Psyllid ID: psy6185

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEEKKI
ccccccccccEEEEEccccEEEEEEccccccEEEEEcccccEEEEEEEcccEEEEEEEcccccEEEEEEEccccccccc
cccccccccEEEEEEccccEEEEEcccHHHHHHHHccccccEEEEEHHccccEEEEEEcccccccEEEEcccccHcccc
mcsvplkgllslsvgtksgyrlfslnSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSlssprkltkeegkneeeekki
mcsvplkgLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVavvslssprkltkeegkneeeekki
MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERlfssslvavvslssPRKLTkeegkneeeekkI
******KGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVS*********************
MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTK************
MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLS*******************
*CSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNE******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEEKKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
Q9Y4P8 454 WD repeat domain phosphoi yes N/A 0.721 0.125 0.724 1e-16
Q6AY57 445 WD repeat domain phosphoi yes N/A 0.696 0.123 0.75 1e-16
Q5ZHN3 436 WD repeat domain phosphoi yes N/A 0.696 0.126 0.75 1e-16
Q80W47 445 WD repeat domain phosphoi yes N/A 0.696 0.123 0.75 1e-16
Q7ZWU5 435 WD repeat domain phosphoi N/A N/A 0.696 0.126 0.75 2e-16
Q8R3E3 446 WD repeat domain phosphoi no N/A 0.696 0.123 0.589 6e-07
Q5MNZ9 446 WD repeat domain phosphoi no N/A 0.696 0.123 0.589 1e-06
Q1DKJ3 417 Autophagy-related protein N/A N/A 0.620 0.117 0.444 0.0001
Q6DCN1 433 WD repeat domain phosphoi N/A N/A 0.696 0.127 0.5 0.0001
A7EW77 423 Autophagy-related protein N/A N/A 0.696 0.130 0.383 0.0004
>sp|Q9Y4P8|WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens GN=WIPI2 PE=1 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 1/58 (1%)

Query: 9  LLSLSVGTKSGYRLFSLNSIDTLEQIYE-NSQEDVCIVERLFSSSLVAVVSLSSPRKL 65
          + SL+VG+KSGY+ FSL+S+D LEQIYE    EDVCIVERLFSSSLVA+VSL +PRKL
Sbjct: 42 VWSLAVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKL 99
Probable early component of the autophagy machinery being involved in formation of preautophagosomal structures and their maturation into mature phagosomes in response to PtdIns3P. May bind PtdIns3P.
Homo sapiens (taxid: 9606)
>sp|Q6AY57|WIPI2_RAT WD repeat domain phosphoinositide-interacting protein 2 OS=Rattus norvegicus GN=Wipi2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZHN3|WIPI2_CHICK WD repeat domain phosphoinositide-interacting protein 2 OS=Gallus gallus GN=WIPI2 PE=2 SV=1 Back     alignment and function description
>sp|Q80W47|WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus GN=Wipi2 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZWU5|WIPI2_XENLA WD repeat domain phosphoinositide-interacting protein 2 OS=Xenopus laevis GN=wipi2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R3E3|WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus GN=Wipi1 PE=1 SV=1 Back     alignment and function description
>sp|Q5MNZ9|WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens GN=WIPI1 PE=1 SV=3 Back     alignment and function description
>sp|Q1DKJ3|ATG18_COCIM Autophagy-related protein 18 OS=Coccidioides immitis (strain RS) GN=ATG18 PE=3 SV=1 Back     alignment and function description
>sp|Q6DCN1|WIPI1_XENLA WD repeat domain phosphoinositide-interacting protein 1 OS=Xenopus laevis GN=wipi1 PE=2 SV=1 Back     alignment and function description
>sp|A7EW77|ATG18_SCLS1 Autophagy-related protein 18 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg18 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
242005831 441 WD repeat domain phosphoinositide-intera 0.696 0.124 0.818 3e-18
383861761 472 PREDICTED: WD repeat domain phosphoinosi 0.696 0.116 0.836 4e-18
193613342 422 PREDICTED: WD repeat domain phosphoinosi 0.696 0.130 0.818 5e-18
405974503 438 WD repeat domain phosphoinositide-intera 0.696 0.125 0.781 1e-17
72014139 486 PREDICTED: WD repeat domain phosphoinosi 0.696 0.113 0.781 1e-16
443695598 465 hypothetical protein CAPTEDRAFT_169421 [ 0.696 0.118 0.763 4e-16
307211145 378 WD repeat domain phosphoinositide-intera 0.708 0.148 0.767 4e-16
432870745 425 PREDICTED: LOW QUALITY PROTEIN: WD repea 0.696 0.129 0.767 1e-15
344289650 425 PREDICTED: WD repeat domain phosphoinosi 0.696 0.129 0.767 1e-15
344289648 436 PREDICTED: WD repeat domain phosphoinosi 0.696 0.126 0.767 1e-15
>gi|242005831|ref|XP_002423764.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] gi|212506966|gb|EEB11026.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 52/55 (94%)

Query: 11  SLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKL 65
           SL+VGTK+GY+LFSL+S+D LEQIYEN  ED+CIVERLFSSSLVA+VSLSSPRKL
Sbjct: 47  SLTVGTKTGYKLFSLHSVDLLEQIYENEAEDICIVERLFSSSLVAIVSLSSPRKL 101

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383861761|ref|XP_003706353.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193613342|ref|XP_001951577.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|405974503|gb|EKC39143.1| WD repeat domain phosphoinositide-interacting protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|72014139|ref|XP_781358.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|443695598|gb|ELT96465.1| hypothetical protein CAPTEDRAFT_169421 [Capitella teleta] Back     alignment and taxonomy information
>gi|307211145|gb|EFN87363.1| WD repeat domain phosphoinositide-interacting protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|432870745|ref|XP_004071827.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat domain phosphoinositide-interacting protein 2-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|344289650|ref|XP_003416555.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2 isoform 2 [Loxodonta africana] Back     alignment and taxonomy information
>gi|344289648|ref|XP_003416554.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 2 isoform 1 [Loxodonta africana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
ZFIN|ZDB-GENE-040718-488 431 wipi2 "WD repeat domain, phosp 0.696 0.127 0.571 6.4e-10
UNIPROTKB|Q7ZWU5 435 wipi2 "WD repeat domain phosph 0.696 0.126 0.553 1.8e-09
UNIPROTKB|Q5ZHN3 436 WIPI2 "WD repeat domain phosph 0.696 0.126 0.553 1.8e-09
UNIPROTKB|Q2KJ60 436 WIPI2 "Uncharacterized protein 0.696 0.126 0.553 1.8e-09
UNIPROTKB|D7RA31 436 WIPI2 "Uncharacterized protein 0.696 0.126 0.553 1.8e-09
MGI|MGI:1923831 445 Wipi2 "WD repeat domain, phosp 0.696 0.123 0.553 1.8e-09
RGD|1359154 445 Wipi2 "WD repeat domain, phosp 0.696 0.123 0.553 1.8e-09
UNIPROTKB|Q9Y4P8 454 WIPI2 "WD repeat domain phosph 0.696 0.121 0.553 1.9e-09
UNIPROTKB|D7RA30 446 WIPI1 "WD repeat domain phosph 0.696 0.123 0.410 8.8e-06
MGI|MGI:1261864 446 Wipi1 "WD repeat domain, phosp 0.696 0.123 0.410 8.8e-06
ZFIN|ZDB-GENE-040718-488 wipi2 "WD repeat domain, phosphoinositide interacting 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 150 (57.9 bits), Expect = 6.4e-10, P = 6.4e-10
 Identities = 32/56 (57%), Positives = 36/56 (64%)

Query:    11 SLSVGTKSGYRLFSLNSIDTLEQIYE-NSQEDVCIVERXXXXXXXXXXXXXXPRKL 65
             SL+VGTKSGY+ FSL+S+D LEQIYE    EDVCIVER              PRKL
Sbjct:    26 SLAVGTKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKL 81
GO:0032266 "phosphatidylinositol-3-phosphate binding" evidence=IBA
GO:0080025 "phosphatidylinositol-3,5-bisphosphate binding" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
GO:0034045 "pre-autophagosomal structure membrane" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
GO:0000421 "autophagic vacuole membrane" evidence=IBA
GO:0000045 "autophagic vacuole assembly" evidence=IBA
UNIPROTKB|Q7ZWU5 wipi2 "WD repeat domain phosphoinositide-interacting protein 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHN3 WIPI2 "WD repeat domain phosphoinositide-interacting protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ60 WIPI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D7RA31 WIPI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1923831 Wipi2 "WD repeat domain, phosphoinositide interacting 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359154 Wipi2 "WD repeat domain, phosphoinositide interacting 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4P8 WIPI2 "WD repeat domain phosphoinositide-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D7RA30 WIPI1 "WD repeat domain phosphoinositide-interacting 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1261864 Wipi1 "WD repeat domain, phosphoinositide interacting 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4P8WIPI2_HUMANNo assigned EC number0.72410.72150.1255yesN/A
Q5ZHN3WIPI2_CHICKNo assigned EC number0.750.69620.1261yesN/A
Q6AY57WIPI2_RATNo assigned EC number0.750.69620.1235yesN/A
Q80W47WIPI2_MOUSENo assigned EC number0.750.69620.1235yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
KOG2111|consensus 346 99.96
KOG2110|consensus 391 99.9
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 96.51
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.24
PTZ00421 493 coronin; Provisional 96.16
KOG2048|consensus 691 96.15
KOG0305|consensus484 96.07
PTZ00420 568 coronin; Provisional 96.0
PTZ00421 493 coronin; Provisional 95.58
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 95.38
KOG0271|consensus480 95.31
KOG0273|consensus 524 95.17
KOG1407|consensus 313 95.03
KOG2111|consensus346 94.99
KOG0316|consensus 307 94.97
KOG0265|consensus 338 94.56
KOG0265|consensus 338 94.25
KOG0266|consensus 456 94.18
KOG0276|consensus 794 94.12
KOG2919|consensus 406 94.07
KOG1963|consensus 792 93.63
KOG0973|consensus 942 93.56
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 93.48
KOG0318|consensus 603 93.12
PTZ00420 568 coronin; Provisional 92.56
KOG0278|consensus 334 92.48
KOG0640|consensus 430 92.15
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.1
KOG0302|consensus440 90.25
KOG0282|consensus 503 90.22
KOG1273|consensus 405 90.05
KOG1274|consensus 933 89.39
KOG0647|consensus 347 88.47
KOG0266|consensus456 88.35
PLN00181793 protein SPA1-RELATED; Provisional 88.29
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 87.81
KOG2321|consensus 703 87.66
KOG1036|consensus 323 87.4
PLN00181 793 protein SPA1-RELATED; Provisional 87.27
KOG0272|consensus459 86.68
KOG0271|consensus 480 86.56
KOG0274|consensus537 86.35
KOG0274|consensus 537 86.24
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 86.1
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 85.85
smart0032040 WD40 WD40 repeats. Note that these repeats are per 85.76
KOG0306|consensus 888 85.75
KOG0284|consensus 464 85.35
KOG0771|consensus 398 85.35
PF1076380 DUF2584: Protein of unknown function (DUF2584); In 85.23
KOG0306|consensus 888 83.08
KOG0291|consensus 893 82.75
KOG0303|consensus 472 82.53
KOG0640|consensus 430 82.42
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 81.74
KOG0279|consensus 315 81.31
KOG0319|consensus 775 81.16
smart00036 302 CNH Domain found in NIK1-like kinases, mouse citro 80.95
KOG0264|consensus422 80.51
KOG0310|consensus 487 80.46
KOG0289|consensus506 80.13
>KOG2111|consensus Back     alignment and domain information 
Probab=99.96  E-value=4.1e-30  Score=191.71  Aligned_cols=75  Identities=20%  Similarity=0.262  Sum_probs=66.7

Q ss_pred             eeeccCCCCEEEEEcCCceEEEecCCcchhheeeec--cCCCeEEEEEecccceEEEecc-----CCCcEEEEEeCCCCe
Q psy6185           2 CSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYEN--SQEDVCIVERLFSSSLVAVVSL-----SSPRKLTKEEGKNEE   74 (79)
Q Consensus         2 ~~~fNQD~sc~~vgt~~GfrIyn~~~~d~~~~~~~~--~~g~v~ivEmLf~snLlalVg~-----~~prkL~I~d~~~~~   74 (79)
                      .++||||+|||+|||++|||||||+|   +++..++  ..+|+++||||||||++|+|||     ++||||+||||.+++
T Consensus        10 svs~NQD~ScFava~~~Gfriyn~~P---~ke~~~r~~~~~G~~~veMLfR~N~laLVGGg~~pky~pNkviIWDD~k~~   86 (346)
T KOG2111|consen   10 SVSFNQDHSCFAVATDTGFRIYNCDP---FKESASRQFIDGGFKIVEMLFRSNYLALVGGGSRPKYPPNKVIIWDDLKER   86 (346)
T ss_pred             EEEEccCCceEEEEecCceEEEecCc---hhhhhhhccccCchhhhhHhhhhceEEEecCCCCCCCCCceEEEEecccCc
Confidence            47999999999999999999999655   6665544  4677999999999999999998     899999999999999


Q ss_pred             EEeeC
Q psy6185          75 EEKKI   79 (79)
Q Consensus        75 ~I~~~   79 (79)
                      +|.|+
T Consensus        87 ~i~el   91 (346)
T KOG2111|consen   87 CIIEL   91 (346)
T ss_pred             EEEEE
Confidence            99874

>KOG2110|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF10763 DUF2584: Protein of unknown function (DUF2584); InterPro: IPR019699 This entry is represented by Bacteriophage 0305phi8-36, Orf221 Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 2e-09
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
 Score = 50.8 bits (121), Expect = 2e-09
 Identities = 8/55 (14%), Positives = 20/55 (36%), Gaps = 4/55 (7%)

Query: 11 SLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKL 65
           L + T   + ++++     +  I       +  V  L  ++ VA V+      +
Sbjct: 33 CLILSTLKSFEIYNV---HPVAHIMSQEMRHLSKVRMLHRTNYVAFVT-GVKEVV 83

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.33
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.52
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 97.46
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.35
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.35
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.31
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 97.31
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.25
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.24
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.16
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.13
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.12
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.12
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.11
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 97.09
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.08
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.07
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.07
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.02
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.01
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 96.97
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 96.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.93
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 96.91
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.87
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 96.86
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 96.85
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 96.82
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.75
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.74
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 96.69
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.69
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 96.65
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.65
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.65
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.61
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.61
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 96.59
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.57
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.54
2pm7_B 297 Protein transport protein SEC13, protein transport 96.54
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.52
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 96.46
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.45
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.43
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.42
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.41
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.39
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.39
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.38
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.36
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.36
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 96.3
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.18
3jro_A 753 Fusion protein of protein transport protein SEC13 96.17
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.16
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.16
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 96.14
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.14
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 96.13
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.13
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.1
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 96.08
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 95.97
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.87
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.87
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.84
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.82
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.73
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 95.73
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.72
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 95.72
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 95.67
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.59
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 95.51
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.5
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 95.5
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.48
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.47
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 95.39
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.37
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.33
3jrp_A 379 Fusion protein of protein transport protein SEC13 95.33
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.33
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.31
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.31
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.24
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.21
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.09
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 95.01
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 94.98
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 94.98
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.78
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 94.72
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 94.67
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.34
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 94.16
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.15
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.13
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.08
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.04
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.93
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.86
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 93.84
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 93.82
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.74
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.59
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 92.99
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.74
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 92.57
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 92.56
3jro_A 753 Fusion protein of protein transport protein SEC13 92.49
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 92.46
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.45
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 92.42
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.35
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 92.31
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 92.27
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 92.21
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.23
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 91.03
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 90.85
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 90.72
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 90.53
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 89.87
2pm7_B 297 Protein transport protein SEC13, protein transport 89.8
2nwa_A88 Hypothetical protein YTMB; mostly beta protein, st 89.6
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.21
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 89.17
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 88.68
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 88.4
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 86.99
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 86.32
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 83.19
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 82.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 80.97
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 80.15
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.02
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
Probab=99.33  E-value=6.6e-12  Score=88.73  Aligned_cols=74  Identities=11%  Similarity=0.137  Sum_probs=63.2

Q ss_pred             CeeeccCCCCEEEEEcCCceEEEecCCcchhheeeeccCCCeEEEEEecccceEEEeccCCCcEEEEEeCCCCeEEee
Q psy6185           1 MCSVPLKGLLSLSVGTKSGYRLFSLNSIDTLEQIYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEEKK   78 (79)
Q Consensus         1 ~~~~fNQD~sc~~vgt~~GfrIyn~~~~d~~~~~~~~~~g~v~ivEmLf~snLlalVg~~~prkL~I~d~~~~~~I~~   78 (79)
                      .|++||+|++.+++|.++|++||++++   .+..+..+.+++.+++++++++++|++|+.+ ++++|||.++++.+.+
T Consensus        23 ~~v~fs~dg~~la~g~~~~~~iw~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-~~v~iWd~~~~~~~~~   96 (355)
T 3vu4_A           23 TDYEFNQDQSCLILSTLKSFEIYNVHP---VAHIMSQEMRHLSKVRMLHRTNYVAFVTGVK-EVVHIWDDVKKQDVSR   96 (355)
T ss_dssp             CEEEECTTSSEEEEECSSEEEEEEETT---EEEEEEEECSCCCEEEECTTSSEEEEECSST-TEEEEEETTTTEEEEE
T ss_pred             EEEEECCCCCEEEEEcCCEEEEEecCC---cceeeeeecCCeEEEEEcCCCCEEEEEECCc-cEEEEEECCCCcEEEE
Confidence            489999999999999999999999654   4555555556899999999999999999654 7999999999988765
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2nwa_A Hypothetical protein YTMB; mostly beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Bacillus subtilis} SCOP: b.122.1.13 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.03
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.14
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.11
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.02
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.86
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.77
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.71
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.66
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.65
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.6
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.49
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.46
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 96.45
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.39
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.35
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.24
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 96.21
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.1
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.1
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.72
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.7
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 94.31
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.13
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.11
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.01
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 93.6
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.29
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.16
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.15
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.8
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.04
d2nwaa180 Hypothetical protein YtmB {Bacillus subtilis [TaxI 88.46
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 87.7
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 87.3
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 86.32
d1g291471 Maltose transport protein MalK, C-terminal domain 84.06
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 82.84
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 82.07
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 80.98
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 80.08
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Arp2/3 complex 41 kDa subunit ARPC1
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.03  E-value=1.3e-05  Score=54.14  Aligned_cols=73  Identities=11%  Similarity=0.062  Sum_probs=53.9

Q ss_pred             CeeeccCCCCEEEEEcCCc-eEEEecCCcchhhe--eeeccCCCeEEEEEecccceEEEeccCCCcEEEEEeCCCCeEE
Q psy6185           1 MCSVPLKGLLSLSVGTKSG-YRLFSLNSIDTLEQ--IYENSQEDVCIVERLFSSSLVAVVSLSSPRKLTKEEGKNEEEE   76 (79)
Q Consensus         1 ~~~~fNQD~sc~~vgt~~G-frIyn~~~~d~~~~--~~~~~~g~v~ivEmLf~snLlalVg~~~prkL~I~d~~~~~~I   76 (79)
                      .|++||+|++.+++|..+| .+||+.+. ..+..  .++...++|.-++.--..++||..|  ..+.++|||.+.+...
T Consensus        11 t~~~~s~dg~~la~~~~~~~i~iw~~~~-~~~~~~~~l~gH~~~V~~l~fsp~~~~l~s~s--~D~~i~vWd~~~~~~~   86 (371)
T d1k8kc_          11 SCHAWNKDRTQIAICPNNHEVHIYEKSG-NKWVQVHELKEHNGQVTGVDWAPDSNRIVTCG--TDRNAYVWTLKGRTWK   86 (371)
T ss_dssp             CEEEECTTSSEEEEECSSSEEEEEEEET-TEEEEEEEEECCSSCEEEEEEETTTTEEEEEE--TTSCEEEEEEETTEEE
T ss_pred             EEEEECCCCCEEEEEeCCCEEEEEECCC-CCEEEEEEecCCCCCEEEEEECCCCCEEEEEE--CCCeEEEEeecccccc
Confidence            3899999999999999998 79998643 22222  3344567888777666789987765  3478999998766543
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2nwaa1 b.122.1.13 (A:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure