Psyllid ID: psy6185
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 79 | ||||||
| 242005831 | 441 | WD repeat domain phosphoinositide-intera | 0.696 | 0.124 | 0.818 | 3e-18 | |
| 383861761 | 472 | PREDICTED: WD repeat domain phosphoinosi | 0.696 | 0.116 | 0.836 | 4e-18 | |
| 193613342 | 422 | PREDICTED: WD repeat domain phosphoinosi | 0.696 | 0.130 | 0.818 | 5e-18 | |
| 405974503 | 438 | WD repeat domain phosphoinositide-intera | 0.696 | 0.125 | 0.781 | 1e-17 | |
| 72014139 | 486 | PREDICTED: WD repeat domain phosphoinosi | 0.696 | 0.113 | 0.781 | 1e-16 | |
| 443695598 | 465 | hypothetical protein CAPTEDRAFT_169421 [ | 0.696 | 0.118 | 0.763 | 4e-16 | |
| 307211145 | 378 | WD repeat domain phosphoinositide-intera | 0.708 | 0.148 | 0.767 | 4e-16 | |
| 432870745 | 425 | PREDICTED: LOW QUALITY PROTEIN: WD repea | 0.696 | 0.129 | 0.767 | 1e-15 | |
| 344289650 | 425 | PREDICTED: WD repeat domain phosphoinosi | 0.696 | 0.129 | 0.767 | 1e-15 | |
| 344289648 | 436 | PREDICTED: WD repeat domain phosphoinosi | 0.696 | 0.126 | 0.767 | 1e-15 |
| >gi|242005831|ref|XP_002423764.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] gi|212506966|gb|EEB11026.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 95.9 bits (237), Expect = 3e-18, Method: Compositional matrix adjust.
Identities = 45/55 (81%), Positives = 52/55 (94%)
Query: 11 SLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKL 65
SL+VGTK+GY+LFSL+S+D LEQIYEN ED+CIVERLFSSSLVA+VSLSSPRKL
Sbjct: 47 SLTVGTKTGYKLFSLHSVDLLEQIYENEAEDICIVERLFSSSLVAIVSLSSPRKL 101
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383861761|ref|XP_003706353.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|193613342|ref|XP_001951577.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|405974503|gb|EKC39143.1| WD repeat domain phosphoinositide-interacting protein 2 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|72014139|ref|XP_781358.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|443695598|gb|ELT96465.1| hypothetical protein CAPTEDRAFT_169421 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|307211145|gb|EFN87363.1| WD repeat domain phosphoinositide-interacting protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|432870745|ref|XP_004071827.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat domain phosphoinositide-interacting protein 2-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|344289650|ref|XP_003416555.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2 isoform 2 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|344289648|ref|XP_003416554.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2 isoform 1 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 79 | ||||||
| ZFIN|ZDB-GENE-040718-488 | 431 | wipi2 "WD repeat domain, phosp | 0.696 | 0.127 | 0.571 | 6.4e-10 | |
| UNIPROTKB|Q7ZWU5 | 435 | wipi2 "WD repeat domain phosph | 0.696 | 0.126 | 0.553 | 1.8e-09 | |
| UNIPROTKB|Q5ZHN3 | 436 | WIPI2 "WD repeat domain phosph | 0.696 | 0.126 | 0.553 | 1.8e-09 | |
| UNIPROTKB|Q2KJ60 | 436 | WIPI2 "Uncharacterized protein | 0.696 | 0.126 | 0.553 | 1.8e-09 | |
| UNIPROTKB|D7RA31 | 436 | WIPI2 "Uncharacterized protein | 0.696 | 0.126 | 0.553 | 1.8e-09 | |
| MGI|MGI:1923831 | 445 | Wipi2 "WD repeat domain, phosp | 0.696 | 0.123 | 0.553 | 1.8e-09 | |
| RGD|1359154 | 445 | Wipi2 "WD repeat domain, phosp | 0.696 | 0.123 | 0.553 | 1.8e-09 | |
| UNIPROTKB|Q9Y4P8 | 454 | WIPI2 "WD repeat domain phosph | 0.696 | 0.121 | 0.553 | 1.9e-09 | |
| UNIPROTKB|D7RA30 | 446 | WIPI1 "WD repeat domain phosph | 0.696 | 0.123 | 0.410 | 8.8e-06 | |
| MGI|MGI:1261864 | 446 | Wipi1 "WD repeat domain, phosp | 0.696 | 0.123 | 0.410 | 8.8e-06 |
| ZFIN|ZDB-GENE-040718-488 wipi2 "WD repeat domain, phosphoinositide interacting 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 150 (57.9 bits), Expect = 6.4e-10, P = 6.4e-10
Identities = 32/56 (57%), Positives = 36/56 (64%)
Query: 11 SLSVGTKSGYRLFSLNSIDTLEQIYE-NSQEDVCIVERXXXXXXXXXXXXXXPRKL 65
SL+VGTKSGY+ FSL+S+D LEQIYE EDVCIVER PRKL
Sbjct: 26 SLAVGTKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKL 81
|
|
| UNIPROTKB|Q7ZWU5 wipi2 "WD repeat domain phosphoinositide-interacting protein 2" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZHN3 WIPI2 "WD repeat domain phosphoinositide-interacting protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KJ60 WIPI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D7RA31 WIPI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923831 Wipi2 "WD repeat domain, phosphoinositide interacting 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359154 Wipi2 "WD repeat domain, phosphoinositide interacting 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4P8 WIPI2 "WD repeat domain phosphoinositide-interacting protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D7RA30 WIPI1 "WD repeat domain phosphoinositide-interacting 1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1261864 Wipi1 "WD repeat domain, phosphoinositide interacting 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 79 | |||
| KOG2111|consensus | 346 | 99.96 | ||
| KOG2110|consensus | 391 | 99.9 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 96.51 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 96.24 | |
| PTZ00421 | 493 | coronin; Provisional | 96.16 | |
| KOG2048|consensus | 691 | 96.15 | ||
| KOG0305|consensus | 484 | 96.07 | ||
| PTZ00420 | 568 | coronin; Provisional | 96.0 | |
| PTZ00421 | 493 | coronin; Provisional | 95.58 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 95.38 | |
| KOG0271|consensus | 480 | 95.31 | ||
| KOG0273|consensus | 524 | 95.17 | ||
| KOG1407|consensus | 313 | 95.03 | ||
| KOG2111|consensus | 346 | 94.99 | ||
| KOG0316|consensus | 307 | 94.97 | ||
| KOG0265|consensus | 338 | 94.56 | ||
| KOG0265|consensus | 338 | 94.25 | ||
| KOG0266|consensus | 456 | 94.18 | ||
| KOG0276|consensus | 794 | 94.12 | ||
| KOG2919|consensus | 406 | 94.07 | ||
| KOG1963|consensus | 792 | 93.63 | ||
| KOG0973|consensus | 942 | 93.56 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 93.48 | |
| KOG0318|consensus | 603 | 93.12 | ||
| PTZ00420 | 568 | coronin; Provisional | 92.56 | |
| KOG0278|consensus | 334 | 92.48 | ||
| KOG0640|consensus | 430 | 92.15 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 92.1 | |
| KOG0302|consensus | 440 | 90.25 | ||
| KOG0282|consensus | 503 | 90.22 | ||
| KOG1273|consensus | 405 | 90.05 | ||
| KOG1274|consensus | 933 | 89.39 | ||
| KOG0647|consensus | 347 | 88.47 | ||
| KOG0266|consensus | 456 | 88.35 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 88.29 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 87.81 | |
| KOG2321|consensus | 703 | 87.66 | ||
| KOG1036|consensus | 323 | 87.4 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 87.27 | |
| KOG0272|consensus | 459 | 86.68 | ||
| KOG0271|consensus | 480 | 86.56 | ||
| KOG0274|consensus | 537 | 86.35 | ||
| KOG0274|consensus | 537 | 86.24 | ||
| PF14781 | 136 | BBS2_N: Ciliary BBSome complex subunit 2, N-termin | 86.1 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 85.85 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 85.76 | |
| KOG0306|consensus | 888 | 85.75 | ||
| KOG0284|consensus | 464 | 85.35 | ||
| KOG0771|consensus | 398 | 85.35 | ||
| PF10763 | 80 | DUF2584: Protein of unknown function (DUF2584); In | 85.23 | |
| KOG0306|consensus | 888 | 83.08 | ||
| KOG0291|consensus | 893 | 82.75 | ||
| KOG0303|consensus | 472 | 82.53 | ||
| KOG0640|consensus | 430 | 82.42 | ||
| PF00780 | 275 | CNH: CNH domain; InterPro: IPR001180 Based on sequ | 81.74 | |
| KOG0279|consensus | 315 | 81.31 | ||
| KOG0319|consensus | 775 | 81.16 | ||
| smart00036 | 302 | CNH Domain found in NIK1-like kinases, mouse citro | 80.95 | |
| KOG0264|consensus | 422 | 80.51 | ||
| KOG0310|consensus | 487 | 80.46 | ||
| KOG0289|consensus | 506 | 80.13 |
| >KOG2111|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=4.1e-30 Score=191.71 Aligned_cols=75 Identities=20% Similarity=0.262 Sum_probs=66.7
Q ss_pred eeeccCCCCEEEEEcCCceEEEecCCcchhheeeec--cCCCeEEEEEecccceEEEecc-----CCCcEEEEEeCCCCe
Q psy6185 2 CSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYEN--SQEDVCIVERLFSSSLVAVVSL-----SSPRKLTKEEGKNEE 74 (79)
Q Consensus 2 ~~~fNQD~sc~~vgt~~GfrIyn~~~~d~~~~~~~~--~~g~v~ivEmLf~snLlalVg~-----~~prkL~I~d~~~~~ 74 (79)
.++||||+|||+|||++|||||||+| +++..++ ..+|+++||||||||++|+||| ++||||+||||.+++
T Consensus 10 svs~NQD~ScFava~~~Gfriyn~~P---~ke~~~r~~~~~G~~~veMLfR~N~laLVGGg~~pky~pNkviIWDD~k~~ 86 (346)
T KOG2111|consen 10 SVSFNQDHSCFAVATDTGFRIYNCDP---FKESASRQFIDGGFKIVEMLFRSNYLALVGGGSRPKYPPNKVIIWDDLKER 86 (346)
T ss_pred EEEEccCCceEEEEecCceEEEecCc---hhhhhhhccccCchhhhhHhhhhceEEEecCCCCCCCCCceEEEEecccCc
Confidence 47999999999999999999999655 6665544 4677999999999999999998 899999999999999
Q ss_pred EEeeC
Q psy6185 75 EEKKI 79 (79)
Q Consensus 75 ~I~~~ 79 (79)
+|.|+
T Consensus 87 ~i~el 91 (346)
T KOG2111|consen 87 CIIEL 91 (346)
T ss_pred EEEEE
Confidence 99874
|
|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >PF10763 DUF2584: Protein of unknown function (DUF2584); InterPro: IPR019699 This entry is represented by Bacteriophage 0305phi8-36, Orf221 | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 79 | |||
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 2e-09 |
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 | Back alignment and structure |
|---|
Score = 50.8 bits (121), Expect = 2e-09
Identities = 8/55 (14%), Positives = 20/55 (36%), Gaps = 4/55 (7%)
Query: 11 SLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKL 65
L + T + ++++ + I + V L ++ VA V+ +
Sbjct: 33 CLILSTLKSFEIYNV---HPVAHIMSQEMRHLSKVRMLHRTNYVAFVT-GVKEVV 83
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 79 | |||
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.33 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.52 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.46 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 97.35 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.35 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.31 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 97.31 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.25 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.24 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.16 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.13 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.12 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.12 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.11 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.09 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.08 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.07 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.07 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.02 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.01 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 96.97 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 96.95 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 96.93 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 96.91 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 96.87 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 96.86 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 96.85 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 96.82 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 96.75 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 96.74 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 96.69 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 96.69 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.65 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 96.65 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 96.65 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.61 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 96.61 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 96.59 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 96.57 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 96.54 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 96.54 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.52 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 96.46 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 96.45 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 96.43 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.42 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 96.41 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 96.39 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 96.39 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 96.38 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.36 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 96.36 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 96.3 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.18 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 96.17 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 96.16 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 96.16 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 96.14 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 96.14 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 96.13 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 96.13 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 96.1 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 96.08 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 95.97 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 95.96 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 95.95 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 95.94 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 95.87 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 95.87 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 95.84 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 95.82 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 95.73 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 95.73 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 95.72 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 95.72 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 95.67 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 95.59 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 95.51 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 95.5 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 95.5 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 95.48 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 95.47 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 95.39 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 95.37 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 95.33 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 95.33 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 95.33 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 95.31 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 95.31 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 95.24 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 95.21 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 95.09 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 95.01 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 94.98 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 94.98 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 94.78 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 94.72 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 94.67 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 94.34 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 94.16 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 94.15 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 94.13 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 94.08 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 94.04 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 93.93 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 93.86 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 93.84 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 93.82 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 93.74 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 93.59 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 92.99 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 92.74 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 92.57 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 92.56 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 92.49 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 92.46 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 92.45 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 92.42 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 92.35 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 92.31 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 92.27 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 92.21 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 91.23 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 91.03 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 90.85 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 90.72 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 90.53 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 89.87 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 89.8 | |
| 2nwa_A | 88 | Hypothetical protein YTMB; mostly beta protein, st | 89.6 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 89.21 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 89.17 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 88.68 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 88.4 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 86.99 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 86.32 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 83.19 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 82.97 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 80.97 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 80.15 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 80.02 |
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
Probab=99.33 E-value=6.6e-12 Score=88.73 Aligned_cols=74 Identities=11% Similarity=0.137 Sum_probs=63.2
Q ss_pred CeeeccCCCCEEEEEcCCceEEEecCCcchhheeeeccCCCeEEEEEecccceEEEeccCCCcEEEEEeCCCCeEEee
Q psy6185 1 MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEEKK 78 (79)
Q Consensus 1 ~~~~fNQD~sc~~vgt~~GfrIyn~~~~d~~~~~~~~~~g~v~ivEmLf~snLlalVg~~~prkL~I~d~~~~~~I~~ 78 (79)
.|++||+|++.+++|.++|++||++++ .+..+..+.+++.+++++++++++|++|+.+ ++++|||.++++.+.+
T Consensus 23 ~~v~fs~dg~~la~g~~~~~~iw~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-~~v~iWd~~~~~~~~~ 96 (355)
T 3vu4_A 23 TDYEFNQDQSCLILSTLKSFEIYNVHP---VAHIMSQEMRHLSKVRMLHRTNYVAFVTGVK-EVVHIWDDVKKQDVSR 96 (355)
T ss_dssp CEEEECTTSSEEEEECSSEEEEEEETT---EEEEEEEECSCCCEEEECTTSSEEEEECSST-TEEEEEETTTTEEEEE
T ss_pred EEEEECCCCCEEEEEcCCEEEEEecCC---cceeeeeecCCeEEEEEcCCCCEEEEEECCc-cEEEEEECCCCcEEEE
Confidence 489999999999999999999999654 4555555556899999999999999999654 7999999999988765
|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2nwa_A Hypothetical protein YTMB; mostly beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Bacillus subtilis} SCOP: b.122.1.13 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 79 | |||
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.03 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 97.14 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 97.11 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 97.02 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.86 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 96.77 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 96.71 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.66 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.65 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.6 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 96.49 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 96.46 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 96.45 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.39 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 96.35 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.24 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 96.21 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.1 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.1 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 95.84 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 95.72 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 95.7 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 94.94 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 94.31 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.13 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 94.11 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.01 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 93.6 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 93.29 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 92.16 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 92.15 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 91.8 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 89.04 | |
| d2nwaa1 | 80 | Hypothetical protein YtmB {Bacillus subtilis [TaxI | 88.46 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 87.7 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 87.3 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 86.32 | |
| d1g2914 | 71 | Maltose transport protein MalK, C-terminal domain | 84.06 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 82.84 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 82.07 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 80.98 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 80.08 |
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Arp2/3 complex 41 kDa subunit ARPC1 species: Cow (Bos taurus) [TaxId: 9913]
Probab=98.03 E-value=1.3e-05 Score=54.14 Aligned_cols=73 Identities=11% Similarity=0.062 Sum_probs=53.9
Q ss_pred CeeeccCCCCEEEEEcCCc-eEEEecCCcchhhe--eeeccCCCeEEEEEecccceEEEeccCCCcEEEEEeCCCCeEE
Q psy6185 1 MCSVPLKGLLSLSVGTKSG-YRLFSLNSIDTLEQ--IYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEE 76 (79)
Q Consensus 1 ~~~~fNQD~sc~~vgt~~G-frIyn~~~~d~~~~--~~~~~~g~v~ivEmLf~snLlalVg~~~prkL~I~d~~~~~~I 76 (79)
.|++||+|++.+++|..+| .+||+.+. ..+.. .++...++|.-++.--..++||..| ..+.++|||.+.+...
T Consensus 11 t~~~~s~dg~~la~~~~~~~i~iw~~~~-~~~~~~~~l~gH~~~V~~l~fsp~~~~l~s~s--~D~~i~vWd~~~~~~~ 86 (371)
T d1k8kc_ 11 SCHAWNKDRTQIAICPNNHEVHIYEKSG-NKWVQVHELKEHNGQVTGVDWAPDSNRIVTCG--TDRNAYVWTLKGRTWK 86 (371)
T ss_dssp CEEEECTTSSEEEEECSSSEEEEEEEET-TEEEEEEEEECCSSCEEEEEEETTTTEEEEEE--TTSCEEEEEEETTEEE
T ss_pred EEEEECCCCCEEEEEeCCCEEEEEECCC-CCEEEEEEecCCCCCEEEEEECCCCCEEEEEE--CCCeEEEEeecccccc
Confidence 3899999999999999998 79998643 22222 3344567888777666789987765 3478999998766543
|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2nwaa1 b.122.1.13 (A:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|