Psyllid ID: psy6464

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
ccccccccEEEEccHHHHHHHHHcccccEEEEEEEcEEEEccccHHHHHHHcccccccccccccccHHHHHHHHHHcccccEEEEEEEEEEccccc
ccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccccccHHHccccHHHHHHHHHccccccccccEEEEEEEEcHcccc
mneppgarARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLgripsavgyqptlatdmgtmqerittttkgsitsvqvrecpnfmn
mneppgararVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERIttttkgsitsvqvrecpnfmn
MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
*********RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDM****************************
****PGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
********ARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
***PPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTKGSITSVQVRECPNFMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q07233158 ATP synthase subunit beta N/A N/A 0.958 0.582 0.945 8e-45
P10719 529 ATP synthase subunit beta yes N/A 0.958 0.173 0.945 1e-44
P56480 529 ATP synthase subunit beta yes N/A 0.958 0.173 0.945 1e-44
Q0QEP2 362 ATP synthase subunit beta N/A N/A 0.958 0.254 0.945 1e-44
P00829 528 ATP synthase subunit beta yes N/A 0.958 0.174 0.945 1e-44
P06576 529 ATP synthase subunit beta yes N/A 0.958 0.173 0.945 1e-44
Q25117 523 ATP synthase subunit beta N/A N/A 0.958 0.175 0.945 2e-44
Q9PTY0 518 ATP synthase subunit beta N/A N/A 0.958 0.177 0.945 2e-44
Q5ZLC5 533 ATP synthase subunit beta yes N/A 0.958 0.172 0.945 3e-44
Q05825 505 ATP synthase subunit beta yes N/A 0.958 0.182 0.934 3e-44
>sp|Q07233|ATPB_SCHGA ATP synthase subunit beta, mitochondrial (Fragment) OS=Schizaphis graminum PE=3 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/92 (94%), Positives = 88/92 (95%)

Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct: 59  MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 118

Query: 61  QPTLATDMGTMQERITTTTKGSITSVQVRECP 92
           QPTLATDMGTMQERITTT+KGSITSVQ    P
Sbjct: 119 QPTLATDMGTMQERITTTSKGSITSVQAIYVP 150
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Schizaphis graminum (taxid: 13262)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 4
>sp|P10719|ATPB_RAT ATP synthase subunit beta, mitochondrial OS=Rattus norvegicus GN=Atp5b PE=1 SV=2 Back     alignment and function description
>sp|P56480|ATPB_MOUSE ATP synthase subunit beta, mitochondrial OS=Mus musculus GN=Atp5b PE=1 SV=2 Back     alignment and function description
>sp|Q0QEP2|ATPB_MESAU ATP synthase subunit beta, mitochondrial (Fragment) OS=Mesocricetus auratus GN=ATP5B PE=1 SV=1 Back     alignment and function description
>sp|P00829|ATPB_BOVIN ATP synthase subunit beta, mitochondrial OS=Bos taurus GN=ATP5B PE=1 SV=2 Back     alignment and function description
>sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens GN=ATP5B PE=1 SV=3 Back     alignment and function description
>sp|Q25117|ATPB_HEMPU ATP synthase subunit beta, mitochondrial OS=Hemicentrotus pulcherrimus PE=2 SV=1 Back     alignment and function description
>sp|Q9PTY0|ATPB_CYPCA ATP synthase subunit beta, mitochondrial OS=Cyprinus carpio GN=atp5b PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLC5|ATPB_CHICK ATP synthase subunit beta, mitochondrial OS=Gallus gallus GN=ATP5B PE=1 SV=1 Back     alignment and function description
>sp|Q05825|ATPB_DROME ATP synthase subunit beta, mitochondrial OS=Drosophila melanogaster GN=ATPsyn-beta PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
320407251 359 ATP synthase beta subunit [Ophelia limac 0.958 0.256 0.956 3e-43
209915626 521 ATP synthase subunit beta, mitochondrial 0.958 0.176 0.945 3e-43
242023574 550 ATP synthase subunit beta, putative [Ped 0.958 0.167 0.945 3e-43
104 357 beta-subunit [Bos taurus] 0.958 0.257 0.945 3e-43
89574469 521 putative ATP synthase beta subunit [Acyr 0.958 0.176 0.945 4e-43
203033 358 F1-ATPase beta subunit, partial [Rattus 0.958 0.256 0.945 4e-43
1168581158 RecName: Full=ATP synthase subunit beta, 0.958 0.582 0.945 4e-43
12666541158 ATPase beta subunit [Thelaxes suberi] gi 0.958 0.582 0.945 4e-43
28931 312 beta-subunit (AA 1-312) [Homo sapiens] 0.958 0.294 0.945 4e-43
406679472 284 mitochondrial ATP synthase subunit beta, 0.958 0.323 0.945 4e-43
>gi|320407251|gb|ADW27401.1| ATP synthase beta subunit [Ophelia limacina] Back     alignment and taxonomy information
 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/92 (95%), Positives = 88/92 (95%)

Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct: 162 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 221

Query: 61  QPTLATDMGTMQERITTTTKGSITSVQVRECP 92
           QPTLATDMGTMQERITTTTKGSITSVQ    P
Sbjct: 222 QPTLATDMGTMQERITTTTKGSITSVQAIYVP 253

Source: Ophelia limacina

Species: Ophelia limacina

Genus: Ophelia

Family: Opheliidae

Order:

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota
>gi|209915626|ref|NP_001119645.2| ATP synthase subunit beta, mitochondrial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242023574|ref|XP_002432207.1| ATP synthase subunit beta, putative [Pediculus humanus corporis] gi|212517604|gb|EEB19469.1| ATP synthase subunit beta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|104|emb|CAA29094.1| beta-subunit [Bos taurus] Back     alignment and taxonomy information
>gi|89574469|gb|ABD76365.1| putative ATP synthase beta subunit [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|203033|gb|AAA40778.1| F1-ATPase beta subunit, partial [Rattus norvegicus] Back     alignment and taxonomy information
>gi|1168581|sp|Q07233.1|ATPB_SCHGA RecName: Full=ATP synthase subunit beta, mitochondrial gi|312115|emb|CAA78851.1| beta subunit of ATPase [Schizaphis graminum] Back     alignment and taxonomy information
>gi|12666541|emb|CAC28078.1| ATPase beta subunit [Thelaxes suberi] gi|12666549|emb|CAC28068.1| ATPase beta subunit [Rhopalosiphum padi] gi|12666551|emb|CAC28053.1| ATPase beta subunit [Myzus persicae] Back     alignment and taxonomy information
>gi|28931|emb|CAA29095.1| beta-subunit (AA 1-312) [Homo sapiens] Back     alignment and taxonomy information
>gi|406679472|gb|AFS50738.1| mitochondrial ATP synthase subunit beta, partial [Solen vaginoides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
UNIPROTKB|Q5ZLC5 533 ATP5B "ATP synthase subunit be 0.958 0.172 0.945 2.6e-40
UNIPROTKB|P00829 528 ATP5B "ATP synthase subunit be 0.958 0.174 0.945 2.6e-40
UNIPROTKB|F1PDB4 527 ATP5B "ATP synthase subunit be 0.958 0.174 0.945 2.6e-40
UNIPROTKB|H0YH81362 ATP5B "ATP synthase subunit be 0.958 0.254 0.945 2.6e-40
UNIPROTKB|P06576 529 ATP5B "ATP synthase subunit be 0.958 0.173 0.945 2.6e-40
UNIPROTKB|F1SLA0 528 ATP5B "ATP synthase subunit be 0.958 0.174 0.945 2.6e-40
UNIPROTKB|Q0QEP2 362 ATP5B "ATP synthase subunit be 0.958 0.254 0.945 2.6e-40
MGI|MGI:107801 529 Atp5b "ATP synthase, H+ transp 0.958 0.173 0.945 2.6e-40
RGD|621368 529 Atp5b "ATP synthase, H+ transp 0.958 0.173 0.945 2.6e-40
UNIPROTKB|G3V6D3 529 Atp5b "ATP synthase subunit be 0.958 0.173 0.945 2.6e-40
UNIPROTKB|Q5ZLC5 ATP5B "ATP synthase subunit beta, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 2.6e-40, P = 2.6e-40
 Identities = 87/92 (94%), Positives = 87/92 (94%)

Query:     1 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
             MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct:   277 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 336

Query:    61 QPTLATDMGTMQERITTTTKGSITSVQVRECP 92
             QPTLATDMGTMQERITTT KGSITSVQ    P
Sbjct:   337 QPTLATDMGTMQERITTTRKGSITSVQAIYVP 368
GO:0015986 "ATP synthesis coupled proton transport" evidence=IEA
GO:0015991 "ATP hydrolysis coupled proton transport" evidence=IEA
GO:0046933 "proton-transporting ATP synthase activity, rotational mechanism" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0045261 "proton-transporting ATP synthase complex, catalytic core F(1)" evidence=IEA
GO:0005753 "mitochondrial proton-transporting ATP synthase complex" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0006933 "negative regulation of cell adhesion involved in substrate-bound cell migration" evidence=IEA
GO:0009986 "cell surface" evidence=IEA
GO:0042288 "MHC class I protein binding" evidence=IEA
GO:0042645 "mitochondrial nucleoid" evidence=IEA
GO:0043499 "eukaryotic cell surface binding" evidence=IEA
GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IEA
GO:0051453 "regulation of intracellular pH" evidence=IEA
GO:0001525 "angiogenesis" evidence=IMP
UNIPROTKB|P00829 ATP5B "ATP synthase subunit beta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDB4 ATP5B "ATP synthase subunit beta" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YH81 ATP5B "ATP synthase subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P06576 ATP5B "ATP synthase subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLA0 ATP5B "ATP synthase subunit beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0QEP2 ATP5B "ATP synthase subunit beta, mitochondrial" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
MGI|MGI:107801 Atp5b "ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621368 Atp5b "ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6D3 Atp5b "ATP synthase subunit beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0BQE8ATPB_GRABC3, ., 6, ., 3, ., 1, 40.83690.95830.1932yesN/A
Q74GY0ATPB_GEOSL3, ., 6, ., 3, ., 1, 40.83690.95830.1957yesN/A
Q2G5N5ATPB_NOVAD3, ., 6, ., 3, ., 1, 40.88040.95830.1912yesN/A
P00830ATPB_YEAST3, ., 6, ., 3, ., 1, 40.89130.95830.1800yesN/A
A5V3X5ATPB_SPHWW3, ., 6, ., 3, ., 1, 40.84780.95830.1900yesN/A
P10719ATPB_RAT3, ., 6, ., 3, ., 1, 40.94560.95830.1739yesN/A
Q39Q56ATPB_GEOMG3, ., 6, ., 3, ., 1, 40.84780.95830.1957yesN/A
Q1GQS5ATPB_SPHAL3, ., 6, ., 3, ., 1, 40.86950.95830.1793yesN/A
C3M9S1ATPB_RHISN3, ., 6, ., 3, ., 1, 40.89130.94790.1801yesN/A
B3EA01ATPB_GEOLS3, ., 6, ., 3, ., 1, 40.85860.95830.1953yesN/A
P00829ATPB_BOVIN3, ., 6, ., 3, ., 1, 40.94560.95830.1742yesN/A
Q4FP38ATPB_PELUB3, ., 6, ., 3, ., 1, 40.90210.95830.1949yesN/A
Q25117ATPB_HEMPU3, ., 6, ., 3, ., 1, 40.94560.95830.1759N/AN/A
P83484ATPBN_ARATH3, ., 6, ., 3, ., 1, 40.86950.95830.1654yesN/A
Q04BA3ATPB_LACDB3, ., 6, ., 3, ., 1, 40.85860.95830.1920yesN/A
Q1GAW5ATPB_LACDA3, ., 6, ., 3, ., 1, 40.85860.95830.1920yesN/A
Q05825ATPB_DROME3, ., 6, ., 3, ., 1, 40.93470.95830.1821yesN/A
Q6NDD2ATPB_RHOPA3, ., 6, ., 3, ., 1, 40.88040.94790.1911yesN/A
Q07233ATPB_SCHGA3, ., 6, ., 3, ., 1, 40.94560.95830.5822N/AN/A
Q5NQY9ATPB_ZYMMO3, ., 6, ., 3, ., 1, 40.85860.95830.1900yesN/A
A6UDM1ATPB_SINMW3, ., 6, ., 3, ., 1, 40.90210.94790.1787yesN/A
P83483ATPBM_ARATH3, ., 6, ., 3, ., 1, 40.86950.95830.1654yesN/A
P46561ATPB_CAEEL3, ., 6, ., 3, ., 1, 40.92390.95830.1710yesN/A
P05038ATPB_RHORU3, ., 6, ., 3, ., 1, 40.85860.95830.1940yesN/A
Q11DD5ATPB_MESSB3, ., 6, ., 3, ., 1, 40.89130.94790.1753yesN/A
Q92LK8ATPB_RHIME3, ., 6, ., 3, ., 1, 40.90210.94790.1805yesN/A
Q9C5A9ATPBO_ARATH3, ., 6, ., 3, ., 1, 40.86950.95830.1645yesN/A
B5EFI7ATPB_GEOBB3, ., 6, ., 3, ., 1, 40.83690.95830.1957yesN/A
Q0QEP2ATPB_MESAU3, ., 6, ., 3, ., 1, 40.94560.95830.2541N/AN/A
Q5ZLC5ATPB_CHICK3, ., 6, ., 3, ., 1, 40.94560.95830.1726yesN/A
Q2VZN2ATPB_MAGSA3, ., 6, ., 3, ., 1, 40.86950.95830.1940yesN/A
P56480ATPB_MOUSE3, ., 6, ., 3, ., 1, 40.94560.95830.1739yesN/A
Q6MGM7ATPB_BDEBA3, ., 6, ., 3, ., 1, 40.85860.95830.1965yesN/A
Q9PTY0ATPB_CYPCA3, ., 6, ., 3, ., 1, 40.94560.95830.1776N/AN/A
Q2N8Z2ATPB_ERYLH3, ., 6, ., 3, ., 1, 40.85860.95830.1896yesN/A
Q2RV18ATPB_RHORT3, ., 6, ., 3, ., 1, 40.85860.95830.1940yesN/A
P06576ATPB_HUMAN3, ., 6, ., 3, ., 1, 40.94560.95830.1739yesN/A
Q98EV8ATPB_RHILO3, ., 6, ., 3, ., 1, 40.89130.94790.1907yesN/A
P22068ATPB_SCHPO3, ., 6, ., 3, ., 1, 40.92390.95830.1752yesN/A
P49376ATPB_KLULA3, ., 6, ., 3, ., 1, 40.89130.95830.1821yesN/A
P23704ATPB_NEUCR3, ., 6, ., 3, ., 1, 40.91300.95830.1772N/AN/A
A6TK65ATPB_ALKMQ3, ., 6, ., 3, ., 1, 40.85860.95830.1982yesN/A
Q55CS9ATPB_DICDI3, ., 6, ., 3, ., 1, 40.89130.95830.1413yesN/A
Q9A2V9ATPB_CAUCR3, ., 6, ., 3, ., 1, 40.83690.95830.1706yesN/A
A8HS10ATPB_AZOC53, ., 6, ., 3, ., 1, 40.89130.94790.1903yesN/A
C6E9F1ATPB_GEOSM3, ., 6, ., 3, ., 1, 40.83690.95830.1957yesN/A
B0T335ATPB_CAUSK3, ., 6, ., 3, ., 1, 40.83690.95830.1697yesN/A
A7IH31ATPB_XANP23, ., 6, ., 3, ., 1, 40.89130.94790.1903yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 6e-73
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 6e-69
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 2e-67
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 3e-60
CHL00060 494 CHL00060, atpB, ATP synthase CF1 beta subunit 3e-59
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 1e-56
TIGR03305 449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 2e-42
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 5e-31
TIGR03498 418 TIGR03498, FliI_clade3, flagellar protein export A 1e-16
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 2e-16
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 3e-16
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flag 7e-16
PRK06820 440 PRK06820, PRK06820, type III secretion system ATPa 2e-14
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-14
PRK06002 450 PRK06002, fliI, flagellum-specific ATP synthase; V 4e-14
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 4e-14
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 9e-14
PRK08927 442 PRK08927, fliI, flagellum-specific ATP synthase; V 6e-13
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 1e-12
PRK07721 438 PRK07721, fliI, flagellum-specific ATP synthase; V 1e-11
PRK06315 442 PRK06315, PRK06315, type III secretion system ATPa 2e-11
PRK08472 434 PRK08472, fliI, flagellum-specific ATP synthase; V 3e-11
PRK09099 441 PRK09099, PRK09099, type III secretion system ATPa 8e-11
PRK08149 428 PRK08149, PRK08149, ATP synthase SpaL; Validated 8e-11
PRK05688 451 PRK05688, fliI, flagellum-specific ATP synthase; V 1e-10
PRK08972 444 PRK08972, fliI, flagellum-specific ATP synthase; V 3e-10
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 6e-10
TIGR01043 578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, 1e-09
COG1155 588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su 2e-09
TIGR01042 591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A 2e-09
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catal 4e-09
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 6e-09
PRK07594 433 PRK07594, PRK07594, type III secretion system ATPa 3e-08
PRK05922 434 PRK05922, PRK05922, type III secretion system ATPa 3e-08
PRK06793 432 PRK06793, fliI, flagellum-specific ATP synthase; V 8e-08
PRK04192 586 PRK04192, PRK04192, V-type ATP synthase subunit A; 9e-08
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 9e-08
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 3e-07
PRK07196 434 PRK07196, fliI, flagellum-specific ATP synthase; V 2e-06
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 5e-06
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 6e-06
PRK07960 455 PRK07960, fliI, flagellum-specific ATP synthase; V 1e-05
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 3e-05
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 6e-05
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 1e-04
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 4e-04
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 6e-04
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 0.002
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 0.003
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information 
 Score =  222 bits (569), Expect = 6e-73
 Identities = 78/87 (89%), Positives = 83/87 (95%)

Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGAR RVALTGLT+AEYFRD EGQDVLLFIDNIFRFTQAGSEVSALLGR+PSAVGY
Sbjct: 211 MNEPPGARLRVALTGLTMAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGY 270

Query: 61  QPTLATDMGTMQERITTTTKGSITSVQ 87
           QPTLAT+MG +QERIT+T KGSITSVQ
Sbjct: 271 QPTLATEMGQLQERITSTKKGSITSVQ 297

Length = 463
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 100.0
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 100.0
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
PRK04196 460 V-type ATP synthase subunit B; Provisional 100.0
PRK06936 439 type III secretion system ATPase; Provisional 100.0
PRK02118 436 V-type ATP synthase subunit B; Provisional 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 100.0
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 100.0
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
CHL00060 494 atpB ATP synthase CF1 beta subunit 100.0
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 100.0
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK09099 441 type III secretion system ATPase; Provisional 100.0
PRK07594 433 type III secretion system ATPase SsaN; Validated 100.0
PRK05922 434 type III secretion system ATPase; Validated 100.0
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 100.0
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK06820 440 type III secretion system ATPase; Validated 100.0
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 100.0
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 100.0
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 100.0
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
PRK08149 428 ATP synthase SpaL; Validated 100.0
PTZ00185 574 ATPase alpha subunit; Provisional 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 100.0
CHL00059 485 atpA ATP synthase CF1 alpha subunit 100.0
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 100.0
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 100.0
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 100.0
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 100.0
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 100.0
PRK04192 586 V-type ATP synthase subunit A; Provisional 100.0
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 100.0
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 100.0
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 100.0
PRK14698 1017 V-type ATP synthase subunit A; Provisional 100.0
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 99.98
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 99.98
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 99.97
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.97
KOG1350|consensus 521 99.95
PRK12608380 transcription termination factor Rho; Provisional 99.95
PRK09376416 rho transcription termination factor Rho; Provisio 99.95
PRK06315 442 type III secretion system ATPase; Provisional 99.94
PRK12678 672 transcription termination factor Rho; Provisional 99.94
TIGR00767415 rho transcription termination factor Rho. Members 99.94
cd01128249 rho_factor Transcription termination factor rho is 99.91
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 99.91
KOG1351|consensus 489 99.9
KOG1352|consensus 618 99.87
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 99.86
COG1158422 Rho Transcription termination factor [Transcriptio 99.75
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.25
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information 
Probab=100.00  E-value=3.7e-39  Score=246.17  Aligned_cols=93  Identities=31%  Similarity=0.493  Sum_probs=90.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhccCCcEEEEecCchhhhhhhhhHHhhhCCCCCCCCCCCcccchhHHHhhhhcCC--
Q psy6464           1 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--   78 (96)
Q Consensus         1 md~p~~~r~~~~~~~~~~AEyfrd~~G~~Vlll~Dsltr~a~A~reisl~~ge~p~~~gyp~~~~~~~~~l~eRag~~--   78 (96)
                      ||+||++|++++|+|+++||||||++|+|||+++||+||||+|+||||+++||||+++||||++|+.|++|+||||+.  
T Consensus       139 ~~~~~~~r~~a~~~a~aiAEyfrd~~g~~VLl~~D~ltr~A~A~rEisl~~gepP~~~gyp~~vf~~~~~l~ERag~~~~  218 (276)
T cd01135         139 ANDPTIERIITPRMALTTAEYLAYEKGKHVLVILTDMTNYAEALREISAAREEVPGRRGYPGYMYTDLATIYERAGRVEG  218 (276)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhccCCeEEEEEcChhHHHHHHHHHHhccCCCCCccCcCccHHHHhhHHheecccCCC
Confidence            699999999999999999999999779999999999999999999999999999999999999999999999999995  


Q ss_pred             CCCccceeeeeecCC
Q psy6464          79 TKGSITSVQVRECPN   93 (96)
Q Consensus        79 ~~GSIT~i~~v~vp~   93 (96)
                      ++||||+|++|++|+
T Consensus       219 ~~GSITa~~~V~~~~  233 (276)
T cd01135         219 RNGSITQIPILTMPN  233 (276)
T ss_pred             CCeeEEEEEEEEccC
Confidence            579999999999996

These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria. This subfamily consists of the non-catalytic beta subunit.
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1nbm_E 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 8e-46
1mab_B 479 Rat Liver F1-Atpase Length = 479 1e-45
1cow_D 482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 1e-45
1nbm_D 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 1e-45
4asu_D 480 F1-Atpase In Which All Three Catalytic Sites Contai 1e-45
2w6e_D 528 Low Resolution Structures Of Bovine Mitochondrial F 1e-45
2xnd_D 467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-45
4b2q_D 470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 6e-44
3fks_D 484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 6e-44
2hld_D 478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 6e-44
4b2q_E 473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 7e-44
2xok_D 511 Refined Structure Of Yeast F1c10 Atpase Complex To 7e-44
3oeh_D 484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 3e-43
2qe7_D 462 Crystal Structure Of The F1-Atpase From The Thermoa 2e-41
1sky_E 473 Crystal Structure Of The Nucleotide Free Alpha3beta 3e-40
1fx0_B 498 Crystal Structure Of The Chloroplast F1-Atpase From 4e-37
3oaa_D 459 Structure Of The E.Coli F1-Atp Synthase Inhibited B 2e-34
2obl_A 347 Structural And Biochemical Analysis Of A Prototypic 3e-09
3a5c_A 578 Inter-Subunit Interaction And Quaternary Rearrangem 3e-08
3gqb_A 578 Crystal Structure Of The A3b3 Complex From V-atpase 3e-08
3se0_A 588 Structural Characterization Of The Subunit A Mutant 3e-08
3sdz_A 588 Structural Characterization Of The Subunit A Mutant 3e-08
1vdz_A 588 Crystal Structure Of A-Type Atpase Catalytic Subuni 3e-08
3nd9_A 588 Structural Characterization For The Nucleotide Bind 3e-08
3m4y_A 588 Structural Characterization Of The Subunit A Mutant 3e-08
3qjy_A 588 Crystal Structure Of P-Loop G234a Mutant Of Subunit 3e-08
3qia_A 588 Crystal Structure Of P-Loop G237a Mutant Of Subunit 3e-08
3qg1_A 588 Crystal Structure Of P-Loop G239a Mutant Of Subunit 3e-08
3nd8_A 588 Structural Characterization For The Nucleotide Bind 3e-08
3mfy_A 588 Structural Characterization Of The Subunit A Mutant 3e-08
3ikj_A 588 Structural Characterization For The Nucleotide Bind 3e-08
3i4l_A 588 Structural Characterization For The Nucleotide Bind 3e-08
3vr6_A 600 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 4e-07
3vr2_A 600 Crystal Structure Of Nucleotide-free A3b3 Complex F 2e-06
2rkw_A 469 Intermediate Position Of Atp On Its Trail To The Bi 3e-06
2c61_A 469 Crystal Structure Of The Non-Catalytic B Subunit Of 3e-06
3ssa_A 460 Crystal Structure Of Subunit B Mutant N157t Of The 3e-06
3tiv_A 460 Crystal Structure Of Subunit B Mutant N157a Of The 4e-06
3tgw_A 460 Crystal Structure Of Subunit B Mutant H156a Of The 4e-06
3gqb_B 464 Crystal Structure Of The A3b3 Complex From V-atpase 7e-06
3a5c_D 478 Inter-Subunit Interaction And Quaternary Rearrangem 1e-05
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 2e-05
2dpy_A 438 Crystal Structure Of The Flagellar Type Iii Atpase 2e-05
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 3e-05
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure 
Iteration: 1

 Score =  178 bits (451), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 87/92 (94%), Positives = 87/92 (94%)
Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct: 226 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 285
Query: 61  QPTLATDMGTMQERITTTTKGSITSVQVRECP 92
           QPTLATDMGTMQERITTT KGSITSVQ    P
Sbjct: 286 QPTLATDMGTMQERITTTKKGSITSVQAIXVP 317
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 Back     alignment and structure
>pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 Back     alignment and structure
>pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 Back     alignment and structure
>pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 Back     alignment and structure
>pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 Back     alignment and structure
>pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 Back     alignment and structure
>pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 Back     alignment and structure
>pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 Back     alignment and structure
>pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 Back     alignment and structure
>pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 7e-73
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 9e-68
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 3e-66
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 4e-46
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 7e-40
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 2e-27
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 1e-18
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 6e-18
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 9e-17
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
 Score =  222 bits (568), Expect = 7e-73
 Identities = 86/87 (98%), Positives = 86/87 (98%)

Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct: 226 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 285

Query: 61  QPTLATDMGTMQERITTTTKGSITSVQ 87
           QPTLATDMGTMQERITTT KGSITSVQ
Sbjct: 286 QPTLATDMGTMQERITTTKKGSITSVQ 312
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 100.0
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 100.0
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 100.0
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 100.0
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 100.0
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 100.0
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 100.0
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 100.0
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 100.0
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 100.0
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 100.0
3ice_A422 Transcription termination factor RHO; transcriptio 99.98
3l0o_A427 Transcription termination factor RHO; helicase, RH 99.98
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.82
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.69
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
Probab=100.00  E-value=6.1e-37  Score=246.84  Aligned_cols=92  Identities=92%  Similarity=1.278  Sum_probs=90.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHh-ccCCcEEEEecCchhhhhhhhhHHhhhCCCCCCCCCCCcccchhHHHhhhhcCCC
Q psy6464           1 MNEPPGARARVALTGLTVAEYFRD-QEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTT   79 (96)
Q Consensus         1 md~p~~~r~~~~~~~~~~AEyfrd-~~G~~Vlll~Dsltr~a~A~reisl~~ge~p~~~gyp~~~~~~~~~l~eRag~~~   79 (96)
                      ||+||.+|++++++|+++|||||| + |+|||+++||+||||+|+||||+++||+|+++||||++|+.+++|+|||++++
T Consensus       226 ~d~p~~~r~~~~~~a~tiAEyfrd~~-G~dVLll~DsitR~A~A~rEis~~lge~P~~~GYpp~l~~~l~~l~ERag~~~  304 (482)
T 2ck3_D          226 MNEPPGARARVALTGLTVAEYFRDQE-GQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTK  304 (482)
T ss_dssp             TTSCHHHHHHHHHHHHHHHHHHHHTT-CSCEEEEEECTHHHHHHHHHHHGGGTCCCCGGGCCTTHHHHHHHHHTTSSCCS
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHhc-CCcEEEEeccHHHHHHHHHHhhhhcCCCCccccCchhHHHHhHHHHHhhcCCC
Confidence            699999999999999999999999 7 99999999999999999999999999999999999999999999999999999


Q ss_pred             CCccceeeeeecCC
Q psy6464          80 KGSITSVQVRECPN   93 (96)
Q Consensus        80 ~GSIT~i~~v~vp~   93 (96)
                      +||||+|+||++|+
T Consensus       305 ~GSIT~i~tv~v~~  318 (482)
T 2ck3_D          305 KGSITSVQAIYVPA  318 (482)
T ss_dssp             SCCEEEEEEEECGG
T ss_pred             CCceeeeEEEEecC
Confidence            99999999999996
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 5e-37
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 7e-33
d1fx0a3276 c.37.1.11 (A:97-372) Central domain of alpha subun 2e-21
d1xpua3289 c.37.1.11 (A:129-417) Transcription termination fa 4e-14
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  123 bits (310), Expect = 5e-37
 Identities = 87/93 (93%), Positives = 87/93 (93%)

Query: 1   MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 60
           MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY
Sbjct: 141 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGY 200

Query: 61  QPTLATDMGTMQERITTTTKGSITSVQVRECPN 93
           QPTLATDMGTMQERITTT KGSITSVQ    P 
Sbjct: 201 QPTLATDMGTMQERITTTKKGSITSVQAIYVPA 233
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 100.0
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 100.0
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 100.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 99.98
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=7.3e-38  Score=235.84  Aligned_cols=93  Identities=94%  Similarity=1.280  Sum_probs=90.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhccCCcEEEEecCchhhhhhhhhHHhhhCCCCCCCCCCCcccchhHHHhhhhcCCCC
Q psy6464           1 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTTK   80 (96)
Q Consensus         1 md~p~~~r~~~~~~~~~~AEyfrd~~G~~Vlll~Dsltr~a~A~reisl~~ge~p~~~gyp~~~~~~~~~l~eRag~~~~   80 (96)
                      +|+||.+|++++|+|+++||||||++|+|||+++||+||||+|+||+|+++||+|+++||||++|+.+++|+|||++.++
T Consensus       141 s~~~~~~r~~~~~~a~~iAEyf~~~~G~~VLv~~Dsltr~A~A~reis~~~ge~p~~~gyp~~l~~~~~~l~ERag~~~~  220 (276)
T d2jdid3         141 MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKK  220 (276)
T ss_dssp             TTSCHHHHHHHHHHHHHHHHHHHHTTCSCEEEEEECTHHHHHHHHHHHGGGTCCCCGGGCCTTHHHHHHHHHTTSSCCSS
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhcCCCeEEEEEcchhHHHHHHHHHHHhcCCCCCcccCchhHHHHHHHHHHhhccCCC
Confidence            58999999999999999999999866999999999999999999999999999999999999999999999999999999


Q ss_pred             CccceeeeeecCC
Q psy6464          81 GSITSVQVRECPN   93 (96)
Q Consensus        81 GSIT~i~~v~vp~   93 (96)
                      ||||+|+++++|+
T Consensus       221 GSIT~i~~v~~~~  233 (276)
T d2jdid3         221 GSITSVQAIYVPA  233 (276)
T ss_dssp             CCEEEEEEEECGG
T ss_pred             cccceEEEEEccC
Confidence            9999999999985
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure