Psyllid ID: psy6070

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450----
MKLFGIKPSGQSVTADTNTEAEDCPLTEAPDMDTRSNDGAVSKRKSSTWTKVAKTFDLMRKSEARQCSEAGPSSQGDGGEDGRMRRRSSIWRRVGSVQSTQAPKGSSNESQCSQSQSSPQRSSQSNNSPQNNSQSNNSSQSQRSPQSQSTSQSSSQTPCGSQNKGAIRSDLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKSCDSKSLSNDYKSSDCKSLANDYKLSDCKALANDYKSSDSMSLVNDYKPSQTNGSTEVTAHRSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSNESGYDSDSTTRQSEQHSPNSEHFNFGTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFEANGAPKAPHANTSATDKSVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILERSSVKGQTNSNPLLIKATRDFAKDGHLATNDGNSLLAKLHAQPSNQGEAHETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCPEPPEENSCNRVPESRPNDESLSENTPSKGRLPALPPHSSLDAFCHSGSISVSSVDKPVNSVDKPVRSVDKPVNSVDKPVSSVDKPVNSMDKPVNSVDKPVRAVDSAFVSPSMNLFYKKVQSQQSLEARGQGEPQRKSDRPQFTRRMFVKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQVGRRQRNSQTNPSVGNTAGSSTYAQRKLQIGESQSENGPKRSLQTESPTENGPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFTLGNHSPQTSQVASRREETMRSRQSDPLPAVDSRKSQDRKSVRNQVRKAEHVSLKSKAIFSNEESRGLSNRHEANRRSKRSSKKSVEPTPAQNDENSLENDLVRALNLALRTGALMSPQNPSAQRPKSFDLEEFAPRAMVPLHSSSPNIQRKVSSLDRKRRSQQNNPNQHRSEDVKAYRSRTEDLKDCLSRTENVNASTNSTKEYRSLVDTASEVRLDEMGHVPDVLRNCVRRDAKVIQNFPNSNEVLPSSSDFMSNSNSSSRSNANQSLPKSNQSLPNSNQNLPTSNQVPSSTDSVSNTNRASPNATNSNQALTNLTDSVSNTNQESPTSTELAKTSSGGFGLLHSLLASRSAFRSRPQTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPNTTEADSKEGLNLQPRLIPRADFTTQIYHSYNPTQPRLIPRADFTTQIYHGYNPTQPRLILRK
cccccccccccEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccEEcccccccccEEEEcccccccccccccccccccccccccccHHccccccccHHHHHHHcccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHcccccccEEccEEEEEcccccccccccccccccccccccccccccccccccEEccccccccEEEccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccHHHcccccccccccccHHHHccccccccccccccccHHHHHHHcccccccccccEEEEEEEEccccccccEEEEccccccccccccEEEEEcccccccccccccccccccccccccHHHHccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccEEEccccccccccccccccEEEEEEEEEEHHHHccccccccccEEEcccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccEEEEcccccccccccEEEEEEccccHHHcccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEEcccccEEEcccccccccccccccccccccccccccEccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEccHHHHEccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHccHHHcccccccccccccccccccccHHHHHccccccHHHHHHHccccccccccEcccccccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHcccccEEEcEEEEEEccccccccccccccccccccccccccccccccccEEEcccccccEEEccccccccccHHHHHccccccccEEEEcccccccccccccccccccccccccccccHHcHHcccccccEEEccccccccccccccccccccHHHEccccccccccccHHHHHHHHHHHccccccccccHHHHHHccccccccccccEEEEEEEEcccccccEEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccEEEEEEEEcEEccccccccccccccccccccccccccccccccccccccccccccccccEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccHHHEccccccccccccccHHHHHEEcccccccccccHHHHHHHHHHHHHHccccccHEHEEHHHHHHHHHccccccccEEEEEEccccEEEEEEHEEcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEEEEcccccccEccccEEEEEEEEEcEcccccHHHHHHHHHcHccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHEEcccccccEEccccccEcccccccccccccccccccccHHHHHHHHccccccccEEcccccccccccccccccccHHcccccccccccccEEEcccccccccccccccccccHHccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEccccccccccEEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEcc
mklfgikpsgqsvtadtnteaedcplteapdmdtrsndgavskrksstwtKVAKTFDLMRKSearqcseagpssqgdggedgrmrRRSSIWRrvgsvqstqapkgssnesqcsqsqsspqrssqsnnspqnnsqsnnssqsqrspqsqstsqsssqtpcgsqnkgairsdltlsenrplfspslneevmdmnYLYNFKCRRKQNFLLLNDYKSLtndykscdskslsndykssdckslandyklsdckalandykssdsmslvndykpsqtngstevtahrstdlvgtdgkpnlsdvskplphinlpinlyptptvaamsnlnvpvSLHHCAyissnesgydsdsttrqseqhspnsehfnfgtpspplievgdylslplylnqgtsvdgtdgakalgragrpdlvarfedvptgdgpfeangapkaphantsatdksvedvydfvepssvlcsskgglkcppnpvlnsvsnldilerssvkgqtnsnplliKATRdfakdghlatndgNSLLAKlhaqpsnqgeahetysficfdqsngeknrivemdhgntqsddgdyEYIFNFETklpklsedggdfgcdrvsnevdddiyenvefkfgciagrscpeppeenscnrvpesrpndeslsentpskgrlpalpphssldafchsgsisvssvdkpvnsvdkpvrsvdkpvnsvdkpvssvdkpvnsmdkpvnsvdkpvravdsafvspsmnLFYKKVQSQQSleargqgepqrksdrpqftrrmfvktgaparadtkSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMvrkfhplktqpvwswfvssnnILMRIWVSTlvpnyqvgrrqrnsqtnpsvgntagsstYAQRKLQigesqsengpkrslqtesptengpiVKAAieigpqtgtthfknavssnnivgnslvtnshgqimssiatplftlgnhspqtsQVASRREETMrsrqsdplpavdsrksqdrkSVRNQVRKAEHVSLKSKAIfsneesrglsnrheanrrskrsskksveptpaqndensLENDLVRALNLALRtgalmspqnpsaqrpksfdleefapramvplhssspniqrKVSSLDRkrrsqqnnpnqhrsedvkayrSRTEDLKDCLSRtenvnastnstKEYRSLVDTASevrldemghvpdVLRNCVRRDAKViqnfpnsnevlpsssdfmsnsnsssrsnanqslpksnqslpnsnqnlptsnqvpsstdsvsntnraspnatnsnqaltnltdsvsntnqesptstelaktssggfgLLHSLLASRSafrsrpqtceptlvrvsfekgpgkkslgfsivggvdspkgemgifvktifphgqaaesgllvegdeillfnneplqgrtHAEAITIFKKTKQGLVELvlqpntteadskeglnlqprlipradfttqiyhsynptqprlipradfttqiyhgynptqprlilrk
mklfgikpsgqsvtadtnteaedcplteapdmdtrsndgavskrksstwtkvaktfdlmrksearqcseagpssqgdggedgrMRRRSSIWrrvgsvqstqapkgssnesQCSQSQSSPQRSSQSNNSPQNNSQSNNSSQSQRSPQSqstsqsssqtpcgsqnkgairsdltlsenrplfspslneevMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKScdskslsndykssdCKSLANDYKLSDCKALANDYKSSDSMSLVNDYkpsqtngstevtahrstdlvgtdGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSNESGYDSDSTTRQSEQHSPNSEHFNFGTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFEANGAPKAPHANTSATDKSVEDVYDFVEPSSVLCsskgglkcppnpvLNSVSNLDILERssvkgqtnsnplLIKATRDFAKDGHLATNDGNSLLAKLHAQPSNQGEAHETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCPEPPEENSCNRVPESRPNDESLSENTPSKGRLPALPPHSSLDAFCHSGSISvssvdkpvnsvdkpvrsvdkpvnsvdkpvssvdkpvnsmdkpvnsvdkpvRAVDSAFVSPSMNLFYKKVQSQQsleargqgepqrksdrpqftrrmfvktgaparadtkSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQVgrrqrnsqtnpsvgntagsstYAQRKLQigesqsengpkrslqtesptengPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFTLGNHSPQTSQVASRREETmrsrqsdplpavdsrksqdrksvrnqvrkaehvslkskaifsneesrglsnrheanrrskrsskksveptpaqndensleNDLVRALNLALRTGalmspqnpsaqrpKSFDLEEFAPRamvplhssspniQRKVSSldrkrrsqqnnpnqhrsedvkayrsrtedlkdclsrtenvnastnstkeyrSLVDTAsevrldemghvpDVLRNCVRRDAKVIQnfpnsnevlpssSDFMSNSNSSSRSNANQSLPKSNQSLPNSNQNLPTSNQVPSSTDSVSNTNRaspnatnsnqaltNLTDSVSNTNQESPTSTELAKTSSGGFGLLHSLLASRSAfrsrpqtceptlvrvsfekgpgkkslgfsiVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPntteadskeglnlqpRLIPRADFTTQIYHSynptqprliprADFTTQIyhgynptqprlilrk
MKLFGIKPSGQSVTADTNTEAEDCPLTEAPDMDTRSNDGAVSKRKSSTWTKVAKTFDLMRKSEARQCSEAGPSSQgdggedgrmrrrssiwrrvgsVQSTQAPKgssnesqcsqsqsspqrssqsnnspqnnsqsnnssqsqrspqsqstsqsssqtpcgsqNKGAIRSDLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKSCDSKSLSNDYKSSDCKSLANDYKLSDCKALANDYKSSDSMSLVNDYKPSQTNGSTEVTAHRSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSNESGYDSDSTTRQSEQHSPNSEHFNFGTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFEANGAPKAPHANTSATDKSVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILERSSVKGQTNSNPLLIKATRDFAKDGHLATNDGNSLLAKLHAQPSNQGEAHETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCPEPPEENSCNRVPESRPNDESLSENTPSKGRLPALPPHSSLDAFCHSGSISVSSVDKPVNSVDKPVRSVDKPVNSVDKPVSSVDKPVNSMDKPVNSVDKPVRAVDSAFVSPSMNLFYKKVQSQQSLEARGQGEPQRKSDRPQFTRRMFVKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQVGRRQRNSQTNPSVGNTAGSSTYAQRKLQIGESQSENGPKRSLQTESPTENGPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFTLGNHSPQTSQVASRREETMRSRQSDPLPAVDSRKSQDRKSVRNQVRKAEHVSLKSKAIFSNEESRGLSNRHEANrrskrsskksVEPTPAQNDENSLENDLVRALNLALRTGALMSPQNPSAQRPKSFDLEEFAPRAMVPLHSSSPNIQRKVSSLDRKRRSQQNNPNQHRSEDVKAYRSRTEDLKDCLSRTENVNASTNSTKEYRSLVDTASEVRLDEMGHVPDVLRNCVRRDAKVIQNFPNSNEVLPsssdfmsnsnsssrsnanqslpksnqslpnsnqnlpTSNQVPSSTDSVSNTNRASPNATNSNQALTNLTDSVSNTNQESPTSTELAKTssggfgllhsllasrsafrsrPQTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPNTTEADSKEGLNLQPRLIPRADFTTQIYHSYNPTQPRLIPRADFTTQIYHGYNPTQPRLILRK
******************************************************************************************************************************************************************************************EVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYK**********************************************************************************PHINLPINLYPTPTVAAMSNLNVPVSLHHCAYI**********************************LIEVGDYLSLPLYLNQGTSV*****************************************************VYDFVEPSSVLC***************************************************************************TYSFICFD*********************GDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAG*******************************************************************************************************************************************************************SLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQV********************************************************AIEIG***GTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFT********************************************************************************************************L*L************************************************************************************************************LDEMGHVPDVLRNCVRRDAKVIQ*******************************************************************************************************GLLHSLL***************TLVRVSF*******SLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQ*************LQPRLIPRADFTTQIYHSYNPTQPRLIPRADFTTQIYHGYNP*********
*********G********T*AEDCPLTEA*******************WTKVAKTFDL******************************SIWR*****************************************************************************DLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYK**D************CKSLANDYKLSDCKALANDYKSSDSMSLV*****************RSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYIS***************************GTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFE*****************SVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILER********S*PLLIKATRDFAKDGHLATNDGNSLLA**************TYSFICFDQSNGEKNRIV*******QSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRS*****************************************************************************************************************MNLF********************************VKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVST****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQ**********************************************************RLI***
MKLFGIKPSGQSVTADTNTEAEDCPLTEAPDM****************WTKVAKTFDLMRKS***********************RRSSIWR*************************************************************************AIRSDLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKSCDSKSLSNDYKSSDCKSLANDYKLSDCKALANDYKSSDSMSLVNDY*************HRSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSNE*********************FNFGTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFEANGAP************SVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILERSSVKGQTNSNPLLIKATRDFAKDGHLATNDGNSLLAKLH*********HETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCP*****************************RLPALPPHSSLDAFCHSGSISVSSVDKPVNSVDKPVRSVDKPVNSVDKPVSSVDKPVNSMDKPVNSVDKPVRAVDSAFVSPSMNLFYKKVQ*******************PQFTRRMFVKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQVGRRQRNSQTNPSVGNTAGSSTYAQRKLQI******************TENGPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFTLGNH*********************************************HVSLKSKAIFS***********************************SLENDLVRALNLALRTGALM**********KSFDLEEFAPRAMVPLHSS*********************************RSRTEDLKDCLSRTENVNASTNSTKEYRSLVDTASEVRLDEMGHVPDVLRNCVRRDAKVIQNFPNSNEVLPS*******************************************************NATNSNQALTNLTDS******************SGGFGLLHSLLASRSAFRSRPQTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPNTTEADSKEGLNLQPRLIPRADFTTQIYHSYNPTQPRLIPRADFTTQIYHGYNPTQPRLILRK
*KLFGIKPSGQSVT*******EDCPLT*********************WTKVAKTFDLMRKS***********************************************************************************************************DLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKSCDSKSLSNDYKSSDCKSLANDYKLSDCKALANDYKSSDSMSLVNDYK******STEVT**RSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSN************************FGTPSPPLIEVGDYLSLPLYLNQGT*VDGTDGAKA*GRAGRPDLVARFEDVPTGDGPFEA****************SVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILERSSV***TNSNPLLIKATRDFAKDGHLATNDGNSLLAKLHAQPSN**EAHETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCPEPPE***C****************************HSSLDA*C*S*SISVS*V****************************************SVDKPVRAVDSAFVSPSMNLFYKKVQS*********************T***FVKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNY***************************************PKRSLQTESPTENGPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFT**************************************************VSLKSKAIFSNEESRGLSNR*EANRRSKRSSKKSVEPTPAQ*****LENDLVRALNLALRTGA*********************************NIQRK*S**************************************************************L*EMGHVPDVLRNCVRRDAKVIQN***********************************************************************************************************************QTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPN***************************************RADFTTQIYHGYNPTQPRLILR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLFGIKPSGQSVTADTNTEAEDCPLTEAPDMDTRSNDGAVSKRKSSTWTKVAKTFDLMRKSEARQCSEAGPSSQGDGGEDGRMRRRSSIWRRVGSVQSTQAPKGSSNESQCSQSQSSPQRSSQSNNSPQNNSQSNNSSQSQRSPQSQSTSQSSSQTPCGSQNKGAIRSDLTLSENRPLFSPSLNEEVMDMNYLYNFKCRRKQNFLLLNDYKSLTNDYKSCDSKSLSNDYKSSDCKSLANDYKLSDCKALANDYKSSDSMSLVNDYKPSQTNGSTEVTAHRSTDLVGTDGKPNLSDVSKPLPHINLPINLYPTPTVAAMSNLNVPVSLHHCAYISSNESGYDSDSTTRQSEQHSPNSEHFNFGTPSPPLIEVGDYLSLPLYLNQGTSVDGTDGAKALGRAGRPDLVARFEDVPTGDGPFEANGAPKAPHANTSATDKSVEDVYDFVEPSSVLCSSKGGLKCPPNPVLNSVSNLDILERSSVKGQTNSNPLLIKATRDFAKDGHLATNDGNSLLAKLHAQPSNQGEAHETYSFICFDQSNGEKNRIVEMDHGNTQSDDGDYEYIFNFETKLPKLSEDGGDFGCDRVSNEVDDDIYENVEFKFGCIAGRSCPEPPEENSCNRVPESRPNDESLSENTPSKGRLPALPPHSSLDAFCHSGSISVSSVDKPVNSVDKPVRSVDKPVNSVDKPVSSVDKPVNSMDKPVNSVDKPVRAVDSAFVSPSMNLFYKKVQSQQSLEARGQGEPQRKSDRPQFTRRMFVKTGAPARADTKSLVSLESLRYHYLVNFCEPNFVIAFFAFTDMVRKFHPLKTQPVWSWFVSSNNILMRIWVSTLVPNYQVGRRQRNSQTNPSVGNTAGSSTYAQRKLQIGESQSENGPKRSLQTESPTENGPIVKAAIEIGPQTGTTHFKNAVSSNNIVGNSLVTNSHGQIMSSIATPLFTLGNHSPQTSQVASRREETMRSRQSDPLPAVDSRKSQDRKSVRNQVRKAEHVSLKSKAIFSNEESRGLSNRHEANRRSKRSSKKSVEPTPAQNDENSLENDLVRALNLALRTGALMSPQNPSAQRPKSFDLEEFAPRAMVPLHSSSPNIQRKVSSLDRKRRSQQNNPNQHRSEDVKAYRSRTEDLKDCLSRTENVNASTNSTKEYRSLVDTASEVRLDEMGHVPDVLRNCVRRDAKVIQNFPNSNEVLPSSSDFMSNSNSSSRSNANQSLPKSNQSLPNSNQNLPTSNQVPSSTDSVSNTNRASPNATNSNQALTNLTDSVSNTNQESPTSTELAKTSSGGFGLLHSLLASRSAFRSRPQTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPNTTEADSKEGLNLQPRLIPRADFTTQIYHSYNPTQPRLIPRADFTTQIYHGYNPTQPRLILRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1454 2.2.26 [Sep-21-2011]
O15018 2839 PDZ domain-containing pro yes N/A 0.059 0.030 0.528 8e-18
Q9QZR8 2766 PDZ domain-containing pro yes N/A 0.059 0.031 0.528 1e-17
O759702070 Multiple PDZ domain prote no N/A 0.099 0.070 0.359 1e-15
O551642054 Multiple PDZ domain prote no N/A 0.056 0.039 0.476 6e-15
Q8VBX62055 Multiple PDZ domain prote no N/A 0.056 0.039 0.476 7e-15
Q14005 1332 Pro-interleukin-16 OS=Hom no N/A 0.051 0.056 0.537 1e-13
O54824 1322 Pro-interleukin-16 OS=Mus no N/A 0.044 0.048 0.565 1e-11
Q9CSB4 1203 Partitioning defective 3 no N/A 0.057 0.069 0.402 3e-08
Q15700 870 Disks large homolog 2 OS= no N/A 0.070 0.118 0.388 4e-08
Q91XM9 852 Disks large homolog 2 OS= no N/A 0.070 0.120 0.388 8e-08
>sp|O15018|PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens GN=PDZD2 PE=1 SV=4 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 60/89 (67%), Gaps = 3/89 (3%)

Query: 1302 TLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFN 1361
            +++ +  EKG   K LGFSI GG D  +G+MGIFVKTIFP+G AAE G L EGDEIL  N
Sbjct: 585  SIIGLYKEKG---KGLGFSIAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEILDVN 641

Query: 1362 NEPLQGRTHAEAITIFKKTKQGLVELVLQ 1390
              P++G T  EAI  FK+ + GL  L ++
Sbjct: 642  GIPIKGLTFQEAIHTFKQIRSGLFVLTVR 670

Homo sapiens (taxid: 9606)
>sp|Q9QZR8|PDZD2_RAT PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Pdzd2 PE=1 SV=1 Back     alignment and function description
>sp|O75970|MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2 Back     alignment and function description
>sp|O55164|MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus GN=Mpdz PE=1 SV=1 Back     alignment and function description
>sp|Q8VBX6|MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus GN=Mpdz PE=1 SV=2 Back     alignment and function description
>sp|Q14005|IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens GN=IL16 PE=1 SV=4 Back     alignment and function description
>sp|O54824|IL16_MOUSE Pro-interleukin-16 OS=Mus musculus GN=Il16 PE=1 SV=3 Back     alignment and function description
>sp|Q9CSB4|PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus GN=Pard3b PE=1 SV=2 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description
>sp|Q91XM9|DLG2_MOUSE Disks large homolog 2 OS=Mus musculus GN=Dlg2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1454
3576118761029 putative PDZ domain containing 3 [Danaus 0.063 0.090 0.634 8e-27
242014198861 pdz domain protein arc, putative [Pedicu 0.063 0.108 0.655 8e-26
242004706618 pdz domain protein arc, putative [Pedicu 0.059 0.139 0.651 2e-25
91094275461 PREDICTED: similar to arc CG6741-PB [Tri 0.059 0.186 0.651 1e-24
328712532630 PREDICTED: hypothetical protein LOC10016 0.059 0.136 0.639 5e-24
321479285262 hypothetical protein DAPPUDRAFT_309940 [ 0.068 0.381 0.6 1e-23
328719103699 PREDICTED: hypothetical protein LOC10057 0.056 0.117 0.695 1e-23
328719105701 PREDICTED: hypothetical protein LOC10057 0.056 0.116 0.695 1e-23
383853666956 PREDICTED: uncharacterized protein LOC10 0.059 0.089 0.627 2e-23
350427377976 PREDICTED: hypothetical protein LOC10074 0.059 0.088 0.627 2e-23
>gi|357611876|gb|EHJ67691.1| putative PDZ domain containing 3 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  130 bits (326), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%)

Query: 1297 QTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDE 1356
            Q+ + TL R  F KGPG KSLGFSIVGG DSPKG+MGIFVKT+FP+GQAA+ G + EGDE
Sbjct: 913  QSSQNTLHRAEFWKGPGHKSLGFSIVGGTDSPKGQMGIFVKTVFPNGQAADKGTIYEGDE 972

Query: 1357 ILLFNNEPLQGRTHAEAITIFKKTKQGLVELVL 1389
            IL  NN   +G +HA AI++FKK K+G +EL L
Sbjct: 973  ILSVNNVATRGLSHAGAISLFKKVKEGKLELTL 1005

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242014198|ref|XP_002427780.1| pdz domain protein arc, putative [Pediculus humanus corporis] gi|212512238|gb|EEB15042.1| pdz domain protein arc, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242004706|ref|XP_002423220.1| pdz domain protein arc, putative [Pediculus humanus corporis] gi|212506191|gb|EEB10482.1| pdz domain protein arc, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91094275|ref|XP_970558.1| PREDICTED: similar to arc CG6741-PB [Tribolium castaneum] gi|270014391|gb|EFA10839.1| hypothetical protein TcasGA2_TC001616 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328712532|ref|XP_001952127.2| PREDICTED: hypothetical protein LOC100162662 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|321479285|gb|EFX90241.1| hypothetical protein DAPPUDRAFT_309940 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328719103|ref|XP_003246663.1| PREDICTED: hypothetical protein LOC100574713 isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719105|ref|XP_003246664.1| PREDICTED: hypothetical protein LOC100574713 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383853666|ref|XP_003702343.1| PREDICTED: uncharacterized protein LOC100878180 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350427377|ref|XP_003494737.1| PREDICTED: hypothetical protein LOC100746876 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1454
FB|FBgn00000081329 a "arc" [Drosophila melanogast 0.067 0.073 0.544 4.8e-19
UNIPROTKB|F1NBK4 1141 F1NBK4 "Uncharacterized protei 0.061 0.078 0.576 1.5e-16
UNIPROTKB|F1SMP51588 MPDZ "Uncharacterized protein" 0.059 0.054 0.460 3.1e-13
UNIPROTKB|K7GQ54 1338 IL16 "Uncharacterized protein" 0.080 0.087 0.441 6.3e-13
UNIPROTKB|F1N1J2 1327 IL16 "Interleukin-16" [Bos tau 0.066 0.073 0.505 1.3e-12
UNIPROTKB|H0YLL1 594 IL16 "Pro-interleukin-16" [Hom 0.060 0.148 0.516 2.2e-12
UNIPROTKB|F1MT13 2646 PDZD2 "Uncharacterized protein 0.054 0.029 0.573 4.1e-12
UNIPROTKB|H3BVH5 1221 IL16 "Pro-interleukin-16" [Hom 0.060 0.072 0.516 6.6e-12
UNIPROTKB|Q14005 1332 IL16 "Pro-interleukin-16" [Hom 0.060 0.066 0.516 7.4e-12
RGD|619958 2766 Pdzd2 "PDZ domain containing 2 0.054 0.028 0.573 2e-11
FB|FBgn0000008 a "arc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 4.8e-19, Sum P(3) = 4.8e-19
 Identities = 55/101 (54%), Positives = 69/101 (68%)

Query:  1299 CEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEIL 1358
             C P  +  +F KGPG KSLGFSIVGG DSPKG MGIFVKT+FP GQAA+ G L  GDEI+
Sbjct:  1228 CTPKTI--TFFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIV 1285

Query:  1359 LFNNEPLQGRTHAEAITIFKKTKQGLVEL-VLQPNTTEADS 1398
               N   +QG +HAE I +FK  ++G + L +L+    +A S
Sbjct:  1286 EINGNSVQGMSHAETIGLFKNVREGTIVLKILRRKLQKAKS 1326
GO:0005912 "adherens junction" evidence=IDA
GO:0048749 "compound eye development" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|F1NBK4 F1NBK4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP5 MPDZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQ54 IL16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1J2 IL16 "Interleukin-16" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLL1 IL16 "Pro-interleukin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT13 PDZD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H3BVH5 IL16 "Pro-interleukin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14005 IL16 "Pro-interleukin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619958 Pdzd2 "PDZ domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1454
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 7e-17
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 6e-15
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-09
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-08
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 76.5 bits (189), Expect = 7e-17
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 1303 LVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNN 1362
            +  V+  K PG   LGFS+ GG DS     GIFV  + P G  AE G L  GD IL  N 
Sbjct: 1    VRTVTLRKDPGG-GLGFSLRGGKDS---GGGIFVSRVEP-GGPAERGGLRVGDRILEVNG 55

Query: 1363 EPLQGRTHAEAITIFKKTKQGLVELVLQ 1390
              ++G TH EA+ + K +    V L ++
Sbjct: 56   VSVEGLTHEEAVELLKNSG-DEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1454
KOG3209|consensus984 99.59
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.41
KOG0609|consensus 542 99.31
KOG3550|consensus207 99.26
KOG3209|consensus984 99.19
KOG3551|consensus 506 99.02
KOG1892|consensus 1629 98.98
KOG3549|consensus 505 98.94
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.89
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.83
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.82
KOG3580|consensus 1027 98.72
KOG3580|consensus 1027 98.72
KOG3553|consensus124 98.59
KOG3571|consensus 626 98.55
KOG3606|consensus358 98.54
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.51
KOG3651|consensus 429 98.46
KOG3605|consensus829 98.3
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.3
KOG3605|consensus829 98.12
KOG3552|consensus 1298 98.1
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.94
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.93
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.91
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.85
KOG3542|consensus 1283 97.84
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 97.77
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.77
PRK11186 667 carboxy-terminal protease; Provisional 97.76
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.61
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.58
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.57
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.47
PRK10942473 serine endoprotease; Provisional 97.43
PRK10139455 serine endoprotease; Provisional 97.35
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.31
KOG3938|consensus334 97.07
TIGR01713259 typeII_sec_gspC general secretion pathway protein 96.84
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.76
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 96.61
PRK10139455 serine endoprotease; Provisional 96.56
PRK10898353 serine endoprotease; Provisional 96.53
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.5
PRK10942473 serine endoprotease; Provisional 96.22
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 95.96
KOG0606|consensus 1205 95.8
PRK10779 449 zinc metallopeptidase RseP; Provisional 95.72
KOG1738|consensus 638 95.47
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.39
KOG4371|consensus1332 94.89
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 94.63
KOG0792|consensus 1144 94.18
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 93.67
COG3975558 Predicted protease with the C-terminal PDZ domain 92.85
KOG3129|consensus231 92.47
COG0265347 DegQ Trypsin-like serine proteases, typically peri 91.63
KOG3532|consensus 1051 90.32
PRK09681276 putative type II secretion protein GspC; Provision 89.45
KOG4371|consensus1332 88.36
KOG1320|consensus473 87.13
COG3480342 SdrC Predicted secreted protein containing a PDZ d 87.08
KOG1421|consensus 955 82.5
COG3031275 PulC Type II secretory pathway, component PulC [In 81.73
>KOG3209|consensus Back     alignment and domain information 
Probab=99.59  E-value=4.4e-15  Score=172.82  Aligned_cols=149  Identities=26%  Similarity=0.341  Sum_probs=118.8

Q ss_pred             CCCCCCCCCCCCCceeccCCccCccCCCCCCchhhhcccCCCCcccccc------------------------ccccccc
Q psy6070        1236 NTNRASPNATNSNQALTNLTDSVSNTNQESPTSTELAKTSSGGFGLLHS------------------------LLASRSA 1291 (1454)
Q Consensus      1236 SGAARSPSsTqGDRLLeVNGEDVSNASQEEpSSVqLLKkSSgSVgLlhS------------------------iLASssv 1291 (1454)
                      |.+.|+..+..||+|+.|||.++.+++|...  +.+++.++-++.+..-                        .......
T Consensus       789 SPAdRCgkLkVGDrilAVNG~sI~~lsHadi--v~LIKdaGlsVtLtIip~ee~~~~~~~~sa~~~s~~t~~~~~~q~~g  866 (984)
T KOG3209|consen  789 SPADRCGKLKVGDRILAVNGQSILNLSHADI--VSLIKDAGLSVTLTIIPPEEAGPPTSMTSAEKQSPFTQNGPYEQQYG  866 (984)
T ss_pred             ChhHhhccccccceEEEecCeeeeccCchhH--HHHHHhcCceEEEEEcChhccCCCCCCcchhhcCcccccCCHhHccC
Confidence            3468899999999999999999999999998  7888877766665320                        0000000


Q ss_pred             cCCC--------C-------------CCCCCceEEEEEEeCCCCCcccEEEEeccCCCCCCccEEEEEeCCCChhhhcCC
Q psy6070        1292 FRSR--------P-------------QTCEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGL 1350 (1454)
Q Consensus      1292 LPSR--------P-------------rs~ppEIRTVrLqKGpG~EGLGFSIRGGkDQP~Gd~GIFISRVIPGGPADRDGR 1350 (1454)
                      ++..        |             ......+..|.|+|+.  +||||+|+||...   .|++||-++...|||.++||
T Consensus       867 lp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelErG~--kGFGFSiRGGrey---nM~LfVLRlAeDGPA~rdGr  941 (984)
T KOG3209|consen  867 LPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELERGA--KGFGFSIRGGREY---NMDLFVLRLAEDGPAIRDGR  941 (984)
T ss_pred             CCCCCccccccCCCCccccceeccccccccCCeeEEEeeccc--cccceEeeccccc---ccceEEEEeccCCCccccCc
Confidence            1110        0             1234567899999998  8999999999754   68999999999999999999


Q ss_pred             CCCCCEEEeeCCeeCCCCCHHHHHHHHhcCCCCeEEEEEEcC
Q psy6070        1351 LVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQPN 1392 (1454)
Q Consensus      1351 LRVGDRILEVNGISVEGLTHEEAVSLLKqSGqGSVsLVVrR~ 1392 (1454)
                      +++||+|++|||++..||||+.|+++||+.+ ..|.|++++.
T Consensus       942 m~VGDqi~eINGesTkgmtH~rAIelIk~gg-~~vll~Lr~g  982 (984)
T KOG3209|consen  942 MRVGDQITEINGESTKGMTHDRAIELIKQGG-RRVLLLLRRG  982 (984)
T ss_pred             eeecceEEEecCcccCCCcHHHHHHHHHhCC-eEEEEEeccC
Confidence            9999999999999999999999999999986 5666666654

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1454
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 6e-16
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 3e-09
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 3e-08
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 4e-08
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 4e-08
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-07
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 1e-07
4amh_A106 Influence Of Circular Permutation On The Folding Pa 2e-07
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 4e-07
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 6e-07
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 7e-07
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 7e-07
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 1e-06
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 1e-06
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 1e-06
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-06
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-06
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 2e-06
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-06
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 2e-06
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 2e-06
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 3e-06
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 5e-06
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 6e-06
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 7e-06
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 7e-06
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 8e-06
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 8e-06
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 1e-05
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 1e-05
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 1e-05
1ujd_A117 Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of 2e-05
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 2e-05
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 2e-05
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 2e-05
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 2e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-05
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 3e-05
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 3e-05
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 3e-05
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 5e-05
1kef_A93 Pdz1 Of Sap90 Length = 93 5e-05
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 6e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 6e-05
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 8e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 1e-04
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 1e-04
1i16_A130 Structure Of Interleukin 16: Implications For Funct 1e-04
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 2e-04
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-04
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 3e-04
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 4e-04
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 5e-04
1ueq_A123 Solution Structure Of The First Pdz Domain Of Human 5e-04
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 5e-04
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 5e-04
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 7e-04
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 7e-04
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 7e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 8e-04
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 8e-04
2db5_A128 Solution Structure Of The First Pdz Domain Of Inad- 8e-04
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 8e-04
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure 
Iteration: 1

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 42/94 (44%), Positives = 59/94 (62%), Gaps = 2/94 (2%)
Query: 1301 PTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLF 1360
            P    ++ E+GP    LGFSIVGG  SP G++ I+VKT+F  G A+E G L  GD+I+  
Sbjct: 24   PQCKSITLERGP--DGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAV 81
Query: 1361 NNEPLQGRTHAEAITIFKKTKQGLVELVLQPNTT 1394
            N + L+G TH EA+ I K+TK  +  +VL  + T
Sbjct: 82   NGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDET 115
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|1UJD|A Chain A, Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of Hypothetical Kiaa0559 Protein From Human Cdna Length = 117 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|1I16|A Chain A, Structure Of Interleukin 16: Implications For Function, Nmr, 20 Structures Length = 130 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|1UEQ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 123 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|2DB5|A Chain A, Solution Structure Of The First Pdz Domain Of Inad-Like Protein Length = 128 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1454
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-29
2fne_A117 Multiple PDZ domain protein; structural protein, s 6e-29
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-29
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 8e-29
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-28
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-28
2o2t_A117 Multiple PDZ domain protein; structural protein, s 3e-28
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 4e-28
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 5e-28
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-27
2awx_A105 Synapse associated protein 97; membrane protein, s 1e-27
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-27
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-27
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 3e-27
2byg_A117 Channel associated protein of synapse-110; DLG2, P 3e-27
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 5e-27
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-26
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 6e-26
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-25
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 1e-25
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-25
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-25
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-25
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-25
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 3e-25
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 3e-25
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 8e-25
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-24
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-24
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-24
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-24
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 4e-24
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-24
2opg_A98 Multiple PDZ domain protein; structural protein, s 7e-24
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 9e-24
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-23
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-23
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 1e-23
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-23
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-23
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-23
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-23
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-23
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 4e-23
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-23
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 8e-23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 8e-23
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 9e-23
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-22
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-22
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 3e-22
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-22
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 5e-22
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-22
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 6e-22
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 8e-22
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 9e-22
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 9e-22
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-21
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-21
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-21
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-21
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-21
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-21
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-21
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 9e-21
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-20
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-20
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-20
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 4e-20
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 6e-20
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 7e-20
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-17
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-19
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-19
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-19
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-19
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-19
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-19
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-19
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-19
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-19
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 5e-19
2eeh_A100 PDZ domain-containing protein 7; structural genomi 8e-19
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-18
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 6e-17
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-18
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-18
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 3e-18
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-18
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-18
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 8e-18
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 8e-18
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 8e-18
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-17
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-17
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 4e-17
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-17
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 7e-17
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 8e-17
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-16
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-16
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-16
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-16
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-16
3k1r_A192 Harmonin; protein-protein complex, alternative spl 4e-16
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 7e-16
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 8e-16
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 9e-16
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-15
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-15
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-15
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-15
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 4e-15
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-15
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 8e-15
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-14
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-14
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 4e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-14
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 5e-14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-14
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 7e-14
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 7e-14
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-13
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 8e-13
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-06
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-13
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-13
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-13
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-05
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 8e-13
2v90_A96 PDZ domain-containing protein 3; membrane, protein 9e-13
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-12
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-12
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-12
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-12
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 2e-12
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-12
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-12
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 3e-12
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-12
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 8e-12
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-11
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 3e-11
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 3e-11
2ego_A96 General receptor for phosphoinositides 1- associat 4e-11
3khf_A99 Microtubule-associated serine/threonine-protein ki 4e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-11
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-10
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 6e-10
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 6e-10
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-09
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-09
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-06
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 7e-09
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 7e-09
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-08
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 1e-08
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-08
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-08
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
 Score =  111 bits (280), Expect = 5e-29
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 1283 HSLLASRSAFRSRPQTCEPTLVR-VSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFP 1341
            H   +S     +     +   +R V  +KGP   SLG SI GGV SP G++ IF+  + P
Sbjct: 4    HHHHSSGVDLGTENLYFQSMGLRTVEMKKGPTD-SLGISIAGGVGSPLGDVPIFIAMMHP 62

Query: 1342 HGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKKTKQGLVELVLQP 1391
             G AA++  L  GD I+       +G TH +A+ + K    G +E+ +  
Sbjct: 63   TGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNAS-GSIEMQVVA 111
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1454
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.51
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.5
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.49
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.49
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.49
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.47
2awx_A105 Synapse associated protein 97; membrane protein, s 99.47
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.47
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.47
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.47
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.46
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.45
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.45
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.44
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.44
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.44
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.44
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.44
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.43
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.43
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.43
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.43
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.42
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.41
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.41
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.41
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.4
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.4
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.4
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.4
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.39
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.39
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.39
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.39
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.39
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.38
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.38
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.38
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.38
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.38
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.38
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.38
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.37
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.37
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.37
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.37
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.37
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.37
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.37
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.37
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.36
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.36
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.36
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.36
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.36
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.36
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.36
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.36
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.35
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.35
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.35
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.35
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.34
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.34
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.34
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.33
2ego_A96 General receptor for phosphoinositides 1- associat 99.33
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.33
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.33
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.32
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.32
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.32
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.32
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.31
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.31
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.31
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.31
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.3
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.3
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.3
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.3
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.29
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.29
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.28
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.28
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.28
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.28
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.28
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.27
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.27
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.27
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.26
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.26
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.26
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.26
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.25
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.25
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.25
2d90_A102 PDZ domain containing protein 1; structural genomi 99.24
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.24
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.24
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.24
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.24
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.24
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.23
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.23
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.22
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.22
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.22
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.22
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.22
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.22
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.21
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.21
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.21
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.21
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.21
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.21
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.2
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.2
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.2
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.2
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.19
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.19
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.18
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.18
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.18
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.17
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.17
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.17
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.16
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.14
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.13
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.13
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.12
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.12
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.12
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.12
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.1
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.09
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.09
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.09
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.08
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.07
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.06
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.06
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.06
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.05
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.04
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.03
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.6
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.02
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.02
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.01
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.99
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.98
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.97
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.96
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.93
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.9
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.89
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.85
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.83
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.81
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.7
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.69
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.51
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.24
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.2
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.1
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.95
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 97.88
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.88
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 97.87
2kl1_A94 YLBL protein; structure genomics, structural genom 97.83
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.82
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 97.81
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.79
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.77
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.73
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 97.7
3k50_A 403 Putative S41 protease; structural genomics, joint 97.56
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.54
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.49
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.48
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.47
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.4
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.35
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.28
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.25
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.14
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.1
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.08
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.71
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 96.36
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 94.14
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 93.72
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
Probab=99.51  E-value=6.9e-14  Score=130.73  Aligned_cols=94  Identities=33%  Similarity=0.494  Sum_probs=82.0

Q ss_pred             CCCceEEEEEEeCCCCCcccEEEEeccCCCCCCccEEEEEeCCCChhhhcCCCCCCCEEEeeCCeeCCCCCHHHHHHHHh
Q psy6070        1299 CEPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFK 1378 (1454)
Q Consensus      1299 ~ppEIRTVrLqKGpG~EGLGFSIRGGkDQP~Gd~GIFISRVIPGGPADRDGRLRVGDRILEVNGISVEGLTHEEAVSLLK 1378 (1454)
                      .+.+++.|+|.|+.  .||||+|.++.+.+.+..+++|..|.+||+|+++|.|++||+|++|||+++.+++|++++.+|+
T Consensus        26 ~~~~~~~v~l~k~~--~glG~~i~gg~~~~~~~~~i~I~~V~~gs~A~~aggL~~GD~Il~Vng~~v~~~~~~~~~~~l~  103 (130)
T 1i16_A           26 AEATVCTVTLEKMS--AGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIK  103 (130)
T ss_dssp             SSEEEEEEEEETTS--SSTTEEEECCCCCSSSCCCCEEEEECSSCCCSSSCCCCTTCCEEECSSCBGGGSCHHHHHHHHH
T ss_pred             CCCcEEEEEEEcCC--CccCEEEecCcCCCCCCCCEEEEEECCCCHHHHcCCCCCCCEEEEECCEECCCCCHHHHHHHHH
Confidence            34677899999976  6999999998875444568999999999999999559999999999999999999999999999


Q ss_pred             cCCCCeEEEEEEcCCC
Q psy6070        1379 KTKQGLVELVLQPNTT 1394 (1454)
Q Consensus      1379 qSGqGSVsLVVrR~ks 1394 (1454)
                      ..+...|.|+|.|...
T Consensus       104 ~~~~~~v~l~v~r~~~  119 (130)
T 1i16_A          104 ALPDGPVTIVIRRKSL  119 (130)
T ss_dssp             TSCSSEEEEEEEEESS
T ss_pred             hCCCceEEEEEEeCCC
Confidence            9975679999988643
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1454
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-22
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-21
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 8e-21
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-20
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-20
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 8e-20
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-18
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-18
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-18
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-18
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 6e-18
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 8e-18
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 9e-18
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-17
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-17
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-17
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 1e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-17
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-17
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 8e-17
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 8e-17
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 1e-16
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-16
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-16
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 4e-16
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-16
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-15
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-15
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-15
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-15
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-15
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-15
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-15
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 9e-15
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 9e-15
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-14
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-14
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-14
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-13
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-13
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-13
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 4e-13
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 4e-13
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-13
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 1e-12
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-12
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-12
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 7e-12
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 9e-12
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-11
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 7e-11
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 8e-11
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-10
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-10
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 5e-10
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-09
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-09
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 7e-07
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-04
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 0.002
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Afadin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 89.9 bits (223), Expect = 4e-22
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1300 EPTLVRVSFEKGPGKKSLGFSIVGGVDSPKGEMGIFVKTIFPHGQAAESGLLVEGDEILL 1359
            EP ++ V+ +K  G   +G SIV    + + ++GI+VK++   G A   G L  GD++L 
Sbjct: 2    EPEIITVTLKKQNG---MGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLS 58

Query: 1360 FNNEPLQGRTHAEAITIFKKTKQGLVELVLQ 1390
             +   L G +   A  +  +T   +V L + 
Sbjct: 59   VDGRSLVGLSQERAAELMTRTS-SVVTLEVA 88
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1454
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.7
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.7
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.68
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.68
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.68
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.66
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.66
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.64
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.63
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.62
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.62
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.62
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.61
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.6
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.6
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.6
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.6
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.59
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.58
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.58
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.57
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.57
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.57
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.57
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.57
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.56
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.56
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.55
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.55
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.53
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.53
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.53
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.53
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.52
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.52
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.52
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.51
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.5
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.5
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.5
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.49
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.49
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.46
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.45
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.44
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.44
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.42
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.41
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.38
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.31
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.17
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.52
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.29
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.28
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.04
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.77
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.73
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 97.48
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 97.4
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.70  E-value=4.1e-17  Score=143.96  Aligned_cols=89  Identities=34%  Similarity=0.603  Sum_probs=80.1

Q ss_pred             ceEEEEEEeCCCCCcccEEEEeccCCCC--CCccEEEEEeCCCChhhhcCCCCCCCEEEeeCCeeCCCCCHHHHHHHHhc
Q psy6070        1302 TLVRVSFEKGPGKKSLGFSIVGGVDSPK--GEMGIFVKTIFPHGQAAESGLLVEGDEILLFNNEPLQGRTHAEAITIFKK 1379 (1454)
Q Consensus      1302 EIRTVrLqKGpG~EGLGFSIRGGkDQP~--Gd~GIFISRVIPGGPADRDGRLRVGDRILEVNGISVEGLTHEEAVSLLKq 1379 (1454)
                      ++++|+|.|+.  .||||+|.||.+.+.  ...+|||+.|.+||+|+++|+|++||+|++|||+++.+++|++|+++|+.
T Consensus         1 E~~~V~l~k~~--~glG~~i~gg~~~~~~~~~~gi~I~~V~~gg~A~~~G~L~~GD~Il~VNg~~v~~~s~~e~~~~l~~   78 (93)
T d1rgra_           1 EYEEITLERGN--SGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKE   78 (93)
T ss_dssp             CEEEEEEECCS--SCCSEEECCCSSSCSCTTCCCCCEEEECTTSHHHHHCCCCTTCEEEEETTEECSSSCHHHHHHHHHH
T ss_pred             CCEEEEEEeCC--CcCCEEEEeecCCCCcCCCCCEEEEEECCCChHHhcCCCCcCcEEEEECCEECCCCCHHHHHHHHHc
Confidence            45789999986  689999999877532  35689999999999999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEEEcCC
Q psy6070        1380 TKQGLVELVLQPNT 1393 (1454)
Q Consensus      1380 SGqGSVsLVVrR~k 1393 (1454)
                      ++ +.|.|+|.|..
T Consensus        79 ~~-~~v~L~v~R~~   91 (93)
T d1rgra_          79 AG-SIVRLYVMRRK   91 (93)
T ss_dssp             TT-TEEEEEEECSC
T ss_pred             CC-CEEEEEEEeCC
Confidence            86 79999999865
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure