 | Back alignment and structure |
| >pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 | Back alignment and structure |
| >pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 | Back alignment and structure |
| >pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 | Back alignment and structure |
| >pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 | Back alignment and structure |
| >pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 | Back alignment and structure |
| >pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 | Back alignment and structure |
| >pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 | Back alignment and structure |
| >pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 | Back alignment and structure |
| >pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 | Back alignment and structure |
| >pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 | Back alignment and structure |
| >pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 | Back alignment and structure |
| >pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 | Back alignment and structure |
| >pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 | Back alignment and structure |
| >pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 | Back alignment and structure |
| >pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 | Back alignment and structure |
| >pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 | Back alignment and structure |
| >pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 | Back alignment and structure |
| >pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 | Back alignment and structure |
| >pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 | Back alignment and structure |
| >pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 | Back alignment and structure |
| >pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 | Back alignment and structure |
| >pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 | Back alignment and structure |
| >pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 | Back alignment and structure |
| >pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 | Back alignment and structure |
| >pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 | Back alignment and structure |
| >pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 | Back alignment and structure |
| >pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 | Back alignment and structure |
| >pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 | Back alignment and structure |
| >pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 | Back alignment and structure |
| >pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 | Back alignment and structure |
| >pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 | Back alignment and structure |
| >pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 | Back alignment and structure |
| >pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 | Back alignment and structure |
| >pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 | Back alignment and structure |
| >pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 | Back alignment and structure |
| >pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 | Back alignment and structure |
| >pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 | Back alignment and structure |
| >pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 | Back alignment and structure |
| >pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 | Back alignment and structure |
| >pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 | Back alignment and structure |
| >pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 | Back alignment and structure |
| >pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 | Back alignment and structure |
| >pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 | Back alignment and structure |
| >pdb|2NPM|A Chain A, Crystal Structure Of Cryptosporidium Parvum 14-3-3 Protein In Complex With Peptide Length = 260 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 6e-25 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 2e-24 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 6e-12 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 2e-16 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 1e-14 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 1e-11 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 4e-16 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 7e-16 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 5e-10 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 9e-16 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 2e-15 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 2e-11 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 2e-15 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 8e-14 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 1e-10 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 7e-15 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 1e-14 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 6e-11 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 2e-14 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 3e-14 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 7e-10 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 9e-13 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 9e-13 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 4e-10 |
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 | Back alignment and structure |
|---|
Score = 97.0 bits (241), Expect = 6e-25
Identities = 12/57 (21%), Positives = 22/57 (38%)
Query: 90 CSLAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAK 146
L +EDS+K +Q+AF + + LG N + E + ++
Sbjct: 136 FGLCSLEDSKKIHQDAFTLLCEHPDKIEQLPLGFIQNLAYILSEKYGEKKQVFNMLN 192
|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 100.0 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 100.0 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 100.0 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 100.0 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 100.0 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 100.0 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 100.0 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 99.97 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 99.9 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 99.9 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 99.89 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 99.89 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 99.89 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 99.88 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 99.88 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 99.86 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.92 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.76 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.74 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.33 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.24 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.72 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 96.71 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.44 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 96.41 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.25 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 96.23 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.13 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.08 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.07 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 95.86 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 95.83 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.8 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 95.62 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 95.34 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 95.28 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 95.27 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 94.99 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 94.88 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 94.79 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.36 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 94.27 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 94.04 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 94.03 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 93.95 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 92.05 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.04 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 91.7 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 91.67 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 91.55 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 91.51 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 90.94 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 90.78 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 90.74 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 90.5 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 90.39 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 90.33 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 89.84 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 89.8 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 89.67 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 89.5 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 89.42 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 89.34 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 89.13 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 89.07 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 88.85 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 88.42 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 88.37 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 88.29 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 88.23 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 87.86 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 87.8 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 87.22 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 86.86 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 85.83 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 85.69 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 85.23 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 84.86 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 84.47 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 83.81 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 83.25 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 82.74 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 82.55 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 81.96 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 81.92 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 81.75 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 81.25 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 81.07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 81.01 |
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=9.4e-37 Score=266.65 Aligned_cols=112 Identities=36% Similarity=0.581 Sum_probs=106.4
Q ss_pred chhHHHHHhhcChHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCccccHHHHHHHHHHHHHHHHHHHhcCCCCCcchhccc
Q psy5989 45 NFSVFYYEILNSPDKACQLAKQVCAHYFCFYFFLMNDPEFSPLFPCSLAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLA 124 (220)
Q Consensus 45 N~SVF~yEIl~~~~~A~~lAk~A~~d~~~~~~~~~~~~e~~~~~~~k~~~~e~a~~aYq~A~eiA~~~L~pt~PirLGL~ 124 (220)
.--|||+.+.+| +|||++++..|++ |++++++|++||++|.++|+++|||||||||||+
T Consensus 120 eskVFY~KmKGD--------------yyRYlAE~~~g~~-------r~~~~e~a~~aY~~A~~iA~~~L~pthPirLGLa 178 (236)
T 3iqu_A 120 ESRVFYLKMKGD--------------YYRYLAEVATGDD-------KKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLA 178 (236)
T ss_dssp HHHHHHHHHHHH--------------HHHHHHHHCCSTT-------HHHHHHHHHHHHHHHHHHHHHHSCTTCHHHHHHH
T ss_pred HHHHHHHHhhhh--------------HHHHHHHhcCchH-------HHHHHHHHHHHHHHHHHHHHhhCCCCCcHHHHHH
Confidence 467999988876 9999999999988 9999999999999999999999999999999999
Q ss_pred chhHHHHHHHhcChHHHHHHHHHHHHHHHHhhh----hhhhhhhHHHHHhhcccccc
Q psy5989 125 LNFSVFYYEIINSPARACHLAKQVKYSCIGASR----DTKRSVCLLCEIFHTMSSSG 177 (220)
Q Consensus 125 LN~SVF~yEIl~~~~~A~~iAk~AfdeAi~eld----~~~~d~~lilq~L~~~s~~s 177 (220)
||||||||||+|+|++||++||+|||+||+++| ++|+|+|+|||+|||+..+|
T Consensus 179 LNfSVFyyEiln~~~~Ac~lAk~Afd~Ai~eld~l~eesykDstlImqLLRDNLtlW 235 (236)
T 3iqu_A 179 LNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLW 235 (236)
T ss_dssp HHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhhccChhhhHHHHHHHHHHHHHHhcc
Confidence 999999999999999999999999999999997 78999999999999987665
|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 220 | ||||
| d2o8pa1 | 220 | a.118.7.1 (A:8-227) 14-3-3 domain containing prote | 2e-25 | |
| d2o8pa1 | 220 | a.118.7.1 (A:8-227) 14-3-3 domain containing prote | 3e-25 | |
| d2o8pa1 | 220 | a.118.7.1 (A:8-227) 14-3-3 domain containing prote | 1e-09 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 1e-21 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 1e-20 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 3e-11 | |
| d2o02a1 | 230 | a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) | 1e-21 | |
| d2o02a1 | 230 | a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) | 3e-21 | |
| d2o02a1 | 230 | a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) | 1e-12 | |
| d3efza1 | 223 | a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry | 1e-19 | |
| d3efza1 | 223 | a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry | 2e-19 |
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: 14-3-3 domain containing protein cgd7 2470 species: Cryptosporidium parvum [TaxId: 5807]
Score = 96.9 bits (241), Expect = 2e-25
Identities = 15/84 (17%), Positives = 28/84 (33%), Gaps = 7/84 (8%)
Query: 90 CSLAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQVK 149
L +EDS+K +Q+AF + + LG N + E + ++ +
Sbjct: 134 FGLCSLEDSKKIHQDAFTLLCEHPDKIEQLPLGFIQNLAYILSEKYGEKKQVFNMLNSLG 193
Query: 150 YSCIGA-------SRDTKRSVCLL 166
R + +V L
Sbjct: 194 KILELQIKEQENMDRKAQITVYLQ 217
|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 99.98 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 99.98 | |
| d3efza1 | 223 | 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ | 99.97 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 99.96 | |
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 99.85 | |
| d3efza1 | 223 | 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ | 99.85 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 99.85 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 99.8 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 93.79 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 92.68 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 89.46 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 88.32 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 88.02 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 86.69 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 86.08 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 85.71 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 84.17 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 84.08 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 83.66 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 82.68 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 81.83 |
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: zeta isoform species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.98 E-value=7.8e-34 Score=245.01 Aligned_cols=104 Identities=42% Similarity=0.698 Sum_probs=98.2
Q ss_pred HHHHHHHHHHhcCCCCCCCCccccHHHHHHHHHHHHHHHHHHHhcCCCCCcchhcccchhHHHHHHHhcChHHHHHHHHH
Q psy5989 68 CAHYFCFYFFLMNDPEFSPLFPCSLAVVEDSQKAYQEAFDIAKSKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQ 147 (220)
Q Consensus 68 ~~d~~~~~~~~~~~~e~~~~~~~k~~~~e~a~~aYq~A~eiA~~~L~pt~PirLGL~LN~SVF~yEIl~~~~~A~~iAk~ 147 (220)
-||++||++++..+++ |++++++|+++|++|+++|+++||||||+||||+||||||||||++++++||++|++
T Consensus 122 kgDy~RY~aE~~~~~e-------~~~~~~~a~~aY~~A~~~A~~~L~~t~pirLgL~LN~SVF~YEi~~~~~~A~~lak~ 194 (230)
T d2o02a1 122 KGDYYRYLAEVAAGDD-------KKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKT 194 (230)
T ss_dssp HHHHHHHHHHTCCHHH-------HHHHHHHHHHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHTSCCHHHHHHHHHH
T ss_pred cccHHHHHHHhcCcHH-------HHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhHHHHHHHHcCCHHHHHHHHHH
Confidence 3559999999988877 999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhh----hhhhhhhHHHHHhhcccccch
Q psy5989 148 VKYSCIGASR----DTKRSVCLLCEIFHTMSSSGE 178 (220)
Q Consensus 148 AfdeAi~eld----~~~~d~~lilq~L~~~s~~s~ 178 (220)
|||+|++++| ++|+|+|+|||+|||+.++|+
T Consensus 195 afd~ai~~l~~l~ee~y~ds~~ImqlLrdNl~lW~ 229 (230)
T d2o02a1 195 AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWT 229 (230)
T ss_dssp HHHHHHTTGGGCCTTTHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHhhcCChhhHHHHHHHHHHHHHHHHHhc
Confidence 9999999987 889999999999999887663
|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|