Psyllid ID: psy634

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYVDDYDLDDDDDEDEEEEGEEGAEEEGGDSGDDSGNGEL
ccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccHHHHHHHHHHHHHcccccccccHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHccccccEccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mpcerwnptqNVRTILLSVISllnepntsspanvdasVMYRRwrdskgcdkeYENIIRKqvsggrieadkdgvkipmTLEDYCIkaktrpadtsmdmtdfyvddydldddddedeeeegeegaeeeggdsgddsgngel
mpcerwnptqnVRTILLSVISllnepntsspanvdasvmyRRWRdskgcdkeyeniirkqvsggrieadkdgvkipMTLEDYCIKaktrpadtsmdmtDFYVDDYDLDDDDDEDEEEegeegaeeeggdsgddsgngel
MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYVddydldddddedeeeegeegaeeeggdsgddsgngeL
*********QNVRTILLSVISLLN**********DASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAKT********MTDFYVDD***********************************
*PCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQV*******D*DGVKIPM*********************DFYVDDYDLDDDDDEDEE***********************
********TQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYVDDYDLDD******************************
****RWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAK*********MTD****************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYVDDYDLDDDDDEDEEEEGEEGAEEEGGDSGDDSGNGEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
P49427236 Ubiquitin-conjugating enz yes N/A 0.913 0.538 0.594 1e-37
Q8CFI2235 Ubiquitin-conjugating enz yes N/A 0.906 0.536 0.594 1e-36
Q29503238 Ubiquitin-conjugating enz no N/A 0.676 0.394 0.755 1e-36
Q6ZWZ2238 Ubiquitin-conjugating enz no N/A 0.676 0.394 0.755 1e-36
Q712K3238 Ubiquitin-conjugating enz no N/A 0.676 0.394 0.755 1e-36
P14682295 Ubiquitin-conjugating enz yes N/A 0.741 0.349 0.345 2e-11
Q8SSK3216 Probable ubiquitin-conjug yes N/A 0.287 0.185 0.65 6e-11
P0C8G4217 Ubiquitin-conjugating enz no N/A 0.273 0.175 0.736 2e-09
P0C8G3218 Ubiquitin-conjugating enz no N/A 0.489 0.311 0.445 1e-08
P27949215 Ubiquitin-conjugating enz no N/A 0.273 0.176 0.684 2e-08
>sp|P49427|UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 99/138 (71%), Gaps = 11/138 (7%)

Query: 1   MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQ 60
           +P ERWNPTQNVRTILLSVISLLNEPNT SPANVDASVMYR+W++SKG D+EY +IIRKQ
Sbjct: 109 LPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQ 168

Query: 61  VSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYVDDYDLDDDDDEDEEEEGE 120
           V G +++A++DGVK+P TL +YC+K K    D   D+  FY         DD  E+ E E
Sbjct: 169 VLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDL--FY---------DDYYEDGEVE 217

Query: 121 EGAEEEGGDSGDDSGNGE 138
           E A+   GD  DDSG  E
Sbjct: 218 EEADSCFGDDEDDSGTEE 235
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin. Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q8CFI2|UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1 Back     alignment and function description
>sp|Q29503|UB2R2_RABIT Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZWZ2|UB2R2_MOUSE Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=2 SV=1 Back     alignment and function description
>sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1 Back     alignment and function description
>sp|P14682|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC34 PE=1 SV=1 Back     alignment and function description
>sp|Q8SSK3|Y1A1_ENCCU Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_1010 PE=1 SV=1 Back     alignment and function description
>sp|P0C8G4|UBC_ASFP4 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1 Back     alignment and function description
>sp|P0C8G3|UBC_ASFK5 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=UBC PE=2 SV=1 Back     alignment and function description
>sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
242015514 246 ubiquitin-conjugating enzyme E2-32 kDa c 0.733 0.414 0.823 2e-45
156552864 242 PREDICTED: ubiquitin-conjugating enzyme 0.964 0.553 0.724 4e-43
66504238239 PREDICTED: ubiquitin-conjugating enzyme 0.942 0.548 0.688 9e-43
380026284210 PREDICTED: ubiquitin-conjugating enzyme 0.942 0.623 0.688 1e-42
307197724238 Ubiquitin-conjugating enzyme E2 R2 [Harp 0.877 0.512 0.623 1e-42
240849633 242 ubiquitin-conjugating enyzme E2r-like [A 0.928 0.533 0.645 2e-42
307172394238 Ubiquitin-conjugating enzyme E2 R2 [Camp 0.877 0.512 0.616 2e-42
427787953 266 Putative ubiquitin-protein ligase [Rhipi 0.726 0.379 0.735 3e-39
167888833 241 ubiquitin-conjugating enyzme E2r [Marsup 0.647 0.373 0.822 1e-38
195128457 321 GI13630 [Drosophila mojavensis] gi|19392 0.798 0.345 0.675 2e-38
>gi|242015514|ref|XP_002428398.1| ubiquitin-conjugating enzyme E2-32 kDa complementing, putative [Pediculus humanus corporis] gi|212513010|gb|EEB15660.1| ubiquitin-conjugating enzyme E2-32 kDa complementing, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%)

Query: 1   MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQ 60
           +PCERWNPTQNVRTILLSVISLLNEPNT SPANVDASVMYRRWR+SKG DKEYENIIRKQ
Sbjct: 118 LPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRRWRESKGKDKEYENIIRKQ 177

Query: 61  VSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMTDFYV 102
           VS  R+EA+KDGV +P+TLEDYCIK K +PA+ ++DMTDFYV
Sbjct: 178 VSAARLEAEKDGVVVPLTLEDYCIKTKVKPAENNVDMTDFYV 219

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156552864|ref|XP_001600179.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|66504238|ref|XP_394314.2| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Apis mellifera] gi|340728699|ref|XP_003402655.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Bombus terrestris] gi|350415366|ref|XP_003490616.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Bombus impatiens] gi|383851872|ref|XP_003701455.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380026284|ref|XP_003696882.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Apis florea] Back     alignment and taxonomy information
>gi|307197724|gb|EFN78873.1| Ubiquitin-conjugating enzyme E2 R2 [Harpegnathos saltator] gi|332027425|gb|EGI67508.1| Ubiquitin-conjugating enzyme E2 R2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|240849633|ref|NP_001155411.1| ubiquitin-conjugating enyzme E2r-like [Acyrthosiphon pisum] gi|239793037|dbj|BAH72783.1| ACYPI001111 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307172394|gb|EFN63860.1| Ubiquitin-conjugating enzyme E2 R2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|427787953|gb|JAA59428.1| Putative ubiquitin-protein ligase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|167888833|gb|ACA09717.1| ubiquitin-conjugating enyzme E2r [Marsupenaeus japonicus] Back     alignment and taxonomy information
>gi|195128457|ref|XP_002008680.1| GI13630 [Drosophila mojavensis] gi|193920289|gb|EDW19156.1| GI13630 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|E1BAB9225 UBE2R2 "Uncharacterized protei 0.726 0.448 0.718 6.5e-35
UNIPROTKB|J9P7F2238 UBE2R2 "Uncharacterized protei 0.726 0.424 0.718 6.5e-35
UNIPROTKB|Q712K3238 UBE2R2 "Ubiquitin-conjugating 0.726 0.424 0.718 6.5e-35
UNIPROTKB|Q29503238 UBE2R2 "Ubiquitin-conjugating 0.726 0.424 0.718 6.5e-35
MGI|MGI:1914865238 Ube2r2 "ubiquitin-conjugating 0.726 0.424 0.718 6.5e-35
RGD|1594826238 Ube2r2 "ubiquitin-conjugating 0.726 0.424 0.718 6.5e-35
UNIPROTKB|E1BW49235 CDC34 "Uncharacterized protein 0.726 0.429 0.669 1.7e-34
FB|FBgn0036516341 CG7656 [Drosophila melanogaste 0.719 0.293 0.686 2.2e-34
UNIPROTKB|F1NV52237 UBE2R2 "Uncharacterized protei 0.697 0.409 0.731 3.6e-34
UNIPROTKB|J9P0N9236 CDC34 "Uncharacterized protein 0.726 0.427 0.660 5.8e-34
UNIPROTKB|E1BAB9 UBE2R2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 6.5e-35, P = 6.5e-35
 Identities = 74/103 (71%), Positives = 82/103 (79%)

Query:     1 MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQ 60
             +P ERWNPTQNVRTILLSVISLLNEPNT SPANVDASVM+R+WRDSKG DKEY  IIRKQ
Sbjct:    96 LPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQ 155

Query:    61 VSGGRIEADKDGVKIPMTLEDYCIKAKTRPADTSMDMT--DFY 101
             VS  + EA+KDGVK+P TL +YCIK K    D S D+   D Y
Sbjct:   156 VSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLY 198
GO:0070936 "protein K48-linked ubiquitination" evidence=IEA
GO:0006513 "protein monoubiquitination" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
UNIPROTKB|J9P7F2 UBE2R2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q712K3 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29503 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1914865 Ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1594826 Ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW49 CDC34 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0036516 CG7656 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV52 UBE2R2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0N9 CDC34 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CFI2UB2R1_MOUSE6, ., 3, ., 2, ., 1, 90.59420.90640.5361yesN/A
P49427UB2R1_HUMAN6, ., 3, ., 2, ., 1, 90.59420.91360.5381yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.190.824
3rd Layer6.3.20.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 7e-16
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 1e-15
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 3e-15
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 2e-13
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information 
 Score = 68.8 bits (169), Expect = 7e-16
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 4   ERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQV 61
             W+P   +RT+LLS+ SLLNEPN S P N +A+ +Y+  R      +E++   R+  
Sbjct: 90  HGWSPAYTLRTVLLSLQSLLNEPNPSDPLNAEAAKLYKENR------EEFKKKAREWT 141

This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD. Length = 141
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG0425|consensus171 99.79
KOG0417|consensus148 99.67
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.62
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.58
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.55
KOG0419|consensus152 99.55
KOG0426|consensus165 99.46
KOG0424|consensus158 99.39
KOG0418|consensus200 99.25
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.25
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.24
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.17
KOG0420|consensus184 99.17
KOG0422|consensus153 99.15
KOG0421|consensus175 99.14
KOG0416|consensus189 99.13
KOG0423|consensus223 98.78
KOG0429|consensus258 96.66
KOG0427|consensus161 95.58
KOG0894|consensus244 88.87
KOG0895|consensus1101 84.26
>KOG0425|consensus Back     alignment and domain information 
Probab=99.79  E-value=1.4e-19  Score=140.38  Aligned_cols=66  Identities=50%  Similarity=0.830  Sum_probs=62.7

Q ss_pred             CCCCCCcccccHHHHHHHHHHhhcCCCCCCCCcHHHHHHHHhccCCCCChHHHHHHHHHHHhccccccCCCC
Q psy634            1 MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDG   72 (139)
Q Consensus         1 l~~e~WsPt~~V~~ILlSI~sLL~ePN~~sPlN~dAA~~yr~nr~~~~~~~~y~~~ar~~v~~~a~~ae~~G   72 (139)
                      +|++||+|++||++||+||+|||+.||.+||+|++||++||.|+      ++|.++|+++|.++...++|.|
T Consensus       106 ~~~erW~Pv~tvetIllSiIsmL~~PN~~SPANVDAa~~~Ren~------~EykkkV~r~vr~s~e~~~r~~  171 (171)
T KOG0425|consen  106 LPSERWLPVQTVETILLSIISMLNSPNDESPANVDAAKEWRENP------EEYKKKVRRCVRRSQEEAEREG  171 (171)
T ss_pred             ChhhccCCccchhHhHHHHHHHHcCCCCCCccchHHHHHHhhCH------HHHHHHHHHHHHHHHHhhhccC
Confidence            58899999999999999999999999999999999999999997      9999999999999998887765

>KOG0417|consensus Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 9e-31
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 1e-30
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 6e-09
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 6e-09
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 6e-09
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 7e-09
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-08
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 6e-08
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 1e-07
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 2e-06
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 3e-06
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 6e-06
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 6e-06
1jas_A152 Hsubc2b Length = 152 1e-05
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 4e-05
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 5e-05
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 1e-04
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 2e-04
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 2e-04
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 4e-04
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 4e-04
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 4e-04
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 4e-04
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 4e-04
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 4e-04
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 4e-04
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 5e-04
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 5e-04
3o2u_A190 S. Cerevisiae Ubc12 Length = 190 8e-04
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 9e-04
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure 
Iteration: 1

 Score =  128 bits (322), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%)
Query: 1   MPCERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQ 60
           +P ERWNPTQNVRTILLSVISLLNEPNT SPANVDASVMYR+W++SKG D+EY +IIRKQ
Sbjct: 105 LPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQ 164
Query: 61  VSGGRIEADKDGVKIP 76
           V G +++A++DGVK+P
Sbjct: 165 VLGTKVDAERDGVKVP 180
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.74
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.61
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.61
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.59
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.59
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.59
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.59
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.59
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.58
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.58
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.58
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.58
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.58
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.58
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.57
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.57
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.57
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.57
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.57
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.57
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.56
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.56
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.56
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.55
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.55
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.55
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.53
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.53
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.53
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 99.52
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.49
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.48
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.46
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.45
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.45
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.44
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.44
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.43
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.41
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.38
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.05
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 98.96
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 97.99
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 97.91
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
Probab=99.74  E-value=7.8e-19  Score=136.28  Aligned_cols=74  Identities=77%  Similarity=1.239  Sum_probs=67.7

Q ss_pred             CCCCcccccHHHHHHHHHHhhcCCCCCCCCcHHHHHHHHhccCCCCChHHHHHHHHHHHhccccccCCCCcccC
Q psy634            3 CERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRIEADKDGVKIP   76 (139)
Q Consensus         3 ~e~WsPt~~V~~ILlSI~sLL~ePN~~sPlN~dAA~~yr~nr~~~~~~~~y~~~ar~~v~~~a~~ae~~Gv~vp   76 (139)
                      .++|+|+++|++||++|++||.+||+.+|+|.+||.+|+++++.++++++|.++||++|++++..++++|++||
T Consensus       110 ~~~W~p~~~i~~vL~si~~ll~~Pn~~~p~n~~aa~~~~~~~~~~~~~~~y~~~v~~~v~~s~~~~~~~g~~vp  183 (183)
T 3rz3_A          110 SERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVP  183 (183)
T ss_dssp             -CCCCTTCCHHHHHHHHHHHHHSCCCSSCSSHHHHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHTTCCC-
T ss_pred             cCCCCCcCcHHHHHHHHHHHHhCCCCCCcccHHHHHHHHhcccccccHHHHHHHHHHHHHHHHHHHHHcCCcCC
Confidence            48899999999999999999999999999999999999996655555689999999999999999999999997
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 4e-12
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 1e-11
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-11
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 5e-11
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 5e-11
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-10
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 7e-10
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 9e-10
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-09
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 1e-09
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-09
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 3e-09
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 3e-09
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 5e-09
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 9e-09
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 4e-08
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 6e-08
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 1e-07
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 2e-07
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 2e-07
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-07
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 7e-07
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 1e-06
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 2e-06
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 3e-06
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 3e-06
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 4e-05
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 8e-05
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 1e-04
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 M [TaxId: 9606]

 Score = 57.8 bits (139), Expect = 4e-12
 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 15/82 (18%)

Query: 4   ERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSG 63
           E W P   + +I+  +  L  EPN   P N +A+ + +  R      + +E  +++ + G
Sbjct: 91  EDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNR------RLFEQNVQRSMRG 144

Query: 64  GRIEADKDGVKIPMTLEDYCIK 85
           G          I  T  + C+K
Sbjct: 145 G---------YIGSTYFERCLK 157
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.55
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.52
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.51
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.49
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.48
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.48
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.48
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.47
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.47
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.46
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.44
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.43
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.43
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.42
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.41
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.39
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.39
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.38
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.26
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.25
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.25
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.24
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 98.72
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 98.46
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]

Probab=99.55  E-value=2.8e-15  Score=110.24  Aligned_cols=58  Identities=19%  Similarity=0.369  Sum_probs=55.4

Q ss_pred             CCCCcccccHHHHHHHHHHhhcCCCCCCCCcHHHHHHHHhccCCCCChHHHHHHHHHHHhcccc
Q psy634            3 CERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRRWRDSKGCDKEYENIIRKQVSGGRI   66 (139)
Q Consensus         3 ~e~WsPt~~V~~ILlSI~sLL~ePN~~sPlN~dAA~~yr~nr~~~~~~~~y~~~ar~~v~~~a~   66 (139)
                      .+.|+|++||++||++|++||.+||+++|+|.+||.+|++|+      ++|.++||.||++||.
T Consensus        92 ~~~W~p~~ti~~il~~i~~ll~~p~~~~p~n~eaa~~~~~~~------~~f~~~~~~~~~k~A~  149 (149)
T d1fzya_          92 KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDR------ESFNKTAALWTRLYAS  149 (149)
T ss_dssp             TTTCCTTCCHHHHHHHHHHHHHSCCTTSCSSHHHHHHHHHCH------HHHHHHHHHHHHHHCC
T ss_pred             cccCCCcCCHHHHHHHHHHHHhCCCCCChhHHHHHHHHHHCH------HHHHHHHHHHHHHhcC
Confidence            467999999999999999999999999999999999999997      9999999999999984
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure