Psyllid ID: psy6362

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MNVVGSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
cccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccc
ccccccccHHHHHHHHcHHHHHHEEEEEEEHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccc
mnvvgspglhdwFWTLGIEHVCNVLVILITVDDVILLRNRATnlnarmhdgtTPLILAARLAIEGMVEDLINdfvcspglhdwfwTLGIEHVCNVLVILITDDDVILLRNRATnlnarmhdgtTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
MNVVGSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATnlnarmhdgtTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRAtnlnarmhdgtTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
MNVVGSPGLHDWFWTLGIEHVCNvlvilitvddvillRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
*******GLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKEN****
****GSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFF*******
MNVVGSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
****GSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKE*****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVVGSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKENINKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
P07207 2703 Neurogenic locus Notch pr yes N/A 0.535 0.031 0.523 7e-16
Q07008 2531 Neurogenic locus notch ho yes N/A 0.585 0.036 0.525 3e-14
Q01705 2531 Neurogenic locus notch ho yes N/A 0.585 0.036 0.525 3e-14
P46531 2555 Neurogenic locus notch ho yes N/A 0.585 0.036 0.515 8e-14
Q9QW30 2471 Neurogenic locus notch ho no N/A 0.541 0.034 0.461 3e-13
O35516 2470 Neurogenic locus notch ho no N/A 0.541 0.034 0.461 3e-13
Q04721 2471 Neurogenic locus notch ho no N/A 0.541 0.034 0.461 3e-13
P46530 2437 Neurogenic locus notch ho no N/A 0.242 0.015 0.842 9e-13
P21783 2524 Neurogenic locus notch pr N/A N/A 0.242 0.015 0.842 4e-12
Q9R172 2319 Neurogenic locus notch ho no N/A 0.522 0.035 0.448 2e-11
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 61/105 (58%), Gaps = 21/105 (20%)

Query: 35   ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLIN--------DFVCSPGLHDWFWT 86
            ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLI         D      LH   W 
Sbjct: 2002 ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALH---WA 2058

Query: 87   LGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAAR 131
              + +         T+   ILL + A N +A+     TPL LAAR
Sbjct: 2059 AAVNN---------TEAVNILLMHHA-NRDAQDDKDETPLFLAAR 2093
Signaling protein, which regulates, with both positive and negative signals, the differentiation of at least central and peripheral nervous system and eye, wing disk, oogenesis, segmental appendages such as antennae and legs, and muscles, through lateral inhibition or induction. Functions as a receptor for membrane-bound ligands Delta and Serrate to regulate cell-fate determination. Upon ligand activation, and releasing from the cell membrane, the Notch intracellular domain (NICD) forms a transcriptional activator complex with Su(H) (Suppressor of hairless) and activates genes of the E(spl) complex. Essential for proper differentiation of ectoderm. Fringe (fng) acts in the Golgi to determine the type of O-linked fucose on the EGF modules in N, altering the ability of N to bind with Delta (Dl). O-fut1 also has a role in modulating the interaction. Rumi acts in the endoplasmic reticulum to glucosylate the EGF modules in N, this is required for correct folding and cleavage of N.
Drosophila melanogaster (taxid: 7227)
>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=2 SV=2 Back     alignment and function description
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 Back     alignment and function description
>sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 Back     alignment and function description
>sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
242009671 2491 notch, putative [Pediculus humanus corpo 0.535 0.033 0.523 1e-15
255652901 2463 Notch homolog [Bombyx mori] gi|251752766 0.611 0.038 0.478 2e-15
157125482 2599 neurogenic locus notch (notch) [Aedes ae 0.566 0.034 0.504 3e-15
383859393 2508 PREDICTED: neurogenic locus Notch protei 0.566 0.035 0.495 4e-15
380013907 2461 PREDICTED: neurogenic locus Notch protei 0.566 0.036 0.495 4e-15
350416202 2500 PREDICTED: neurogenic locus Notch protei 0.566 0.035 0.495 4e-15
340728435 1986 PREDICTED: neurogenic locus Notch protei 0.566 0.044 0.495 4e-15
347964943 2800 AGAP001015-PA [Anopheles gambiae str. PE 0.566 0.031 0.504 4e-15
328788585 2459 PREDICTED: neurogenic locus Notch protei 0.566 0.036 0.495 4e-15
307166436 884 Neurogenic locus Notch protein [Camponot 0.566 0.100 0.495 4e-15
>gi|242009671|ref|XP_002425606.1| notch, putative [Pediculus humanus corporis] gi|212509499|gb|EEB12868.1| notch, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 87.8 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 60/105 (57%), Gaps = 21/105 (20%)

Query: 35   ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLIN--------DFVCSPGLHDWFWT 86
            ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLIN        D      LH   W 
Sbjct: 1948 ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINADADINAADNNGKTALH---WA 2004

Query: 87   LGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAAR 131
              + +V          D V +L     N +A+     TPL LAAR
Sbjct: 2005 AAVNNV----------DAVNILLAHGANRDAQDDKDETPLFLAAR 2039

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|255652901|ref|NP_001157370.1| Notch homolog [Bombyx mori] gi|251752766|dbj|BAH83638.1| Notch [Bombyx mori] Back     alignment and taxonomy information
>gi|157125482|ref|XP_001654351.1| neurogenic locus notch (notch) [Aedes aegypti] gi|108873616|gb|EAT37841.1| AAEL010210-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|383859393|ref|XP_003705179.1| PREDICTED: neurogenic locus Notch protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380013907|ref|XP_003690986.1| PREDICTED: neurogenic locus Notch protein-like [Apis florea] Back     alignment and taxonomy information
>gi|350416202|ref|XP_003490873.1| PREDICTED: neurogenic locus Notch protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728435|ref|XP_003402530.1| PREDICTED: neurogenic locus Notch protein-like, partial [Bombus terrestris] Back     alignment and taxonomy information
>gi|347964943|ref|XP_309208.5| AGAP001015-PA [Anopheles gambiae str. PEST] gi|333466550|gb|EAA04964.6| AGAP001015-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328788585|ref|XP_396734.4| PREDICTED: neurogenic locus Notch protein [Apis mellifera] Back     alignment and taxonomy information
>gi|307166436|gb|EFN60549.1| Neurogenic locus Notch protein [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
UNIPROTKB|F1M7Y4 2208 Notch1 "Neurogenic locus notch 0.598 0.042 0.5 3.2e-13
UNIPROTKB|G3I6Z6 2412 I79_019276 "Neurogenic locus n 0.598 0.038 0.5 3.5e-13
RGD|3187 2531 Notch1 "notch 1" [Rattus norve 0.598 0.037 0.5 3.7e-13
UNIPROTKB|Q07008 2531 Notch1 "Neurogenic locus notch 0.598 0.037 0.5 3.7e-13
MGI|MGI:97363 2531 Notch1 "notch 1" [Mus musculus 0.598 0.037 0.5 3.7e-13
UNIPROTKB|P46531 2555 NOTCH1 "Neurogenic locus notch 0.598 0.036 0.5 4.8e-13
UNIPROTKB|Q9W737 1194 Gga.54229 "NOTCH-1" [Gallus ga 0.598 0.078 0.490 8.5e-13
UNIPROTKB|J9NS51 2272 NOTCH1 "Uncharacterized protei 0.598 0.041 0.490 8.7e-13
UNIPROTKB|F1MSM3 2534 NOTCH1 "Uncharacterized protei 0.598 0.037 0.490 9.8e-13
UNIPROTKB|F1PDC7 2555 NOTCH1 "Uncharacterized protei 0.598 0.036 0.490 9.9e-13
UNIPROTKB|F1M7Y4 Notch1 "Neurogenic locus notch homolog protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 190 (71.9 bits), Expect = 3.2e-13, P = 3.2e-13
 Identities = 51/102 (50%), Positives = 63/102 (61%)

Query:    38 RNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCNVLV 97
             RNRAT+L+ARMHDGTTPLILAARLA+EGM+EDLIN       + D    LG   +     
Sbjct:  1649 RNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDD----LGKSALHWAAA 1704

Query:    98 ILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVE 139
             +   D  V+LL+N A N + + +   TPL LAAR   EG  E
Sbjct:  1705 VNNVDAAVVLLKNGA-NKDMQNNKEETPLFLAAR---EGSYE 1742
GO:0004872 "receptor activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007219 "Notch signaling pathway" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0030154 "cell differentiation" evidence=IEA
GO:0050793 "regulation of developmental process" evidence=IEA
UNIPROTKB|G3I6Z6 I79_019276 "Neurogenic locus notch-like protein 1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
RGD|3187 Notch1 "notch 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07008 Notch1 "Neurogenic locus notch homolog protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97363 Notch1 "notch 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P46531 NOTCH1 "Neurogenic locus notch homolog protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W737 Gga.54229 "NOTCH-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS51 NOTCH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSM3 NOTCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDC7 NOTCH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P07207NOTCH_DROMENo assigned EC number0.52380.53500.0310yesN/A
P46531NOTC1_HUMANNo assigned EC number0.51540.58590.0360yesN/A
Q01705NOTC1_MOUSENo assigned EC number0.52570.58590.0363yesN/A
Q07008NOTC1_RATNo assigned EC number0.52570.58590.0363yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-04
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 38.9 bits (91), Expect = 2e-04
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 31  VDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIE 90
           ++ V LL     ++NA+ +DG TPL LAA+     +V+ L+              T    
Sbjct: 20  LEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDKDGNTPLHL 79

Query: 91  HVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLI 142
              N  + ++     +LL++ A ++NAR  DG TPL LAA+     +V+ L+
Sbjct: 80  AARNGNLDVVK----LLLKHGA-DVNARDKDGRTPLHLAAKNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG4412|consensus226 99.91
KOG4412|consensus226 99.9
PHA02791284 ankyrin-like protein; Provisional 99.87
KOG0509|consensus 600 99.84
PHA02859209 ankyrin repeat protein; Provisional 99.83
PHA02791284 ankyrin-like protein; Provisional 99.83
PHA02878 477 ankyrin repeat protein; Provisional 99.82
PHA03100 480 ankyrin repeat protein; Provisional 99.82
PHA02875 413 ankyrin repeat protein; Provisional 99.82
PHA02878 477 ankyrin repeat protein; Provisional 99.82
PHA02875 413 ankyrin repeat protein; Provisional 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02874 434 ankyrin repeat protein; Provisional 99.81
PHA02874 434 ankyrin repeat protein; Provisional 99.81
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.81
PHA03100 480 ankyrin repeat protein; Provisional 99.78
PHA02946 446 ankyin-like protein; Provisional 99.78
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.78
KOG0509|consensus 600 99.78
PHA02876 682 ankyrin repeat protein; Provisional 99.78
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.78
PHA03095 471 ankyrin-like protein; Provisional 99.77
PHA03095 471 ankyrin-like protein; Provisional 99.77
KOG0510|consensus 929 99.77
PHA02798 489 ankyrin-like protein; Provisional 99.76
PHA02946 446 ankyin-like protein; Provisional 99.76
PHA02989 494 ankyrin repeat protein; Provisional 99.76
PHA02859209 ankyrin repeat protein; Provisional 99.76
PHA02798 489 ankyrin-like protein; Provisional 99.75
PHA02741169 hypothetical protein; Provisional 99.75
KOG0508|consensus 615 99.74
KOG0502|consensus296 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
PHA02884 300 ankyrin repeat protein; Provisional 99.72
PHA02795 437 ankyrin-like protein; Provisional 99.72
PHA02876 682 ankyrin repeat protein; Provisional 99.72
PHA02989 494 ankyrin repeat protein; Provisional 99.71
PHA02730 672 ankyrin-like protein; Provisional 99.69
PHA02741169 hypothetical protein; Provisional 99.69
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.69
PHA02736154 Viral ankyrin protein; Provisional 99.68
KOG0512|consensus228 99.68
PHA02743166 Viral ankyrin protein; Provisional 99.68
PHA02795 437 ankyrin-like protein; Provisional 99.67
KOG4177|consensus 1143 99.66
PHA02917 661 ankyrin-like protein; Provisional 99.65
KOG0195|consensus 448 99.65
PHA02917 661 ankyrin-like protein; Provisional 99.64
KOG0195|consensus 448 99.64
KOG0505|consensus 527 99.63
KOG0502|consensus296 99.63
PHA02884 300 ankyrin repeat protein; Provisional 99.63
KOG4177|consensus 1143 99.63
KOG0508|consensus 615 99.62
PHA02736154 Viral ankyrin protein; Provisional 99.61
KOG0514|consensus452 99.59
KOG0510|consensus 929 99.57
PHA02730 672 ankyrin-like protein; Provisional 99.56
KOG4214|consensus117 99.53
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.48
PHA02792 631 ankyrin-like protein; Provisional 99.47
PHA02792 631 ankyrin-like protein; Provisional 99.46
KOG0512|consensus228 99.44
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.42
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.38
KOG0514|consensus452 99.37
KOG0505|consensus 527 99.35
KOG0507|consensus 854 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.31
KOG4214|consensus117 99.29
KOG0507|consensus 854 99.28
KOG0515|consensus 752 99.22
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.2
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.17
KOG3676|consensus 782 99.14
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.12
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.09
KOG3676|consensus 782 99.07
KOG1710|consensus 396 99.05
KOG0515|consensus752 98.97
KOG4369|consensus 2131 98.94
KOG1710|consensus 396 98.92
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.89
PF1360630 Ank_3: Ankyrin repeat 98.86
KOG0506|consensus622 98.76
KOG4369|consensus 2131 98.74
KOG0818|consensus 669 98.65
KOG0782|consensus1004 98.46
KOG0783|consensus 1267 98.43
KOG0705|consensus749 98.33
KOG0522|consensus 560 98.32
KOG0783|consensus 1267 98.31
PF1360630 Ank_3: Ankyrin repeat 98.2
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.19
KOG0705|consensus749 98.08
KOG0782|consensus1004 97.99
KOG0520|consensus 975 97.91
KOG0818|consensus 669 97.88
KOG3609|consensus 822 97.86
KOG0511|consensus 516 97.79
KOG2384|consensus 223 97.79
KOG0506|consensus622 97.76
KOG0522|consensus 560 97.68
KOG0521|consensus785 97.64
KOG0521|consensus785 97.4
KOG0511|consensus 516 97.37
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.25
KOG2384|consensus 223 96.97
KOG0520|consensus 975 96.66
KOG2505|consensus591 96.12
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.84
KOG3609|consensus 822 95.23
KOG2505|consensus 591 95.21
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.64
>KOG4412|consensus Back     alignment and domain information 
Probab=99.91  E-value=2.9e-24  Score=151.57  Aligned_cols=144  Identities=20%  Similarity=0.120  Sum_probs=72.4

Q ss_pred             CccCC-CCchhhhhhhcccchhhHhH------------------------hhhhhhhHHHHHhc-CCCcccccCCCCcHH
Q psy6362           2 NVVGS-PGLHDWFWTLGIEHVCNVLV------------------------ILITVDDVILLRNR-ATNLNARMHDGTTPL   55 (157)
Q Consensus         2 ~~~~~-~~~~~~~~~~~~~~~~~~~~------------------------~~~~~~~~~~Ll~~-g~~i~~~~~~g~t~L   55 (157)
                      |...+ .|.+++.|+.+|.|+-.+-.                        .....++++.|+.+ |+++|..+..|+|+|
T Consensus        31 ~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~L  110 (226)
T KOG4412|consen   31 NARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCL  110 (226)
T ss_pred             hccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCccee
Confidence            44445 78888888876654321111                        01122344444444 555555555555555


Q ss_pred             HHHHHhCCHHHHHHHHHcC-----CCCCChhHHHHHHhcCCcceehhhhccchhHHhhhcCCCCCccCCCCCCcHHHHHH
Q psy6362          56 ILAARLAIEGMVEDLINDF-----VCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAA  130 (157)
Q Consensus        56 h~a~~~~~~~~~~~Ll~~~-----~~~~~~t~l~~a~~~~~~~~v~~~~~~~~~~~ll~~~~~~~~~~~~~g~tpl~~A~  130 (157)
                      |||+..|+.+++++|++.|     +|..+.||||.|+..|..+++         ++|+..++ .+|.+|..|+||||.|.
T Consensus       111 HyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvi---------e~Li~~~a-~~n~qDk~G~TpL~~al  180 (226)
T KOG4412|consen  111 HYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVI---------EYLISQGA-PLNTQDKYGFTPLHHAL  180 (226)
T ss_pred             hhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhH---------HHHHhcCC-CCCcccccCccHHHHHH
Confidence            5555555555555555544     444455555555555555555         55555554 55555555555555554


Q ss_pred             HhCCHHHHHHHHHcCCCcceeccCC
Q psy6362         131 RLAIEGMVEDLINFFVHIFFKENIN  155 (157)
Q Consensus       131 ~~~~~~~~~~Ll~~ga~~~~~~~~g  155 (157)
                      ..++.++...|+++||++...|++|
T Consensus       181 ~e~~~d~a~lLV~~gAd~~~edke~  205 (226)
T KOG4412|consen  181 AEGHPDVAVLLVRAGADTDREDKEG  205 (226)
T ss_pred             hccCchHHHHHHHhccceeeccccC
Confidence            4445555555555555555544443

>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-15
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 7e-14
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-13
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-13
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-13
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-13
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 8e-13
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 1e-12
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure 
Iteration: 1

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 66/128 (51%), Gaps = 21/128 (16%)
Query: 38  RNRATNLNARMHDGTTPLILAARLAIEGMVEDLIN--------DFVCSPGLHDWFWTLGI 89
           RNRATNLNARMHDGTTPLILAARLAIEGMVEDLI         D      LH W   +  
Sbjct: 105 RNRATNLNARMHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALH-WAAAVNN 163
Query: 90  EHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIF 149
               N+L++               N +A+     TPL LAAR       + L++ F +  
Sbjct: 164 TEAVNILLM------------HHANRDAQDDKDETPLFLAAREGSYEASKALLDNFANRE 211
Query: 150 FKENINKF 157
             +++++ 
Sbjct: 212 ITDHMDRL 219
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-04
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-04
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
 Score = 53.6 bits (130), Expect = 1e-09
 Identities = 41/109 (37%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 35  ILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDFVCSPGLHDWFWTLGIEHVCN 94
           IL+RNRAT+L+ARMHDGTTPLILAARLA+EGM+EDLIN                      
Sbjct: 108 ILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLIN---------------------- 145

Query: 95  VLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLIN 143
                          + A ++NA    G + L  AA +        L+ 
Sbjct: 146 ---------------SHA-DVNAVDDLGKSALHWAAAVNNVDAAVVLLK 178
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.89
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.89
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.89
3hra_A201 Ankyrin repeat family protein; structural protein; 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.89
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.89
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.89
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.89
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.89
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.88
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.88
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.88
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.88
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.88
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.88
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.88
2rfa_A232 Transient receptor potential cation channel subfa 99.88
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.88
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.88
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.87
2rfa_A232 Transient receptor potential cation channel subfa 99.87
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.87
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.87
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.87
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.87
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.87
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.87
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.86
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.86
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.86
2etb_A256 Transient receptor potential cation channel subfam 99.86
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.86
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.86
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.86
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.86
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.85
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.85
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.85
2pnn_A273 Transient receptor potential cation channel subfa 99.85
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.85
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.85
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.85
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.85
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.84
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.84
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.84
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.84
3hra_A201 Ankyrin repeat family protein; structural protein; 99.84
2etb_A256 Transient receptor potential cation channel subfam 99.84
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.84
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.84
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.83
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.83
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.83
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.82
2pnn_A273 Transient receptor potential cation channel subfa 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.82
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.82
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.82
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.81
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.8
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.79
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.79
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.79
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.78
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.78
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.78
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.77
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.77
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.75
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.64
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.64
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.62
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.6
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.59
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.58
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.58
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.48
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.44
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.94  E-value=2.7e-26  Score=163.04  Aligned_cols=128  Identities=27%  Similarity=0.191  Sum_probs=73.5

Q ss_pred             CccCCCCchhhhhhhcccchhhHhHhhhhhhhHHHHHhcCCCcccccCCCCcHHHHHHHhCCHHHHHHHHHcC-----CC
Q psy6362           2 NVVGSPGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDF-----VC   76 (157)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~g~~i~~~~~~g~t~Lh~a~~~~~~~~~~~Ll~~~-----~~   76 (157)
                      |..++.|.++++++          +.....++++.|++.|++++.+|..|+||||+|+..|+.+++++|++.|     ++
T Consensus        31 n~~d~~g~t~l~~a----------~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d  100 (169)
T 4gpm_A           31 NASDSDGRTPLHHA----------AENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKD  100 (169)
T ss_dssp             TCCCTTSCCHHHHH----------HHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCC
T ss_pred             CCcCCCCCCHHHHH----------HHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCC
Confidence            44445555554443          3344455555566666666666666666666666666666666666655     45


Q ss_pred             CCChhHHHHHHhcCCcceehhhhccchhHHhhhcCCCCCccCCCCCCcHHHHHHHhCCHHHHHHHHHcCCCcc
Q psy6362          77 SPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIF  149 (157)
Q Consensus        77 ~~~~t~l~~a~~~~~~~~v~~~~~~~~~~~ll~~~~~~~~~~~~~g~tpl~~A~~~~~~~~~~~Ll~~ga~~~  149 (157)
                      ..|.||||+|+..++.+++         ++|++.|+ +++.+|.+|.|||++|+..|+.+++++|+++||+++
T Consensus       101 ~~G~TpLh~A~~~g~~~~v---------~~Ll~~ga-d~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~ie  163 (169)
T 4gpm_A          101 SDGRTPLHHAAENGHKEVV---------KLLISKGA-DVNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLE  163 (169)
T ss_dssp             TTSCCHHHHHHHTTCHHHH---------HHHHHTTC-CTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC-----
T ss_pred             CCCCCHHHHHHHcCCHHHH---------HHHHHcCC-CccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCcC
Confidence            5566666666666666666         66666666 666666666666666666666666666666666554
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: RNase L, 2-5a-dependent ribonuclease
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.6 bits (91), Expect = 6e-05
 Identities = 27/136 (19%), Positives = 47/136 (34%)

Query: 7   PGLHDWFWTLGIEHVCNVLVILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGM 66
            G   +        V  +  +     +V L R    +       G T L+ AA      +
Sbjct: 104 YGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEV 163

Query: 67  VEDLINDFVCSPGLHDWFWTLGIEHVCNVLVILITDDDVILLRNRATNLNARMHDGTTPL 126
           ++ L+++        D      + H          +    LL +   ++N R   G TPL
Sbjct: 164 LKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPL 223

Query: 127 ILAARLAIEGMVEDLI 142
           ILA      G+V+ L+
Sbjct: 224 ILAVEKKHLGLVQRLL 239
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.88
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.82
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.8
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.8
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.78
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.78
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.77
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.74
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.72
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.72
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.7
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.69
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.68
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.68
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.63
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.59
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.54
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.52
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.48
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.34
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=3.5e-22  Score=144.90  Aligned_cols=120  Identities=21%  Similarity=0.134  Sum_probs=113.3

Q ss_pred             hhhhhhhHHHHHhcCCCcccccCCCCcHHHHHHHhCCHHHHHHHHHcC-----CCCCChhHHHHHHhcCCcceehhhhcc
Q psy6362          27 ILITVDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINDF-----VCSPGLHDWFWTLGIEHVCNVLVILIT  101 (157)
Q Consensus        27 ~~~~~~~~~~Ll~~g~~i~~~~~~g~t~Lh~a~~~~~~~~~~~Ll~~~-----~~~~~~t~l~~a~~~~~~~~v~~~~~~  101 (157)
                      .....+++++|+++|++++.+|..|.||||+|+..++.+++++|++.|     ++..+.||+|+++..++...+      
T Consensus        79 ~~~~~~i~~~Ll~~~~d~~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~g~d~~~~~~~~~t~L~~a~~~~~~~~~------  152 (223)
T d1uoha_          79 SAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMI------  152 (223)
T ss_dssp             HHTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHH------
T ss_pred             cccccchhHHHhccCceeEeeCCCCCchhhHHHHcCCHHHHHHHHHCCCCCCCcCCCCCccchhhhhcCCcchh------
Confidence            345678999999999999999999999999999999999999999988     678899999999999999999      


Q ss_pred             chhHHhhhcCCCCCccCCCCCCcHHHHHHHhCCHHHHHHHHHcCCCcceeccCCC
Q psy6362         102 DDDVILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLINFFVHIFFKENINK  156 (157)
Q Consensus       102 ~~~~~ll~~~~~~~~~~~~~g~tpl~~A~~~~~~~~~~~Ll~~ga~~~~~~~~g~  156 (157)
                         +++...+. +++.+|.+|.||||.|+..++.+++++|+++|++++.+|..|+
T Consensus       153 ---~~L~~~~~-~i~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~Gad~~~~d~~g~  203 (223)
T d1uoha_         153 ---HILLYYKA-STNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEK  203 (223)
T ss_dssp             ---HHHHHTTC-CSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCTTSC
T ss_pred             ---hhhccccc-eeeeccCCCCceeccccccCcHHHHHHHHHCCCCCCCCCCCCC
Confidence               99999999 9999999999999999999999999999999999999999886
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure