Psyllid ID: psy6405


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MQREQFGSITSIASSTSLISQQELQQLIDESNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNALEYIKTRDLNALRYPKTQDLNALEYPKTQDLNALGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALGHPESPKTRDLNALLWNTF
ccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccEEEEcccccccccEEEEEEccccHHccccccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEcccccccEEEEcccccccccccEEEEEcccccHHHHccccccccEEEEEcccccccccHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccc
ccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccEEEEEcccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEccccccEEEEcccccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHcccccccccccccccccccHHHcccEEccccccHHHcccccccccccccccEcccccccHHHHcccccccHHHHccccccccccccccccccHHHHHHHcccHHHcccccccccccccccccHHHHHHHHcccHHHcccccccccccccccccHHHHHHHHcccHHHcccccccccccccccccHHHHHHHHcccHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcc
mqreqfgsitsiasstsLISQQELQQLIDEsnqsldeggcpsllipgtseVSVVVLHrdlpgnsvgitlaggsdyeskeiTVHKVisgtpadrdgrlqkgdrilsingksmkglthkeslailkrgppveitlikdgaglgfsleggkdspfgdqpltvkkiftggcaekngqlkagdeiltinnvpvteMSRIEAWSLLKKLNDGTIQDIKALGydlnslgyprtqdlnalgypktrdlnALEYIKTRDLNALEYIKTrdlnalrypktqdlnaleypktqdlnalghpktqdlnalghpktqDLNALIQDLNAlgydlnalghpktqdLNALGYKILNaleypksqdlnalgypktqdlnvleypktrdlnalrypktqdlnalghpktqdlndtrfeypkiqdlnalgydlnalghpktqdlndtrfeypkiqdlnalgydlnalghpktqdlndtrfeypkiqdlnalgydlnalghpktqdlndtrfeypkiqdlnalgydlnalghpktqdLNAIGYKILNalghpespktrDLNALLWNTF
mqreqfgsitsiasstslISQQELQQLIDESNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITlaggsdyeskEITVHKvisgtpadrdgrlqkgdrilsingksmkglthkeslailkrgppVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAekngqlkagdeiltinnvpvtEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNAleyiktrdlnalryPKTQDLNALEYPKTQDLNALGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALgypktqdlnvlEYPKTRDLNALRypktqdlnalghpktqdlNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNalghpespktrdlnALLWNTF
MQREQFGsitsiasstslisqqelqqlidesNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNALEYIKTRDLNALRYPKTQDLNALEYPKTQDLNALGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALGHPESPKTRDLNALLWNTF
***************************************CPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVI*******************************ESLAILKRGPPVEITLIKDGAGLGFSLEGG****FGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNALEYIKTRDLNALRYPKTQDLNALEYP***********************TQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNAL*******LNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALG************LL****
***********************************************TSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEIT*I**********************LTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDL************************************************************************************************************************************************************************************************************************************************************************************************************************************LLWN**
**********SIASSTSLISQQELQQLIDESNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNALEYIKTRDLNALRYPKTQDLNALEYPKTQDLNALGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALGHPESPKTRDLNALLWNTF
*******************************************LIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGY**********************************************************************LGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALGHPESPKTRDLNALLWNTF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQREQFGSITSIASSTSLISQQELQQLIDESNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALGYDLNSLGYPRTQDLNALGYPKTRDLNALEYIKTRDLNALEYIKTRDLNALRYPKTQDLNALEYPKTQDLNALGHPKTQDLNALGHPKTQDLNALIQDLNALGYDLNALGHPKTQDLNALGYKILNALEYPKSQDLNALGYPKTQDLNVLEYPKTRDLNALRYPKTQDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNDTRFEYPKIQDLNALGYDLNALGHPKTQDLNAIGYKILNALGHPESPKTRDLNALLWNTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query548 2.2.26 [Sep-21-2011]
O62676630 Pro-interleukin-16 OS=Mac N/A N/A 0.348 0.303 0.370 2e-32
O62674631 Pro-interleukin-16 OS=Chl N/A N/A 0.343 0.297 0.375 2e-32
O62675630 Pro-interleukin-16 OS=Mac yes N/A 0.343 0.298 0.375 3e-32
O62666631 Pro-interleukin-16 OS=Pan yes N/A 0.354 0.307 0.369 5e-32
Q0V8R5627 Pro-interleukin-16 OS=Bos yes N/A 0.377 0.330 0.370 6e-32
Q140051332 Pro-interleukin-16 OS=Hom no N/A 0.354 0.145 0.369 1e-31
O62678632 Pro-interleukin-16 OS=Aot N/A N/A 0.343 0.297 0.370 2e-31
O62677627 Pro-interleukin-16 OS=Sai N/A N/A 0.343 0.299 0.370 4e-31
O548241322 Pro-interleukin-16 OS=Mus yes N/A 0.339 0.140 0.380 1e-30
O150182839 PDZ domain-containing pro no N/A 0.290 0.056 0.334 1e-25
>sp|O62676|IL16_MACFA Pro-interleukin-16 OS=Macaca fascicularis GN=IL16 PE=3 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 132/243 (54%), Gaps = 52/243 (21%)

Query: 14  SSTSLISQQELQQLIDESNQSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGS 73
           S  SL+S +EL+QLI+E  + LDE     L       + V +LH++  G  +G +LAGG+
Sbjct: 378 SVISLLSSEELKQLIEEV-KVLDEATLKQL-----DSIHVTILHKEE-GAGLGFSLAGGA 430

Query: 74  DYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILKRG-PPVE-- 130
           D E+K ITVHKV     A ++G +QKG+ +LSINGKS+KG TH ++LAIL++   P +  
Sbjct: 431 DLENKVITVHKVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHNDALAILRQAREPRQAV 490

Query: 131 ------------------------------------------ITLIKDGAGLGFSLEGGK 148
                                                     +TL K  AGLGFSLEGGK
Sbjct: 491 IVTRKLTAESMPDLNSTTDSAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGK 550

Query: 149 DSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTI 208
            S  GD+PLT+ +IF G  +E++  ++ GDEIL +    +  ++R EAW+++K L DG +
Sbjct: 551 GSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPV 610

Query: 209 QDI 211
             +
Sbjct: 611 TTV 613




Pro-interleukin-16 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.
Macaca fascicularis (taxid: 9541)
>sp|O62674|IL16_CHLAE Pro-interleukin-16 OS=Chlorocebus aethiops GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|O62675|IL16_MACMU Pro-interleukin-16 OS=Macaca mulatta GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|O62666|IL16_PANTR Pro-interleukin-16 OS=Pan troglodytes GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|Q0V8R5|IL16_BOVIN Pro-interleukin-16 OS=Bos taurus GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|Q14005|IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens GN=IL16 PE=1 SV=4 Back     alignment and function description
>sp|O62678|IL16_AOTTR Pro-interleukin-16 OS=Aotus trivirgatus GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|O62677|IL16_SAISC Pro-interleukin-16 OS=Saimiri sciureus GN=IL16 PE=2 SV=1 Back     alignment and function description
>sp|O54824|IL16_MOUSE Pro-interleukin-16 OS=Mus musculus GN=Il16 PE=1 SV=3 Back     alignment and function description
>sp|O15018|PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens GN=PDZD2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query548
242004702 918 conserved hypothetical protein [Pediculu 0.375 0.224 0.544 6e-66
328722578 1187 PREDICTED: hypothetical protein LOC10016 0.374 0.172 0.568 7e-65
307197719 1380 Interleukin-16 [Harpegnathos saltator] 0.357 0.142 0.524 2e-56
241156201 957 PDZ-containing protein, putative [Ixodes 0.364 0.208 0.475 2e-56
307172398 1555 Interleukin-16 [Camponotus floridanus] 0.357 0.126 0.528 2e-56
383852080 1396 PREDICTED: uncharacterized protein LOC10 0.357 0.140 0.524 3e-55
350415387 1455 PREDICTED: hypothetical protein LOC10074 0.357 0.134 0.516 9e-55
340710900 1454 PREDICTED: hypothetical protein LOC10064 0.357 0.134 0.516 1e-54
345487742 1409 PREDICTED: hypothetical protein LOC10012 0.357 0.139 0.509 1e-54
328789728 1381 PREDICTED: hypothetical protein LOC72589 0.357 0.141 0.513 5e-54
>gi|242004702|ref|XP_002423218.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506189|gb|EEB10480.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  258 bits (659), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 169/259 (65%), Gaps = 53/259 (20%)

Query: 3   REQFGSITSIASSTSLISQQELQQLIDESNQSLDEGG-CPSLLIPGTSEVSVVVLHRDLP 61
           REQFGSITS+ASSTSLIS QELQ L++E+NQ+L+E G     L     +V V++LHRD  
Sbjct: 648 REQFGSITSLASSTSLISPQELQLLLEEANQTLEESGNVGGGLNTNNHDVLVIILHRDTV 707

Query: 62  GNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLA 121
           G S+GITLAGG+DYESKEITVHKV++G+PADRDGR+QKGDRILSINGKSMKG    E + 
Sbjct: 708 GGSIGITLAGGADYESKEITVHKVLAGSPADRDGRIQKGDRILSINGKSMKGSPRLEVVL 767

Query: 122 ILK----------------------------------------------------RGPPV 129
           ++                                                     RGPPV
Sbjct: 768 VVSRLKSDILTDCINSDDSNGINNSIRQHSMVRAGRMLKKSTLLESDESSFCQTARGPPV 827

Query: 130 EITLIKDGAGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVT 189
            +TL+KDGAGLGFSLEGGKD   GD+PL +KKIFTGG AEK GQLKAGDE+L IN + V+
Sbjct: 828 SLTLVKDGAGLGFSLEGGKDCSTGDKPLVIKKIFTGGAAEKCGQLKAGDELLNINGMDVS 887

Query: 190 EMSRIEAWSLLKKLNDGTI 208
            MSRIEAW L+K+L DG +
Sbjct: 888 IMSRIEAWKLMKQLPDGNV 906




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328722578|ref|XP_001951758.2| PREDICTED: hypothetical protein LOC100166850 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307197719|gb|EFN78868.1| Interleukin-16 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|241156201|ref|XP_002407719.1| PDZ-containing protein, putative [Ixodes scapularis] gi|215494210|gb|EEC03851.1| PDZ-containing protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307172398|gb|EFN63864.1| Interleukin-16 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383852080|ref|XP_003701557.1| PREDICTED: uncharacterized protein LOC100882911 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350415387|ref|XP_003490623.1| PREDICTED: hypothetical protein LOC100747974 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340710900|ref|XP_003394021.1| PREDICTED: hypothetical protein LOC100649322 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345487742|ref|XP_001606112.2| PREDICTED: hypothetical protein LOC100122506 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328789728|ref|XP_001121687.2| PREDICTED: hypothetical protein LOC725893 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query548
FB|FBgn00870072637 bbg "big bang" [Drosophila mel 0.178 0.037 0.558 2.4e-40
UNIPROTKB|Q76EI9635 IL-16 "Interleukin 16" [Sus sc 0.142 0.122 0.512 4.1e-29
UNIPROTKB|K7GNX8636 IL16 "Uncharacterized protein" 0.142 0.122 0.512 4.1e-29
UNIPROTKB|K7GQ541338 IL16 "Uncharacterized protein" 0.142 0.058 0.512 3.5e-28
UNIPROTKB|Q0V8R5627 IL16 "Pro-interleukin-16" [Bos 0.135 0.118 0.493 5.1e-28
UNIPROTKB|F1PNI81329 IL16 "Uncharacterized protein" 0.142 0.058 0.487 2.1e-27
UNIPROTKB|F1NZM4607 IL16 "Uncharacterized protein" 0.180 0.163 0.4 4.3e-27
UNIPROTKB|F1N1J21327 IL16 "Interleukin-16" [Bos tau 0.135 0.055 0.493 4.3e-27
UNIPROTKB|Q140051332 IL16 "Pro-interleukin-16" [Hom 0.142 0.058 0.474 4.4e-27
UNIPROTKB|F1NZM0690 IL16 "Uncharacterized protein" 0.180 0.143 0.4 6.6e-27
FB|FBgn0087007 bbg "big bang" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 292 (107.8 bits), Expect = 2.4e-40, Sum P(2) = 2.4e-40
 Identities = 57/102 (55%), Positives = 78/102 (76%)

Query:    33 QSLDEGGCPSLLIPGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPAD 92
             Q + E   P L  P   E  ++VL R+ P +S+GITLAGGSDYE+KEIT+HK++S TPA 
Sbjct:  2315 QQIVEEADPPLKTP---EAFIIVLQRENPESSIGITLAGGSDYEAKEITIHKILSNTPAA 2371

Query:    93 RDGRLQKGDRILSINGKSMKGLTHKESLAILKRGPPVEITLI 134
             +DGRL+KGDRIL++NG SM+GLTH+ES+++LK   P E+ L+
Sbjct:  2372 KDGRLKKGDRILAVNGMSMRGLTHRESISVLKTPRP-EVVLV 2412


GO:0007444 "imaginal disc development" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
UNIPROTKB|Q76EI9 IL-16 "Interleukin 16" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GNX8 IL16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQ54 IL16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8R5 IL16 "Pro-interleukin-16" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNI8 IL16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZM4 IL16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1J2 IL16 "Interleukin-16" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14005 IL16 "Pro-interleukin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZM0 IL16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query548
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 8e-20
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-17
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 1e-15
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-14
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-12
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-11
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-09
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 6e-09
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 4e-07
pfam1318081 pfam13180, PDZ_2, PDZ domain 6e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-06
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 2e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 3e-05
TIGR03900 973 TIGR03900, prc_long_Delta, putative carboxyl-termi 4e-05
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 4e-05
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 4e-05
TIGR00225334 TIGR00225, prc, C-terminal peptidase (prc) 2e-04
cd0099179 cd00991, PDZ_archaeal_metalloprotease, PDZ domain 2e-04
TIGR00054419 TIGR00054, TIGR00054, RIP metalloprotease RseP 0.001
PLN00049389 PLN00049, PLN00049, carboxyl-terminal processing p 0.003
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.004
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 83.4 bits (207), Expect = 8e-20
 Identities = 37/83 (44%), Positives = 52/83 (62%), Gaps = 4/83 (4%)

Query: 53  VVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMK 112
            V L +D PG  +G +L GG D     I V +V  G PA+R G L+ GDRIL +NG S++
Sbjct: 3   TVTLRKD-PGGGLGFSLRGGKDSGGG-IFVSRVEPGGPAER-GGLRVGDRILEVNGVSVE 59

Query: 113 GLTHKESLAILKR-GPPVEITLI 134
           GLTH+E++ +LK  G  V +T+ 
Sbjct: 60  GLTHEEAVELLKNSGDEVTLTVR 82


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information
>gnl|CDD|238491 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|232801 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 548
KOG3209|consensus984 99.78
KOG3209|consensus984 99.7
PRK10779449 zinc metallopeptidase RseP; Provisional 99.5
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.49
PRK10139455 serine endoprotease; Provisional 99.48
KOG3580|consensus 1027 99.47
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.47
PRK10942473 serine endoprotease; Provisional 99.45
KOG3605|consensus829 99.31
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 99.18
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.16
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.04
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.04
KOG3580|consensus 1027 98.98
PLN00049389 carboxyl-terminal processing protease; Provisional 98.91
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.85
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.74
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.74
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.74
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.66
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.64
KOG3550|consensus207 98.63
KOG3550|consensus207 98.62
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.61
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.58
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.52
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.46
KOG3571|consensus626 98.42
PRK11186667 carboxy-terminal protease; Provisional 98.42
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.38
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.37
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.35
KOG3549|consensus505 98.3
KOG3551|consensus506 98.29
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.27
KOG3549|consensus505 98.25
KOG3553|consensus124 98.24
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.23
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.14
KOG3551|consensus506 98.12
KOG1892|consensus 1629 98.1
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.01
KOG3553|consensus124 98.0
KOG3651|consensus429 97.98
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.97
KOG3571|consensus626 97.95
PRK10779449 zinc metallopeptidase RseP; Provisional 97.92
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.9
PRK10898353 serine endoprotease; Provisional 97.9
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 97.89
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.89
PLN00049389 carboxyl-terminal processing protease; Provisional 97.87
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.83
COG3975558 Predicted protease with the C-terminal PDZ domain 97.8
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.75
KOG1892|consensus 1629 97.72
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.7
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.65
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.65
PRK10139455 serine endoprotease; Provisional 97.61
KOG1421|consensus 955 97.61
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.59
KOG3552|consensus 1298 97.55
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.53
PRK10942473 serine endoprotease; Provisional 97.51
KOG3651|consensus429 97.49
PRK11186667 carboxy-terminal protease; Provisional 97.37
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.34
KOG3129|consensus231 97.34
KOG3606|consensus358 97.29
KOG3542|consensus 1283 97.24
KOG0609|consensus542 97.05
PRK09681276 putative type II secretion protein GspC; Provision 97.02
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.0
KOG4371|consensus1332 96.98
KOG1421|consensus955 96.96
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.96
TIGR01713259 typeII_sec_gspC general secretion pathway protein 96.95
KOG3938|consensus334 96.85
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 96.79
PRK10898353 serine endoprotease; Provisional 96.73
KOG3606|consensus358 96.66
KOG3552|consensus 1298 96.66
KOG3542|consensus 1283 96.58
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.52
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.48
KOG3834|consensus462 96.46
KOG0609|consensus542 96.44
KOG3605|consensus829 96.31
KOG3938|consensus334 96.19
KOG4407|consensus 1973 96.12
KOG1320|consensus473 95.68
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 95.18
KOG3129|consensus231 95.1
COG3480342 SdrC Predicted secreted protein containing a PDZ d 94.68
KOG0606|consensus1205 94.49
COG3031275 PulC Type II secretory pathway, component PulC [In 94.47
KOG0606|consensus 1205 94.08
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 93.92
KOG1738|consensus638 93.57
KOG1320|consensus473 93.54
PRK09681276 putative type II secretion protein GspC; Provision 93.17
KOG3532|consensus 1051 93.11
COG0265347 DegQ Trypsin-like serine proteases, typically peri 92.38
KOG1738|consensus638 91.74
KOG3532|consensus 1051 91.38
COG3975558 Predicted protease with the C-terminal PDZ domain 89.89
PF1281278 PDZ_1: PDZ-like domain 89.73
COG0750375 Predicted membrane-associated Zn-dependent proteas 89.27
COG3031275 PulC Type II secretory pathway, component PulC [In 87.52
COG3480342 SdrC Predicted secreted protein containing a PDZ d 85.49
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 80.57
>KOG3209|consensus Back     alignment and domain information
Probab=99.78  E-value=2.3e-18  Score=188.64  Aligned_cols=160  Identities=31%  Similarity=0.542  Sum_probs=135.1

Q ss_pred             CCeEEEEEeeCCCCCceEEEEEeCCCCCCCCeEEEEEcCCChhhhcCCCCCCCEEEEECCeeccCccHHHHHHHhh----
Q psy6405          49 SEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILK----  124 (548)
Q Consensus        49 ~d~~tV~L~Kd~~~~GLGfsIagG~d~~~~gVvVs~V~pGSPAaqAGrLq~GDrILaINGv~V~~~s~~~aV~~lk----  124 (548)
                      ..++.|+|+|. +++||||.|......+..+  |..|.+||||+++|+|++||+|++|||.+|.+++|.+.+..++    
T Consensus       752 ~~~yDV~lhR~-ENeGFGFVi~sS~~kp~sg--iGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIKdaGl  828 (984)
T KOG3209|consen  752 SGPYDVVLHRK-ENEGFGFVIMSSQNKPESG--IGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIKDAGL  828 (984)
T ss_pred             CCCeeeEEecc-cCCceeEEEEecccCCCCC--ccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHHhcCc
Confidence            44789999998 5999999998766544333  9999999999999999999999999999999999999762211    


Q ss_pred             -------------------------------------------------------------------CCCCeEEEEEecC
Q psy6405         125 -------------------------------------------------------------------RGPPVEITLIKDG  137 (548)
Q Consensus       125 -------------------------------------------------------------------~g~~VtVtV~RdG  137 (548)
                                                                                         .+.-++|++.|..
T Consensus       829 sVtLtIip~ee~~~~~~~~sa~~~s~~t~~~~~~q~~glp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelErG~  908 (984)
T KOG3209|consen  829 SVTLTIIPPEEAGPPTSMTSAEKQSPFTQNGPYEQQYGLPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELERGA  908 (984)
T ss_pred             eEEEEEcChhccCCCCCCcchhhcCcccccCCHhHccCCCCCCccccccCCCCccccceeccccccccCCeeEEEeeccc
Confidence                                                                               1223788889999


Q ss_pred             cceeEEEecCCCCCCCCCCeEEEEeccCChhhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHHHHcCCCceeEEEEec
Q psy6405         138 AGLGFSLEGGKDSPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKLNDGTIQDIKALG  215 (548)
Q Consensus       138 kgLGfSItgg~~s~lG~~gI~VssV~pgSpAekaGrLq~GDrILaVNGvsV~~~t~~EavelLrs~~g~~V~LlV~Ri  215 (548)
                      +++||+|.++++.   .++++|-.+.+.+||.+.||+++||+|++|||.++.+++|..+.++|++- +..+.++..|+
T Consensus       909 kGFGFSiRGGrey---nM~LfVLRlAeDGPA~rdGrm~VGDqi~eINGesTkgmtH~rAIelIk~g-g~~vll~Lr~g  982 (984)
T KOG3209|consen  909 KGFGFSIRGGREY---NMDLFVLRLAEDGPAIRDGRMRVGDQITEINGESTKGMTHDRAIELIKQG-GRRVLLLLRRG  982 (984)
T ss_pred             cccceEeeccccc---ccceEEEEeccCCCccccCceeecceEEEecCcccCCCcHHHHHHHHHhC-CeEEEEEeccC
Confidence            9999999999654   35799999999999999999999999999999999999999999999985 55555555443



>KOG3209|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query548
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 2e-17
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-04
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 3e-17
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 6e-17
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-16
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 6e-09
1i16_A130 Structure Of Interleukin 16: Implications For Funct 5e-15
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 3e-14
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 1e-06
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 5e-11
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 4e-10
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 4e-10
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 5e-10
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 7e-10
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 7e-10
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-09
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 1e-09
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 1e-09
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-09
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-09
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 3e-09
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 2e-05
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 3e-09
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 3e-09
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 6e-09
1kef_A93 Pdz1 Of Sap90 Length = 93 6e-09
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 7e-09
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 3e-06
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-09
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 8e-09
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 1e-08
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 4e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 1e-08
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 3e-05
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-08
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 6e-05
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 3e-08
4amh_A106 Influence Of Circular Permutation On The Folding Pa 4e-08
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 5e-08
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-08
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 6e-08
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 6e-08
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 3e-06
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 8e-08
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 9e-08
1v6b_A118 Solution Structure Of The Third Pdz Domain Of Mouse 1e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 2e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 4e-04
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 2e-07
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 3e-07
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 7e-07
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 3e-07
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 1e-06
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-06
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 2e-04
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 1e-06
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 1e-06
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 1e-06
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 1e-06
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 2e-04
2djt_A104 Solution Structures Of The Pdz Domain Of Human Unna 1e-06
2djt_A104 Solution Structures Of The Pdz Domain Of Human Unna 1e-04
1wi4_A109 Solution Structure Of The Pdz Domain Of Syntaxin Bi 2e-06
2h2c_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Der 2e-06
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 3e-06
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 4e-06
2h2b_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-der 4e-06
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 4e-06
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 5e-06
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 5e-06
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 5e-06
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 5e-06
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 5e-06
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-06
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 6e-06
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 6e-06
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 6e-06
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 7e-06
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 7e-06
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 3e-04
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 7e-06
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 7e-06
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 7e-06
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 3e-04
2h3m_A97 Crystal Structure Of Zo-1 Pdz1 Length = 97 9e-06
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 9e-06
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 9e-06
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 2e-05
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 7e-04
2rrm_A100 Interplay Between Phosphatidyl-Inositol-Phosphates 2e-05
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 2e-05
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 4e-04
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 2e-05
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 3e-05
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 3e-05
2pdz_A86 Solution Structure Of The Syntrophin Pdz Domain In 3e-05
1z86_A87 Solution Structure Of The Pdz Domain Of Alpha-Syntr 3e-05
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 3e-05
1qav_A90 Unexpected Modes Of Pdz Domain Scaffolding Revealed 3e-05
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 4e-05
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 6e-05
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 7e-04
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 7e-05
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 7e-04
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 7e-05
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 8e-04
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 8e-05
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 9e-05
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 1e-04
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 2e-04
3hpk_A125 Oxidized Dimeric Pick1 Pdz In Complex With The Carb 1e-04
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 1e-04
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 1e-04
2gzv_A114 The Cystal Structure Of The Pdz Domain Of Human Pic 1e-04
2edp_A100 Solution Structure Of The Pdz Domain From Human Shr 2e-04
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 2e-04
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 2e-04
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 2e-04
2pku_A87 Solution Structure Of Pick1 Pdz In Complex With The 2e-04
1ujd_A117 Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of 2e-04
3hpm_A111 Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex W 3e-04
1v62_A117 Solution Structure Of The 3rd Pdz Domain Of Grip2 L 3e-04
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 3e-04
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 3e-04
3qe1_A107 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 7e-04
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 7e-04
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 7e-04
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 8e-04
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 26/182 (14%) Query: 47 GTSEVSVVVLHRDLPGNS-VGITLAGGSDY----ESKEITVHKVISGTPADRDGRLQKGD 101 G E + L R GNS +G ++AGG+D + I + K+I G A +DGRL+ D Sbjct: 56 GEMEYEEITLER---GNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVND 112 Query: 102 RILSINGKSMKGLTHKES------------LAILKRGPP----VEITLIKDGAGLGFSLE 145 IL +N ++ +TH + L +++R PP +EI LIK GLGFS+ Sbjct: 113 SILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIA 172 Query: 146 GGKDSPF--GDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLLKKL 203 GG + GD + V KI GG A K+G+L+ GD+IL +N+V + ++ +A + LK Sbjct: 173 GGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNT 232 Query: 204 ND 205 D Sbjct: 233 YD 234
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1I16|A Chain A, Structure Of Interleukin 16: Implications For Function, Nmr, 20 Structures Length = 130 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1V6B|A Chain A, Solution Structure Of The Third Pdz Domain Of Mouse Harmonin Length = 118 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 Back     alignment and structure
>pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 Back     alignment and structure
>pdb|1WI4|A Chain A, Solution Structure Of The Pdz Domain Of Syntaxin Binding Protein 4 Length = 109 Back     alignment and structure
>pdb|2H2C|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Derived Ligand (Wrrttwv) Length = 107 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|2H2B|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-derived Ligand (wrrttyl) Length = 107 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2H3M|A Chain A, Crystal Structure Of Zo-1 Pdz1 Length = 97 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2RRM|A Chain A, Interplay Between Phosphatidyl-Inositol-Phosphates And Claudins Upon Binding To The 1st Pdz Domain Of Zonula Occludens 1 Length = 100 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|2PDZ|A Chain A, Solution Structure Of The Syntrophin Pdz Domain In Complex With The Peptide Gvkeslv, Nmr, 15 Structures Length = 86 Back     alignment and structure
>pdb|1Z86|A Chain A, Solution Structure Of The Pdz Domain Of Alpha-Syntrophin Length = 87 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|1QAV|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 90 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|3HPK|A Chain A, Oxidized Dimeric Pick1 Pdz In Complex With The Carboxyl Tail Of Glur2 Length = 125 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|2GZV|A Chain A, The Cystal Structure Of The Pdz Domain Of Human Pick1 (Casp Target) Length = 114 Back     alignment and structure
>pdb|2EDP|A Chain A, Solution Structure Of The Pdz Domain From Human Shroom Family Member 4 Length = 100 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>pdb|2PKU|A Chain A, Solution Structure Of Pick1 Pdz In Complex With The Carboxyl Tail Peptide Of Glur2 Length = 87 Back     alignment and structure
>pdb|1UJD|A Chain A, Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of Hypothetical Kiaa0559 Protein From Human Cdna Length = 117 Back     alignment and structure
>pdb|3HPM|A Chain A, Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex With The C Tail Peptide Of Glur2 Length = 111 Back     alignment and structure
>pdb|1V62|A Chain A, Solution Structure Of The 3rd Pdz Domain Of Grip2 Length = 117 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query548
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 9e-52
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-48
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 4e-18
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-45
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-19
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-36
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 7e-17
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-29
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-23
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-29
2xkx_A721 Disks large homolog 4; structural protein, scaffol 5e-15
2xkx_A721 Disks large homolog 4; structural protein, scaffol 1e-14
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-29
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-22
2fne_A117 Multiple PDZ domain protein; structural protein, s 5e-28
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-23
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 7e-28
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-12
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-09
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-27
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-20
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-26
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 4e-20
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-26
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 5e-21
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 7e-26
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-22
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-25
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-21
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-25
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 9e-19
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 3e-25
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-20
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-25
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-24
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-25
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-20
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 4e-25
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 3e-23
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 6e-25
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-16
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-24
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-17
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-24
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-18
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-24
2djt_A104 Unnamed protein product; PDZ domain, structural ge 6e-23
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-24
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 5e-23
2opg_A98 Multiple PDZ domain protein; structural protein, s 6e-24
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-22
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 6e-24
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-19
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-23
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 6e-12
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 8e-09
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-23
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 7e-23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-19
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-23
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 4e-18
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 3e-23
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-21
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 3e-23
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-16
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 4e-23
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 4e-18
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 6e-23
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 4e-22
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 8e-23
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-18
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 9e-23
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-18
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 9e-23
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-17
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-22
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-20
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-22
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 6e-21
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-22
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 6e-22
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-22
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-19
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-22
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 6e-21
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-22
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-17
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-22
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 6e-17
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-22
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-21
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-22
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 5e-20
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-22
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-19
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-22
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-16
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-22
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-21
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-22
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-20
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 4e-22
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-21
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-22
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 7e-21
2byg_A117 Channel associated protein of synapse-110; DLG2, P 5e-22
2byg_A117 Channel associated protein of synapse-110; DLG2, P 8e-22
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 5e-22
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 8e-19
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 6e-22
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-19
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 7e-22
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 9e-19
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 8e-22
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-15
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 8e-22
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 6e-21
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 9e-22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-18
2awx_A105 Synapse associated protein 97; membrane protein, s 9e-22
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-21
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-21
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-21
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-21
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 7e-21
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-21
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-16
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-21
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-21
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-21
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 7e-19
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-21
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-18
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-21
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-20
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-21
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-20
2eeh_A100 PDZ domain-containing protein 7; structural genomi 5e-21
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-16
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 5e-21
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 7e-19
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 5e-21
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 6e-18
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 6e-21
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-20
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-21
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-20
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 9e-21
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-13
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-20
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-20
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-19
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 1e-20
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-19
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-20
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 9e-17
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-20
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-18
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-20
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-16
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 3e-20
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-17
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 4e-20
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 1e-19
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 7e-20
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-17
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 9e-20
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-15
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-19
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-13
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-19
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-17
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-19
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-19
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-16
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-19
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-16
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-19
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 4e-17
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-19
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 4e-19
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-17
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 7e-16
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-19
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-16
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-18
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 6e-12
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-18
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-15
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-18
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-15
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-18
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-16
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-18
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 7e-14
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-18
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 9e-15
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-18
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-15
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-18
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-14
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-18
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-17
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-18
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 4e-16
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 5e-16
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 7e-18
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 4e-15
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 9e-18
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 5e-17
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-17
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 4e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-13
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-17
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-14
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-17
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-14
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-17
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 9e-16
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-17
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 6e-15
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-16
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 3e-13
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-16
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-13
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 8e-12
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 5e-16
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-14
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 5e-16
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 9e-13
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-15
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-15
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-15
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 6e-14
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-15
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 6e-15
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-15
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-12
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-15
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 2e-13
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-15
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-13
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-15
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-10
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-15
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-14
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 6e-15
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 3e-12
2ego_A96 General receptor for phosphoinositides 1- associat 7e-15
2ego_A96 General receptor for phosphoinositides 1- associat 3e-11
2eaq_A90 LIM domain only protein 7; conserved hypothetical 8e-15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-11
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-14
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-12
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-14
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 4e-14
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-14
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 9e-13
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-14
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 9e-14
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-14
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-12
2v90_A96 PDZ domain-containing protein 3; membrane, protein 3e-14
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-13
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-14
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 4e-14
3khf_A99 Microtubule-associated serine/threonine-protein ki 4e-14
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-12
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 5e-14
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-10
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 7e-14
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-11
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 8e-14
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-11
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 9e-14
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-13
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-13
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-13
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 4e-12
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 8e-13
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 7e-11
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-12
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-08
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-12
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 9e-10
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 3e-12
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-10
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 3e-12
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-10
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 6e-12
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-09
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 7e-12
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 6e-09
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 8e-12
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-10
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-11
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-09
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 3e-11
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-10
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 5e-11
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-08
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 5e-11
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-08
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-10
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 4e-10
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 6e-09
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 5e-08
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 2e-07
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 6e-07
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 9e-07
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-06
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 5e-06
3k50_A403 Putative S41 protease; structural genomics, joint 9e-06
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 1e-05
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 1e-05
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 2e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 3e-05
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 3e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 9e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 1e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 1e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 1e-04
1k32_A1045 Tricorn protease; protein degradation, substrate g 3e-04
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 7e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 7e-04
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
 Score =  174 bits (443), Expect = 9e-52
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 46  PGTSEVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILS 105
                 +VV L +   G ++G+T++GG D + K   V  +  G  A R  +L  GD I +
Sbjct: 3   GSFKGSTVVELMKK-EGTTLGLTVSGGIDKDGK-PRVSNLRQGGIAARSDQLDVGDYIKA 60

Query: 106 INGKSMKGLTHKESLAILKR------------------------GPPVEITLIKDGAGLG 141
           +NG ++    H E +++LK                            VE+TL K+G   G
Sbjct: 61  VNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSIQGSSVMFRTVEVTLHKEGNTFG 120

Query: 142 FSLEGGKD-SPFGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINNVPVTEMSRIEAWSLL 200
           F + GG        +P+ +  +  GG A++ G +K GD +L+++ + +   +  EA S+L
Sbjct: 121 FVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSIL 180

Query: 201 KKLND 205
           K+   
Sbjct: 181 KQCGQ 185


>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query548
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.88
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.86
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.83
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.82
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.78
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.76
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.68
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.67
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.62
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.58
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.55
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.36
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.33
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.31
2awx_A105 Synapse associated protein 97; membrane protein, s 99.3
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.28
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.28
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.28
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.27
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.27
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.27
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.27
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.27
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.27
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.26
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.26
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.26
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.26
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.25
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.25
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.25
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.24
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.24
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.24
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.24
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.23
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.23
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.23
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.22
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.22
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.22
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.22
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.22
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.21
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.21
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.21
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.21
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.21
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.21
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.21
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.2
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.2
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.2
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.2
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.2
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.2
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.2
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.19
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.19
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.19
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.18
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.18
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.18
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.17
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.17
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.17
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.17
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.17
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.17
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.17
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.16
2d90_A102 PDZ domain containing protein 1; structural genomi 99.16
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.16
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.16
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.16
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.16
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.16
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.16
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.16
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.16
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.16
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.15
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.15
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.15
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.15
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.15
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.15
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.15
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.15
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.14
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.14
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.14
2ego_A96 General receptor for phosphoinositides 1- associat 99.14
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.14
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.14
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.13
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.13
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.13
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.13
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.13
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.12
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.12
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.11
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.11
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.11
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.11
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.11
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.11
2awx_A105 Synapse associated protein 97; membrane protein, s 99.1
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.1
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.1
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.1
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.1
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.1
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.09
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.09
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.09
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.09
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.09
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.09
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.09
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.09
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.09
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.08
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.08
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.07
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.07
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.07
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.07
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.07
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.07
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.07
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.06
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.06
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.06
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.06
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.06
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.06
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.06
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.05
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.05
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.05
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.04
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.04
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.04
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.04
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.04
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.04
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.04
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.03
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.03
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.03
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.02
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.02
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.02
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.02
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.01
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.01
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.01
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.01
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.0
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.0
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.0
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.0
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.0
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.0
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.0
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.0
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.0
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.0
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.0
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.0
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.0
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.99
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.99
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.99
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.98
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.98
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.98
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.98
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.97
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.97
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.97
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.97
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.97
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.97
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.96
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.96
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.96
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.96
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.96
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.96
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.96
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.95
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.95
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.95
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.95
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.95
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.95
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.94
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.94
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.94
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.94
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.93
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.93
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.93
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.93
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.93
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.93
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.93
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.93
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.93
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.92
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.92
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.92
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.92
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.91
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.91
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.91
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.91
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.91
2ego_A96 General receptor for phosphoinositides 1- associat 98.91
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.91
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.91
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.9
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.9
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.9
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.9
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.89
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.88
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.88
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.88
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.88
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.88
2d90_A102 PDZ domain containing protein 1; structural genomi 98.88
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.87
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.87
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.87
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.87
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.86
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.86
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.86
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.86
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.85
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.85
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.85
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.84
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.84
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.84
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.84
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.84
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.84
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.83
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.82
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.82
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.82
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.8
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.79
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.79
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.79
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.79
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.78
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.78
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.78
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.78
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.78
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.78
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.77
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.77
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.77
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.77
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.76
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.76
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.75
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.75
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.75
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.23
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.75
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.75
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.74
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.74
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.74
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.74
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.73
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.72
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.7
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.69
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.69
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.68
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.68
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.68
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.67
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.67
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.67
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.66
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.65
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.65
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.64
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.64
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.64
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.62
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.62
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.62
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.61
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.6
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.59
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.59
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.57
2kl1_A94 YLBL protein; structure genomics, structural genom 98.56
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.55
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.55
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.53
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.52
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.52
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.51
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.51
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.5
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.5
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.48
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.48
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.84
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.45
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.44
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.43
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.42
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.39
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.37
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.37
3k50_A403 Putative S41 protease; structural genomics, joint 98.36
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.33
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.3
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.28
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.24
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.22
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.17
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.08
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.01
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.0
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.94
2kl1_A94 YLBL protein; structure genomics, structural genom 97.93
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 97.92
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.91
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.9
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 97.9
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.86
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.84
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.83
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.79
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.79
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.72
3k50_A403 Putative S41 protease; structural genomics, joint 97.53
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.46
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.45
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.42
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.34
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.34
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.26
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.25
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.18
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.92
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.09
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 93.84
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
Probab=99.88  E-value=2.1e-21  Score=180.96  Aligned_cols=167  Identities=33%  Similarity=0.549  Sum_probs=136.3

Q ss_pred             CCCeEEEEEeeCCCCCceEEEEEeCCCCC----CCCeEEEEEcCCChhhhcCCCCCCCEEEEECCeeccCccHHHHHHHh
Q psy6405          48 TSEVSVVVLHRDLPGNSVGITLAGGSDYE----SKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAIL  123 (548)
Q Consensus        48 ~~d~~tV~L~Kd~~~~GLGfsIagG~d~~----~~gVvVs~V~pGSPAaqAGrLq~GDrILaINGv~V~~~s~~~aV~~l  123 (548)
                      ..+.+.+.+.+.  ..+|||++.++.+..    ..+++|..|.|+|||+++|+|++||+|++|||+++.++++..++..+
T Consensus         3 ~~~~~~v~l~~~--~~~lG~~i~~g~~~~~~~~~~g~~V~~V~~~spA~~aG~l~~GD~I~~vng~~v~~~~~~~~~~~~   80 (196)
T 3gsl_A            3 SMEYEEITLERG--NSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL   80 (196)
T ss_dssp             CEEEEEEEEECB--TTBSSEEEECCTTSCTTSSCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHH
T ss_pred             CcEEEEEEEEEC--CCCCCEEEEcccCCcccCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHH
Confidence            346788999988  688999999987642    46899999999999999999999999999999999999988866444


Q ss_pred             h-CCCCeEEEEEecC---------------cceeEEEecCCCCC--CCCCCeEEEEeccCChhhhcCCCCCCCEEEEECC
Q psy6405         124 K-RGPPVEITLIKDG---------------AGLGFSLEGGKDSP--FGDQPLTVKKIFTGGCAEKNGQLKAGDEILTINN  185 (548)
Q Consensus       124 k-~g~~VtVtV~RdG---------------kgLGfSItgg~~s~--lG~~gI~VssV~pgSpAekaGrLq~GDrILaVNG  185 (548)
                      + .+..+.++|.|.+               .++|+++.......  ....+++|..|.++|+|+++|+|++||+|++|||
T Consensus        81 ~~~g~~v~l~v~r~~~~~~~~~~v~l~~~~~~lG~~~~~~~~~~~~~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~Vng  160 (196)
T 3gsl_A           81 KEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNS  160 (196)
T ss_dssp             HTSCSEEEEEEEEECCCCEEEEEEEEEEBTTBSCEEEEESBTSCSBTTBCCEEEEEECTTSHHHHHCCCCTTCEEEEETT
T ss_pred             HhCCCcEEEEEEecCCCccccEEEEEecCCCCceEEEEccCCCcCCCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECC
Confidence            4 4677888887754               23556665433221  1124789999999999999999999999999999


Q ss_pred             EEcCCCCHHHHHHHHHHcCCCceeEEEEeccc
Q psy6405         186 VPVTEMSRIEAWSLLKKLNDGTIQDIKALGYD  217 (548)
Q Consensus       186 vsV~~~t~~EavelLrs~~g~~V~LlV~RilD  217 (548)
                      +++.++++.+++++++.. +..+.+++.|...
T Consensus       161 ~~v~~~~~~~~~~~l~~~-~~~v~l~v~R~~~  191 (196)
T 3gsl_A          161 VGLEDVMHEDAVAALKNT-YDVVYLKVAKPSN  191 (196)
T ss_dssp             EECSSCBHHHHHHHHHSC-CEEEEEEEEEESC
T ss_pred             CcCCCCCHHHHHHHHHcC-CCeEEEEEeCCCC
Confidence            999999999999999875 6788888888654



>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 548
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 4e-21
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 3e-16
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 8e-21
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 9e-17
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-20
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-17
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-20
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-19
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-20
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-17
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 7e-20
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-18
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-19
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-17
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-19
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 7e-17
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-19
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-15
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 4e-19
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-16
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 6e-19
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 7e-18
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 7e-19
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 8e-19
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-18
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-17
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-18
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 3e-17
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-18
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 5e-16
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-18
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-16
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-18
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 8e-17
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-18
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-16
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-18
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-17
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 4e-18
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-17
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-18
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-17
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-18
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-16
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 5e-18
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 1e-17
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 6e-18
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-15
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-18
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-14
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 7e-18
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 6e-16
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-17
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-13
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-17
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-12
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-17
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 8e-17
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-17
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 4e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 4e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 7e-14
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-17
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-16
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-16
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-15
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-16
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-11
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-16
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-10
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-16
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-15
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-16
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-13
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 7e-16
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-12
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-16
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-14
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 8e-16
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-15
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-15
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-15
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-15
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-14
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-15
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-14
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-15
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 3e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-15
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-13
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 3e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 7e-15
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 4e-15
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-13
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 5e-15
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 2e-10
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 7e-15
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-14
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 9e-15
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-11
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 9e-15
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-12
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-14
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-14
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 1e-14
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 6e-13
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-14
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-14
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-14
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 6e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-13
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 3e-13
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 7e-12
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 6e-13
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-12
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-11
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 4e-11
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 1e-09
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 1e-07
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 6e-09
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 3e-08
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 1e-06
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 2e-05
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 2e-04
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 4e-04
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.003
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: Interleukin 16
domain: Interleukin 16
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 86.5 bits (214), Expect = 4e-21
 Identities = 38/85 (44%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query: 50  EVSVVVLHRDLPGNSVGITLAGGSDYESKEITVHKVISGTPADRDGRLQKGDRILSINGK 109
            + V +LH++  G  +G +LAGG+D E+K ITVH+V     A ++G +QKG+ +LSINGK
Sbjct: 8   GIHVTILHKE-EGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGK 66

Query: 110 SMKGLTHKESLAILKRGPPVEITLI 134
           S+KG TH ++LAIL++       +I
Sbjct: 67  SLKGTTHHDALAILRQAREPRQAVI 91


>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query548
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.43
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.43
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.43
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.43
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.41
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.41
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.39
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.38
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.38
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.38
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.38
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.38
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.37
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.37
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.36
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.36
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.36
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.35
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.35
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.35
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.34
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.33
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.33
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.33
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.33
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.32
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.31
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.3
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.29
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.29
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.29
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.29
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.29
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.28
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.28
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.28
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.28
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.27
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.27
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.26
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.26
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.25
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.25
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.25
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.25
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.25
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.25
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.25
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.25
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.24
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.24
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.24
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.23
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.22
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.21
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.21
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.2
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.19
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.19
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.19
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.18
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.18
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.18
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.17
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.17
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.17
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.17
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.16
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.16
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.15
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.15
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.15
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.15
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.14
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.13
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.13
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.13
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.13
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.13
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.12
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.12
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.11
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.11
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.09
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.09
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.09
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.08
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.08
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.06
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.06
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.05
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.05
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.04
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.0
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.99
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.99
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.99
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.96
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.95
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.95
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.94
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.91
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.91
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.89
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.88
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.87
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.82
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.71
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.64
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.62
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.62
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.6
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.48
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.41
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.2
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.18
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.14
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.91
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.8
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 97.78
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 97.69
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synapse-associated protein 102
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.43  E-value=3.4e-13  Score=112.65  Aligned_cols=85  Identities=34%  Similarity=0.601  Sum_probs=73.7

Q ss_pred             eEEEEEeeCCCCCceEEEEEeCCCCC----CCCeEEEEEcCCChhhhcCCCCCCCEEEEECCeeccCccHHHHHHHhh-C
Q psy6405          51 VSVVVLHRDLPGNSVGITLAGGSDYE----SKEITVHKVISGTPADRDGRLQKGDRILSINGKSMKGLTHKESLAILK-R  125 (548)
Q Consensus        51 ~~tV~L~Kd~~~~GLGfsIagG~d~~----~~gVvVs~V~pGSPAaqAGrLq~GDrILaINGv~V~~~s~~~aV~~lk-~  125 (548)
                      +++|.|.|.  ..||||++.++.+..    ..+++|..|.|+|||+++|+|++||+|++|||+++.++++.+++..++ .
T Consensus         2 v~~V~L~k~--~~glG~~i~gg~~~~~~~~~~gi~I~~v~~gg~A~~~G~L~~GD~Il~VNg~~v~~~~~~e~~~~lk~~   79 (92)
T d2fe5a1           2 IMEVNLLKG--PKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNT   79 (92)
T ss_dssp             EEEEEEECC--TTCSCEEEEECBTSCSBTTBCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCBHHHHHHHHHTC
T ss_pred             EEEEEEEEC--CCccCEEEEeecCCccCCCCCCEEEEEECCCCChhhcCCCCCCCEEEEeCCeecCCCCHHHHHHHHHcC
Confidence            578899987  478999999876532    357999999999999999999999999999999999999999987776 4


Q ss_pred             CCCeEEEEEecC
Q psy6405         126 GPPVEITLIKDG  137 (548)
Q Consensus       126 g~~VtVtV~RdG  137 (548)
                      +..++++|.|++
T Consensus        80 ~~~v~L~v~Rpg   91 (92)
T d2fe5a1          80 SDMVYLKVAKPG   91 (92)
T ss_dssp             CSEEEEEEECCC
T ss_pred             CCEEEEEEECCC
Confidence            567889888875



>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure