Psyllid ID: psy621


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTAQY
ccccccHHHHHHHHHHHHHHHcccccccEEEEcccccccEEEEEEEccccccccccEEEEEEEccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccEEEcccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEcccEEEEccEEHHccccHHHHccccEEEEEEEcEEccccccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEccccccccccccccc
ccccccHHHHHHHHHHHHHHHccccccEEEcccccccEEEEEEEEEccccccccccEEEEEEEcccccccccEEEEEccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHcccccccccEEEEcHHHHHHHHHHHHHccccccccccccEcccccccEEEEEEEEEEEccccccEccEEEEEEEccccccccccEEEEccccccccEccccccc
MAQVPTSSALRALSMEYKslqeepvegfrvklvnddnlfewevaifgppdtlyqggyFKAIIegelphwdvnVQNQIENLTKTfeassfisaplyteSWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDlwlfkpnpfsldikfnddgtKIIASRFMIQAVNITDGNMEKEMVKELRRIAHEsslnvsvfhpyfvffdqfelvrpttiqsmlggSVTMMFIRFRVKlvnddnlfewevaifgppdtlyqggyfkahmkfpidypyspptirfltkvwhpnvyegtaqy
maqvptssalRALSMEYKslqeepveGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTAQY
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTAQY
************************VEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYE*****
***************EYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVR********TIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNI******************ESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEG****
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTAQY
*******SALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTAQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q29503 238 Ubiquitin-conjugating enz no N/A 0.211 0.256 0.770 1e-25
Q6ZWZ2 238 Ubiquitin-conjugating enz yes N/A 0.211 0.256 0.770 1e-25
Q712K3 238 Ubiquitin-conjugating enz yes N/A 0.211 0.256 0.770 1e-25
P49427 236 Ubiquitin-conjugating enz no N/A 0.211 0.258 0.737 3e-23
Q8CFI2 235 Ubiquitin-conjugating enz no N/A 0.211 0.259 0.737 3e-23
P25868168 Ubiquitin-conjugating enz N/A N/A 0.207 0.357 0.616 6e-18
P62255170 Ubiquitin-conjugating enz no N/A 0.204 0.347 0.593 6e-18
P62254170 Ubiquitin-conjugating enz no N/A 0.204 0.347 0.593 6e-18
P62253170 Ubiquitin-conjugating enz no N/A 0.204 0.347 0.593 6e-18
Q4R5Y8170 Ubiquitin-conjugating enz N/A N/A 0.204 0.347 0.593 6e-18
>sp|Q29503|UB2R2_RABIT Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 57/61 (93%)

Query: 224 FRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVY 283
           FR+ LV++ +L+ WEVAIFGPP+TLY+GGYFKAH+KFPIDYPYSPPT RFLTK+WHPN+Y
Sbjct: 28  FRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIY 87

Query: 284 E 284
           E
Sbjct: 88  E 88




Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. May be involved in degradation of katenin.
Oryctolagus cuniculus (taxid: 9986)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q6ZWZ2|UB2R2_MOUSE Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=2 SV=1 Back     alignment and function description
>sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1 Back     alignment and function description
>sp|P49427|UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2 Back     alignment and function description
>sp|Q8CFI2|UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1 Back     alignment and function description
>sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1 Back     alignment and function description
>sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 Back     alignment and function description
>sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
328720305 1024 PREDICTED: patched domain-containing pro 0.574 0.162 0.807 3e-74
242022973 1087 conserved hypothetical protein [Pediculu 0.546 0.145 0.715 3e-61
312373383 766 hypothetical protein AND_17500 [Anophele 0.678 0.255 0.564 6e-57
157117285 1160 hypothetical protein AaeL_AAEL001299 [Ae 0.574 0.143 0.632 1e-55
158289940 981 AGAP010394-PA [Anopheles gambiae str. PE 0.574 0.169 0.608 1e-55
170070021 874 conserved hypothetical protein [Culex qu 0.574 0.189 0.614 9e-55
332022011 1069 Patched domain-containing protein 3 [Acr 0.574 0.155 0.596 9e-53
189240857 1093 PREDICTED: similar to Ptc-related CG1121 0.685 0.181 0.531 1e-52
195023480 1276 GH20944 [Drosophila grimshawi] gi|193901 0.678 0.153 0.529 4e-52
195580910 1061 GD10331 [Drosophila simulans] gi|1941922 0.667 0.181 0.525 1e-51
>gi|328720305|ref|XP_001943131.2| PREDICTED: patched domain-containing protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 134/166 (80%), Positives = 152/166 (91%)

Query: 59  KAIIEGELPHWDVNVQNQIENLTKTFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTI 118
           + II GEL +WDV+VQN+IENLTK FE S+FIS+PLYTESW+RSFV+YV RNQ+ LNVTI
Sbjct: 558 QVIIAGELDYWDVDVQNEIENLTKAFENSTFISSPLYTESWVRSFVNYVNRNQEELNVTI 617

Query: 119 DTREGFLKTLNDLWLFKPNPFSLDIKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELR 178
           DTRE FL+TLNDLWLFKPNPFSLD+KFNDDGTKI+ASRFMIQAVNI+DGNMEK+MV+ELR
Sbjct: 618 DTRETFLQTLNDLWLFKPNPFSLDVKFNDDGTKIVASRFMIQAVNISDGNMEKDMVRELR 677

Query: 179 RIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRF 224
           +IAHES LNVSVFHPYFVFFDQFELVRPT+IQSM+ G  TMM I F
Sbjct: 678 KIAHESPLNVSVFHPYFVFFDQFELVRPTSIQSMVVGGATMMLISF 723




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242022973|ref|XP_002431911.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517255|gb|EEB19173.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312373383|gb|EFR21138.1| hypothetical protein AND_17500 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157117285|ref|XP_001653012.1| hypothetical protein AaeL_AAEL001299 [Aedes aegypti] gi|108883354|gb|EAT47579.1| AAEL001299-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158289940|ref|XP_311553.4| AGAP010394-PA [Anopheles gambiae str. PEST] gi|157018400|gb|EAA07199.5| AGAP010394-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170070021|ref|XP_001869437.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167865886|gb|EDS29269.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|332022011|gb|EGI62337.1| Patched domain-containing protein 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189240857|ref|XP_969210.2| PREDICTED: similar to Ptc-related CG11212-PA [Tribolium castaneum] gi|270013723|gb|EFA10171.1| hypothetical protein TcasGA2_TC012361 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195023480|ref|XP_001985702.1| GH20944 [Drosophila grimshawi] gi|193901702|gb|EDW00569.1| GH20944 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195580910|ref|XP_002080277.1| GD10331 [Drosophila simulans] gi|194192286|gb|EDX05862.1| GD10331 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
FB|FBgn0262867 1169 Ptr "Patched-related" [Drosoph 0.678 0.167 0.524 6.8e-50
FB|FBgn0036516 341 CG7656 [Drosophila melanogaste 0.211 0.178 0.950 1.8e-30
UNIPROTKB|F1NV52 237 UBE2R2 "Uncharacterized protei 0.211 0.257 0.770 6.6e-26
UNIPROTKB|J9P7F2 238 UBE2R2 "Uncharacterized protei 0.211 0.256 0.770 6.6e-26
UNIPROTKB|Q712K3 238 UBE2R2 "Ubiquitin-conjugating 0.211 0.256 0.770 6.6e-26
UNIPROTKB|Q29503 238 UBE2R2 "Ubiquitin-conjugating 0.211 0.256 0.770 6.6e-26
MGI|MGI:1914865 238 Ube2r2 "ubiquitin-conjugating 0.211 0.256 0.770 6.6e-26
UNIPROTKB|E1BAB9 225 UBE2R2 "Uncharacterized protei 0.211 0.271 0.770 6.6e-26
ZFIN|ZDB-GENE-040718-344 250 ube2r2 "ubiquitin-conjugating 0.211 0.244 0.770 8.4e-26
UNIPROTKB|F1N4D3 237 CDC34 "Uncharacterized protein 0.211 0.257 0.737 4.2e-24
FB|FBgn0262867 Ptr "Patched-related" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 530 (191.6 bits), Expect = 6.8e-50, P = 6.8e-50
 Identities = 106/202 (52%), Positives = 144/202 (71%)

Query:    26 EGF-RVKLVNDDNLFEWEVAIFGPPDTLYQGGYFK--AIIEGELPHWDVNVQNQIENLTK 82
             EG  R KL  +D+   + V  F   D  Y+   ++   II G L + D  VQ Q+ENLT 
Sbjct:   524 EGLERRKLSREDS---YSVEFFDREDDYYREFPYRMQVIIAGPLNYSDPLVQEQVENLTS 580

Query:    83 TFEASSFISAPLYTESWLRSFVSYVRRNQDFLNVTIDTREGFLKTLNDLWLFKPNPFSLD 142
             T E +S++++  YTESWLRSF+S++ RN + LNVT+D  + F+  + + WLF  NPFSLD
Sbjct:   581 TLEHTSYVTSRRYTESWLRSFLSFLERNNELLNVTVDDEQTFIDAVKEHWLFPGNPFSLD 640

Query:   143 IKFNDDGTKIIASRFMIQAVNITDGNMEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFE 202
             ++FN+D T+IIASRF+IQAVNITD N EKEMV++LR+I  +S LN S+FHPYFVFFDQFE
Sbjct:   641 VRFNEDETQIIASRFLIQAVNITDTNHEKEMVRDLRQICKDSPLNASIFHPYFVFFDQFE 700

Query:   203 LVRPTTIQSMLGGSVTMMFIRF 224
             LVRP ++Q+M+ G++ MM I F
Sbjct:   701 LVRPVSLQAMVIGAIIMMIISF 722




GO:0005886 "plasma membrane" evidence=ISS
GO:0004872 "receptor activity" evidence=NAS
GO:0010004 "gastrulation involving germ band extension" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0016328 "lateral plasma membrane" evidence=IDA
GO:0016021 "integral to membrane" evidence=IEA
GO:0008158 "hedgehog receptor activity" evidence=IEA
FB|FBgn0036516 CG7656 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV52 UBE2R2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7F2 UBE2R2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q712K3 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29503 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1914865 Ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAB9 UBE2R2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-344 ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4D3 CDC34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 1e-28
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 2e-28
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-27
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 7e-26
pfam02460801 pfam02460, Patched, Patched family 3e-17
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 3e-15
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 2e-14
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 3e-14
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 8e-14
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 5e-12
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 2e-10
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
 Score =  106 bits (267), Expect = 1e-28
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 224 FRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVY 283
                V DDNLFEWEV I GP  T Y+GG FK  ++FP DYP+ PP ++F TK++HPNV 
Sbjct: 17  ISAFPV-DDNLFEWEVTIIGPEGTPYEGGVFKLDIEFPEDYPFKPPKVKFTTKIYHPNVD 75

Query: 284 E 284
            
Sbjct: 76  P 76


Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139

>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|217050 pfam02460, Patched, Patched family Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.94
KOG0417|consensus148 99.94
KOG0417|consensus148 99.93
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.92
KOG0419|consensus152 99.91
KOG0426|consensus165 99.91
KOG0419|consensus152 99.9
KOG1934|consensus 868 99.9
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.89
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.89
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.89
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.88
KOG0425|consensus171 99.88
KOG0421|consensus175 99.85
KOG0425|consensus171 99.85
KOG0418|consensus 200 99.85
KOG0426|consensus165 99.84
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.84
KOG0421|consensus175 99.82
PF02460798 Patched: Patched family; InterPro: IPR003392 The t 99.81
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.81
KOG0418|consensus200 99.8
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.8
KOG0424|consensus158 99.79
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.78
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.77
KOG0427|consensus161 99.76
KOG0424|consensus158 99.76
KOG0894|consensus244 99.75
TIGR009171204 2A060601 Niemann-Pick C type protein family. The m 99.75
KOG0422|consensus153 99.72
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.71
KOG0416|consensus 189 99.7
KOG0422|consensus153 99.68
KOG0894|consensus 244 99.68
KOG0423|consensus 223 99.65
KOG0416|consensus189 99.61
KOG0428|consensus314 99.55
KOG0420|consensus184 99.55
KOG0420|consensus184 99.53
KOG0423|consensus223 99.52
KOG0427|consensus161 99.51
TIGR009181145 2A060602 The Eukaryotic (Putative) Sterol Transpor 99.48
KOG0428|consensus 314 99.4
KOG0896|consensus138 98.97
KOG0429|consensus 258 98.93
KOG0895|consensus 1101 98.85
KOG1933|consensus1201 98.81
KOG0895|consensus 1101 98.65
KOG0896|consensus138 98.24
KOG0429|consensus258 97.52
KOG1935|consensus 1143 94.19
PF14461133 Prok-E2_B: Prokaryotic E2 family B 93.37
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 92.67
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 92.65
smart00591107 RWD domain in RING finger and WD repeat containing 89.64
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.94  E-value=4.6e-27  Score=186.58  Aligned_cols=126  Identities=31%  Similarity=0.546  Sum_probs=108.1

Q ss_pred             ChHHHHHHHHHHHHhhhCCCCCeEEEecCCCCceEEEEEEeCCCCCCccCcEEEEEE--cCCCCCCCcccceeccccccc
Q psy621            6 TSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAII--EGELPHWDVNVQNQIENLTKT   83 (289)
Q Consensus         6 ~~~~~~Rl~kE~~~l~~~~~~g~~~~~~~~~n~~~w~~~i~gp~~t~y~g~~~~v~v--~~~yp~~~P~v~~~~~~~~~~   83 (289)
                      +..|.+||+||+++|++++++|+++.+.+++|+++|++.|.||+||+|+||.|++.+  +++||++||+++|.++++|||
T Consensus         3 s~~a~~RL~kE~~~l~~~~~~~~~a~p~~d~~l~~w~~~i~GP~dtpYegg~f~~~l~fP~~YP~~PPkv~F~t~i~HPN   82 (153)
T COG5078           3 SPSALKRLLKELKKLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKLTLEFPEDYPFKPPKVRFTTKIFHPN   82 (153)
T ss_pred             chhHHHHHHHHHHHHhcCCCCceEEEECCCCcceeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCeeeeccCCcCCC
Confidence            445999999999999999999999998777799999999999999999999987665  899999999999999999999


Q ss_pred             eeccceeeCccccCccchHH---------HHHhhh-c-ccccccCC-----CchhhHHHHhHHh
Q psy621           84 FEASSFISAPLYTESWLRSF---------VSYVRR-N-QDFLNVTI-----DTREGFLKTLNDL  131 (289)
Q Consensus        84 ~e~~~~~~~~~~~~~Wl~~y---------~~~l~~-~-~~~~n~~~-----~~~~~F~~~l~~~  131 (289)
                      +..+|.+|++++.+.|.|.|         +++|.. + ++++|.++     .++++|.+.++++
T Consensus        83 V~~~G~vCLdIL~~~WsP~~~l~sILlsl~slL~~PN~~~Pln~daa~~~~~d~~~y~~~vr~~  146 (153)
T COG5078          83 VDPSGNVCLDILKDRWSPVYTLETILLSLQSLLLSPNPDSPLNTEAATLYREDKEEYEKKVREW  146 (153)
T ss_pred             cCCCCCChhHHHhCCCCccccHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhCHHHHHHHHHHH
Confidence            99999999999999999986         344432 2 34555443     5777788777774



>KOG0417|consensus Back     alignment and domain information
>KOG0417|consensus Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>KOG1934|consensus Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>PF02460 Patched: Patched family; InterPro: IPR003392 The transmembrane protein, patched, is a receptor for the morphogene Sonic Hedgehog Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>TIGR00917 2A060601 Niemann-Pick C type protein family Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>TIGR00918 2A060602 The Eukaryotic (Putative) Sterol Transporter (EST) Family Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG1933|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG1935|consensus Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 3e-24
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 3e-24
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 7e-19
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 2e-17
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 3e-13
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 3e-13
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 3e-13
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 3e-13
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 5e-13
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 5e-13
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 5e-13
2pwq_A 216 Crystal Structure Of A Putative Ubiquitin Conjugati 5e-13
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 5e-13
3e46_A 253 Crystal Structure Of Ubiquitin-Conjugating Enzyme E 6e-13
3k9p_A 217 The Crystal Structure Of E2-25k And Ubiquitin Compl 6e-13
1yla_A 202 Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington 7e-13
3k9o_A 201 The Crystal Structure Of E2-25k And Ubb+1 Complex L 8e-13
2bep_A159 Crystal Structure Of Ubiquitin Conjugating Enzyme E 1e-12
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 6e-12
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 8e-12
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 9e-12
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 1e-11
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 1e-11
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 3e-11
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 3e-11
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 4e-11
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 4e-11
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 5e-11
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 5e-11
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 5e-11
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 5e-11
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 5e-11
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 5e-11
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 5e-11
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 5e-11
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 5e-11
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 5e-11
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 6e-11
3jvz_A146 E2~ubiquitin-Hect Length = 146 6e-11
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 6e-11
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 6e-11
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 6e-11
1x23_A155 Crystal Structure Of Ubch5c Length = 155 6e-11
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 6e-11
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 7e-11
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 8e-11
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-10
1jas_A152 Hsubc2b Length = 152 2e-10
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 4e-10
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 7e-10
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 1e-09
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-09
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 6e-09
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 9e-09
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 1e-08
1tte_A 215 The Structure Of A Class Ii Ubiquitin-Conjugating E 1e-08
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 2e-08
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 2e-08
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 2e-08
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 2e-08
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 2e-08
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 2e-08
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 2e-08
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 2e-08
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 2e-08
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 2e-08
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 2e-08
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 2e-08
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 2e-08
2onu_A152 Plasmodium Falciparum Ubiquitin Conjugating Enzyme 2e-08
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 3e-08
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 8e-08
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 9e-08
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 1e-07
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 1e-07
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 1e-07
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 1e-07
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 1e-07
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 1e-07
3sqv_C156 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 1e-07
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 1e-07
1c4z_D154 Structure Of E6ap: Insights Into Ubiquitination Pat 2e-07
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 2e-07
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 2e-07
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 1e-06
2z5d_A179 Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 1e-06
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 2e-06
2kjh_A152 Nmr Based Structural Model Of The Ubch8-Ubiquitin C 7e-06
1wzv_A155 Crystal Structure Of Ubch8 Length = 155 7e-06
1yf9_A171 Structural Analysis Of Leishmania Major Ubiquitin C 8e-06
2y9o_A172 Pex4p-Pex22p Mutant I Structure Length = 172 1e-05
2y9m_A172 Pex4p-Pex22p Structure Length = 172 1e-05
2y9p_A172 Pex4p-Pex22p Mutant Ii Structure Length = 172 1e-05
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 3e-05
2f4w_A187 Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 1 3e-05
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 3e-05
3fn1_B167 E2-Ring Expansion Of The Nedd8 Cascade Confers Spec 3e-05
4ds2_A167 Ubiquitin Conjugating Enzyme (Putative) From Trypan 3e-05
2edi_A173 Solution Structure Of The Uq_con Domain From Human 4e-05
3e95_C158 Crystal Structure Of The Plasmodium Falciparum Ubiq 3e-04
2q0v_A156 Crystal Structure Of Ubiquitin Conjugating Enzyme E 3e-04
3ceg_A 323 Crystal Structure Of The Ubc Domain Of Baculoviral 4e-04
2c2v_C142 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 7e-04
1j74_A145 Crystal Structure Of Mms2 Length = 145 7e-04
2a4d_A160 Structure Of The Human Ubiquitin-Conjugating Enzyme 8e-04
2hlw_A170 Solution Structure Of The Human Ubiquitin-Conjugati 8e-04
1zgu_A139 Solution Structure Of The Human Mms2-Ubiquitin Comp 8e-04
4epo_A149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 8e-04
3von_B138 Crystalstructure Of The Ubiquitin Protease Length = 9e-04
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure

Iteration: 1

Score = 108 bits (271), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 45/61 (73%), Positives = 54/61 (88%) Query: 224 FRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVY 283 FRV LV++ +L+ WEVAIFGPP+T Y+GGYFKA +KFPIDYPYSPP RFLTK+WHPN+Y Sbjct: 27 FRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIY 86 Query: 284 E 284 E Sbjct: 87 E 87
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 Back     alignment and structure
>pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 Back     alignment and structure
>pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 Back     alignment and structure
>pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 Back     alignment and structure
>pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 Back     alignment and structure
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 Back     alignment and structure
>pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 Back     alignment and structure
>pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 Back     alignment and structure
>pdb|2Y9O|A Chain A, Pex4p-Pex22p Mutant I Structure Length = 172 Back     alignment and structure
>pdb|2Y9M|A Chain A, Pex4p-Pex22p Structure Length = 172 Back     alignment and structure
>pdb|2Y9P|A Chain A, Pex4p-Pex22p Mutant Ii Structure Length = 172 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 187 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 Back     alignment and structure
>pdb|4DS2|A Chain A, Ubiquitin Conjugating Enzyme (Putative) From Trypanosoma Cruzi Length = 167 Back     alignment and structure
>pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 Back     alignment and structure
>pdb|3E95|C Chain C, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 158 Back     alignment and structure
>pdb|2Q0V|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2, Putative, From Plasmodium Falciparum Length = 156 Back     alignment and structure
>pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 Back     alignment and structure
>pdb|2C2V|C Chain C, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 142 Back     alignment and structure
>pdb|1J74|A Chain A, Crystal Structure Of Mms2 Length = 145 Back     alignment and structure
>pdb|2A4D|A Chain A, Structure Of The Human Ubiquitin-Conjugating Enzyme E2 Variant 1 (Uev- 1) Length = 160 Back     alignment and structure
>pdb|2HLW|A Chain A, Solution Structure Of The Human Ubiquitin-Conjugating Enzyme Variant Uev1a Length = 170 Back     alignment and structure
>pdb|1ZGU|A Chain A, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 139 Back     alignment and structure
>pdb|4EPO|A Chain A, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|3VON|B Chain B, Crystalstructure Of The Ubiquitin Protease Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 1e-33
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 6e-22
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-33
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-22
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 7e-33
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 1e-21
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 1e-32
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 2e-21
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 3e-29
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 1e-16
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 8e-29
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 5e-16
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 3e-28
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 1e-16
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 4e-28
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 8e-17
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 5e-28
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 2e-16
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 7e-28
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 3e-15
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 1e-27
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-16
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 1e-27
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 3e-11
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 2e-27
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 2e-13
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 3e-27
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 2e-16
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 4e-27
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 3e-16
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 4e-27
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 3e-15
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 5e-27
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 4e-15
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 7e-27
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 3e-17
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 1e-26
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 9e-14
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 1e-26
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 2e-15
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 3e-26
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 3e-14
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 4e-26
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 1e-13
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 4e-26
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 2e-10
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 4e-26
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 6e-14
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 5e-26
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-11
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 5e-26
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 6e-10
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 6e-26
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 2e-13
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 6e-26
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 1e-10
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 7e-26
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 1e-10
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 8e-26
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 3e-10
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 8e-26
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 3e-13
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 9e-26
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 3e-10
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-25
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 8e-13
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 1e-25
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 5e-13
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 1e-25
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 4e-13
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 1e-25
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 1e-12
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 2e-25
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 3e-09
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 2e-25
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 4e-13
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 2e-25
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 1e-09
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 3e-25
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 4e-10
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 4e-25
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 1e-13
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 5e-25
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 8e-10
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 5e-25
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 4e-10
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 2e-23
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 6e-12
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 2e-23
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 1e-08
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 3e-23
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 3e-09
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 8e-23
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 7e-15
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 6e-20
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 4e-07
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 1e-19
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 2e-09
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 2e-19
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 1e-10
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
 Score =  120 bits (302), Expect = 1e-33
 Identities = 45/61 (73%), Positives = 54/61 (88%)

Query: 224 FRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVY 283
           FRV LV++ +L+ WEVAIFGPP+T Y+GGYFKA +KFPIDYPYSPP  RFLTK+WHPN+Y
Sbjct: 27  FRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIY 86

Query: 284 E 284
           E
Sbjct: 87  E 87


>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.91
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.91
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.9
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.9
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.9
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.9
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.9
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.9
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.9
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.9
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.9
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.9
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.89
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.89
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.89
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.89
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.89
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.89
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.89
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.89
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.89
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.89
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.89
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.89
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.89
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.89
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.89
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.89
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.89
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.89
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.89
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.89
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.89
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.89
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.89
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.89
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.89
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.89
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.89
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.89
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.88
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.88
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.88
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.88
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.88
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.88
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.88
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.88
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.88
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 99.88
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.88
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.88
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.88
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.88
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.88
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.88
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.88
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.87
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.87
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.87
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.87
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.87
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.87
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.87
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.87
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.87
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.87
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.86
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.86
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.86
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.86
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.86
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.86
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.86
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.85
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.85
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.85
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.85
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.85
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.85
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.84
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.84
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.84
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.84
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.84
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.83
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.83
4ddg_A399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.83
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.83
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.83
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.83
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.82
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.82
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.82
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.81
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.81
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.81
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.81
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.8
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.8
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.79
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.77
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.65
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.49
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.06
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 98.89
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 98.8
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 98.5
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 97.89
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 96.32
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 90.6
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 89.38
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 88.36
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 83.63
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 81.73
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
Probab=99.91  E-value=2.7e-24  Score=175.11  Aligned_cols=127  Identities=22%  Similarity=0.351  Sum_probs=106.8

Q ss_pred             CChHHHHHHHHHHHHhhhCCCCCeEEEecCCCCceEEEEEEeCCCCCCccCcEEEEEE--cCCCCCCCcccceecccccc
Q psy621            5 PTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAII--EGELPHWDVNVQNQIENLTK   82 (289)
Q Consensus         5 ~~~~~~~Rl~kE~~~l~~~~~~g~~~~~~~~~n~~~w~~~i~gp~~t~y~g~~~~v~v--~~~yp~~~P~v~~~~~~~~~   82 (289)
                      |++.|.+||+||+++|++++++|+.+.+.+++|+++|++.|.||++|+|+||.|++.|  +++||++||+++|.++++||
T Consensus         1 M~~~a~~RL~kEl~~l~~~~~~gi~~~~~~~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~YP~~PP~v~f~t~i~HP   80 (165)
T 2ucz_A            1 MSKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSILHP   80 (165)
T ss_dssp             -CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEESSCCSCT
T ss_pred             CChHHHHHHHHHHHHHHhCCCCCEEEEECCCCCccEEEEEEECCCCCCccCcEEEEEEECCccCCCCCCEEEEeCCCccC
Confidence            4568999999999999999999999998777899999999999999999999986655  89999999999999999999


Q ss_pred             ceeccceeeCccc-------------cCccchHH---------HHHhhh-c-ccccccCC-----CchhhHHHHhHHh
Q psy621           83 TFEASSFISAPLY-------------TESWLRSF---------VSYVRR-N-QDFLNVTI-----DTREGFLKTLNDL  131 (289)
Q Consensus        83 ~~e~~~~~~~~~~-------------~~~Wl~~y---------~~~l~~-~-~~~~n~~~-----~~~~~F~~~l~~~  131 (289)
                      |+..+|.+|++++             .+.|.+++         +++|.. + ++++|.++     ++++.|.+.++++
T Consensus        81 Nv~~~G~iCl~iL~~~~~~~~~~~~~~~~W~p~~~i~~vL~si~~ll~~Pn~~~p~n~~aa~~~~~~~~~y~~~v~~~  158 (165)
T 2ucz_A           81 NIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLS  158 (165)
T ss_dssp             TBCTTSBBCCGGGSCCCSCTTSTTTTTTSCCTTCCHHHHHHHHHHHHHSCCGGGCCCHHHHHHHHTTHHHHHHHHHHH
T ss_pred             CCCCCCcEeehhhCCccccccccCCCCCCCCCcCcHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHCHHHHHHHHHHH
Confidence            9999999999998             57898874         333332 2 34444432     6788888888874



>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 1e-18
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 6e-13
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 1e-16
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 7e-11
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 5e-16
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 1e-09
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 8e-16
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 6e-08
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 2e-14
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 7e-05
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-14
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 4e-12
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 1e-13
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 4e-11
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 1e-13
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 4e-12
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 2e-13
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 2e-08
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 4e-13
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 4e-07
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 5e-13
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-08
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-13
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 8e-09
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 1e-12
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 2e-04
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 1e-12
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 5e-07
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 2e-12
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 6e-12
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 2e-12
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 4e-09
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 4e-12
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 9e-11
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 6e-12
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-08
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-11
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 6e-07
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 2e-11
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 3e-09
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 2e-11
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 3e-07
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 9e-11
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 0.001
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 2e-10
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 3e-07
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 3e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 2e-09
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 1e-09
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 6e-07
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-09
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-07
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 2e-09
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 4e-07
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 2e-09
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 5e-09
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 5e-09
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 1e-08
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 4e-07
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 9e-05
d1uzxa_152 d.20.1.2 (A:) Vacuolar protein sorting-associated 6e-05
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 G1 [TaxId: 9606]
 Score = 77.8 bits (191), Expect = 1e-18
 Identities = 35/63 (55%), Positives = 48/63 (76%)

Query: 224 FRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVY 283
           F   L++D++L+ WEV I GPPDTLY+GG FKAH+ FP DYP  PP ++F+T++WHPNV 
Sbjct: 19  FSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVD 78

Query: 284 EGT 286
           +  
Sbjct: 79  KNG 81


>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.89
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.89
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.89
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.89
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.88
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.88
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.88
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.88
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.88
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.88
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.88
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.87
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.87
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.87
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.86
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.86
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.86
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.86
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.85
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.84
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.83
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.81
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.8
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.8
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.78
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.78
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.77
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.73
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.73
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.7
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.7
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.28
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 98.76
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 98.57
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 97.95
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 88.62
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 T [TaxId: 9606]
Probab=99.89  E-value=1.4e-23  Score=167.27  Aligned_cols=82  Identities=30%  Similarity=0.632  Sum_probs=76.7

Q ss_pred             HHHHHHHHHHHHHHhCCCCeEeeccccccccchhhhcchhhhhhhhhceeeeEEeeeccccCCCCcceEEEEEeCCCCCC
Q psy621          169 MEKEMVKELRRIAHESSLNVSVFHPYFVFFDQFELVRPTTIQSMLGGSVTMMFIRFRVKLVNDDNLFEWEVAIFGPPDTL  248 (289)
Q Consensus       169 ~~~~~~~~~r~ia~~~~~~~~~~~~~~~~~DQ~~~i~~~tiq~~~~a~~~m~~v~~~~i~~~~~~~~~w~~~i~gp~~t~  248 (289)
                      ..+|+++|++.+.++.+.++++.                                     ++++|+++|+++|.||+|||
T Consensus         3 ~~~Rl~kE~~~l~~~~~~gi~~~-------------------------------------p~~~~~~~w~~~I~Gp~~Tp   45 (154)
T d1yh2a1           3 RASRLKRELHMLATEPPPGITCW-------------------------------------QDKDQMDDLRAQILGGANTP   45 (154)
T ss_dssp             HHHHHHHHHHHHHHSCCTTEEEE-------------------------------------ESSSCTTEEEEEEECCTTST
T ss_pred             HHHHHHHHHHHHHHCcCCCEEEE-------------------------------------ECCcchhhhhceEeCCCCCC
Confidence            34789999999999988888876                                     78899999999999999999


Q ss_pred             CCCCEEEEEEEcCCCCCCCCCeEEEecCCcCCCCCCCCC
Q psy621          249 YQGGYFKAHMKFPIDYPYSPPTIRFLTKVWHPNVYEGTA  287 (289)
Q Consensus       249 y~~g~~~~~i~~~~~yP~~pP~v~f~t~i~hpnv~~~~~  287 (289)
                      |+||+|+++|.||++||++||+|+|.|++|||||+++|+
T Consensus        46 Y~gg~f~~~i~~p~~YP~~pP~v~f~t~i~HPnV~~~g~   84 (154)
T d1yh2a1          46 YEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGR   84 (154)
T ss_dssp             TTTCEEEEEEECCTTTTSSCCEEEESSCCCBTTBCTTCB
T ss_pred             CCCCEEEEEEecCccccCCCceeeccCCCCcCCcCCCCC
Confidence            999999999999999999999999999999999998774



>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure