Psyllid ID: psy6522

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------141
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKEKKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSEENSHSDSSSESGSSSQSSEEDSEDEDWTRHGKARRMPPRRTNRVGTSLGRQYRENPSDVSDYDSGDRYAMRARQSKQVQSVQAGRRGQTIVTSRTRGKQSYNKFSGRGRGRKAPESEDEVEGEEEEESNDQSEEEEVEENSEEEEEEEAVPRRRPVRRANVAKVKRAVPPAPDTSTSRLRSVRQNGRAKRTNGRQSSSLLMTCSGDSDSEDNSQEEEQYGSRRARRTRTKGQSYAVHSSETETESEEEESQAAQVSFSRRGRMRKPTAKLRGLE
cEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEccccEEEccccccccccccEEEEEEEccccEEEEcccccEEEEEccccccccccEEEEcccccEEEEEEcccccccEEEEccccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccccEEcccccccEEEEEEccccccccEEEEEEEccccEEEEEccccccEEEEccccccccEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEcccccEEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEccccccEEEEEEccccEEEEEcccccEEEEEccccEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccEEEEccccEEEEcccccccEEEccccccccccccccEEcEEEEEccccccEEEEcccccccEEEcccccccccccEEEEccccccccccccccccccccccccEEEEEEEEEEccccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccEEEEEEHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEccccEEEEEEEEEcccccccccEEEEEcccccccccEEEEHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEccccccccccccccccccccHHHHccccccHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHccccccccccccccEEEEEccccccccHHHHHcccEEEEccccccccccccccccc
cHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccHHEEEEccccccHHcccccccccEEEEEcccccEEEEcccccEEEEEEccccHHHEccccccccEEEEEcccccEEEEccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccHHHHHHHHHHccccccccccEcccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEcccEEEEEEcccccEEEEEcccccccccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccEEEEcccccEEEEcccccEEEEEccccccccccccccEEEccccccccccEEEEcccccccccccEcEEEEcccccEEEEEccccccEEEEEccccEEEcccccEEcccccccccccccccEEEEccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEEEcccccEEEEcccccccEEEEccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHcccccccccccccccEEEEEcccHHHHHHHHHHcccEEEccccccccccccccHccEEEEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccEHEEEccHHHHccEccccccccccEEEEEEEEccccEEccccccccccccccccHHccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEEccccccEEEEEccccccEccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHccccccccEHHHHHEEEcccccccccccccccEEccccccEcccccccccEEEEcccccccccccHHHHHccccHHHcccccccEEEEEcccccccccHHHHHHHEEEEcccccccccccHHcccc
MLLIIkylekgpchEAAKVLTDLVEAKnllperydwegathsQTLAEVasshpnvtasfLPKICQrlgplldkelkpnfpglksllsggsqSLLRSEKSLAKSVLSSYDYIARQHgtsllvpnsvkvhntVNVLrsreysgplsrslmisshktsllvpnsvkvhntvnvlrsreysgplsrFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLrgcsgeisdiAIDNRNILLAAGTVDKTIRIWNLQTLAPIsvlvghqgiitgvnfcplevngfnylaststdgcigfwkykldidisktvfhepvmfnerirpgnahilcssfspgglflatgsgdhhvrvykmdgvdsplgileveehsdkvdsiqwshshlrfvsgsrdgTALIWYYKCSQWRFirldmntclphtketsdetNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHtnevfvleshpfdsrvllsaghdgLIIIWDILSSKQRGYKWFHNIVegqgegalfdgkwspdgttcaltdSYGHLLVYglggfkrpqniprelffhtdyrtlnrpnglfeptydevtnlpphlmpppflvdlngtpyppevqrlvpgrenaddtellpdittnddghveivegserngerpvevegqrhyndhghvyiQTSHVHVLRsrangessaategtspsgtaptaqnknfvkrlplsQHKIVVERINAFAEIESEEFIKESKKlfdsstttqplvvkkekKKKVVRQARTRAEYSEHiqdqyedpdnlslsgseesasdsdqsqvdvsdlcesssssggtsssdysdwihegvnleppkrvrrhtkvkpiqvslpkqlipeevpdiykpsdwlaevvpkkapyypqmgdevmFFKQGYQKYVDAVRSKGIYELsrlrsspwgnlilqepelVKVVGIkyeiapprmcCLKLavmkpngkltneffnikyhdmpdvIDFFVLRQIYETAIARewnvgdrfcsmiddawwwgtiegkpsptkspflgykilwdnnerenlspwdleppkegkeatepggslpvepeEIQELlyhprpdewpqgdrdaTCEKIITGLEevmglsvaepflvpvdisslseenshsdsssesgsssqsseedsededwtrhgkarrmpprrtnrvgtslgrqyrenpsdvsdydsgdrYAMRARQSKQVqsvqagrrgqtivtsrtrgkqsynkfsgrgrgrkapesedevegeeeeesndqseeeeveenseeeeeeeavprrrpvrranvakvkravppapdtstsrLRSVRQngrakrtngrqsssllmtcsgdsdsednsqeeeqygsrrarrtrtkgqsyavhsseteteseeeESQAAQVSFsrrgrmrkptaklrgle
MLLIIKYlekgpcheAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHgtsllvpnsvkvHNTVNVLRSREYSGPLSRSLMISSHktsllvpnsvkvhntvnvlrsreysgpLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLrfvsgsrdgTALIWYYKCSQWRFIRLDMNTCLPhtketsdetnkkIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDtellpdittnddghVEIVegserngerpveVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSaategtspsgtaptaqnknfvkrlplsqHKIVVERINAFAEIESEEfikeskklfdsstttqplvvkkekkkkvvrqartraeysehiqdqyedpdNLSLSGSEESASDSDQSQVDVSDLCESSsssggtsssdysdWIHEGvnleppkrvrrhtkvkpiqvslpkqlipeevPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSrlrsspwgnlilqepELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIarewnvgdrFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKeatepggslpVEPEEIQELLYhprpdewpqgdRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSeenshsdsssesgsssqsseedsededwtrhgkarrmpprrtnrvgtslgrqyrenpsdvsdydsGDRYAMRARqskqvqsvqagrrgqtivtsrtrgkqsynkfsgrgrgrkapesedevegeeeeesndqseeeeveenseeeeeeeavprrrpvrranvakvkravppapdtstsrlrsvrqngrakrtngrqsssllmtcsgdsdsednsqeeeqygsrrarrtrtkgqsyavhsseteteseeeesqaaqvsfsrrgrmrkptaklrgle
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPglksllsggsqsllrsEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINafaeieseefikeskKLFDSSTTTQPLvvkkekkkkvvRQARTRAEYSEHIQDQYEDPDNlslsgseesasdsdqsqvdvsdLCEsssssggtsssdysdWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDIsslseenshsdsssesgsssqsseedsededWTRHGKARRMPPRRTNRVGTSLGRQYRENPSDVSDYDSGDRYAMRARQSKQVQSVQAGRRGQTIVTSRTRGKQSYNKFSGRGRGRKAPesedevegeeeeesndqseeeeveenseeeeeeeavprrrpvrranvakvkravppapDTSTSRLRSVRQNGRAKRTNGRQSSSLLMTCsgdsdsednsqeeeQYGSRRARRTRTKGQSYAVHsseteteseeeesQAAQVSFSRRGRMRKPTAKLRGLE
*LLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKEL***************************SVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREY*******LMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTK******NKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNG*******************************************************YNDHGHVYIQTSHVHVL*****************************VKRLPLSQHKIVVERINAFAEIE********************************************************************************************************************IQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKP**TKSPFLGYKILWDN***************************************************DATCEKIITGLEEVMGLSVAEPFLVPVDI***************************************************************************************************************************************************************************************************************************************************************************************
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVH*********************TAPTAQNKNFVKRLPLSQHKIVVE**************************************************************************************************************************************************DWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSEENS*********************************************GRQYRE*PSD*SDYDSG*****************************************************************************************************************************************************************************************************************
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHV**********************PTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKL********************************HIQDQ*******************************************YSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLE*************SLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISS******************************************RTNRVGTSLGRQYRENPSDVSDYDSGDRYAM***********************************************************************************RPVRRANVAKV********************************SSLLM*************************************************************************
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKE********************************************************************WIHE*****************************EEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSE**************************************************************D**DRYAMRARQSKQVQSVQAGRRGQTIVTSR***********************************************************RPVRRAN**KVKRAVPP********************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKEKKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSEENSHSDSSSESGSSSQSSEEDSEDEDWTRHGKARRMPPRRTNRVGTSLGRQYRENPSDVSDYDSGDRYAMRARQSKQVQSVQAGRRGQTIVTSRTRGKQSYNKFSGRGRGRKAPESEDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPRRRPVRRANVAKVKRAVPPAPDTSTSRLRSVRQNGRAKRTNGRQSSSLLMTCSGDSDSEDNSQEEEQYGSRRARRTRTKGQSYAVHSSETETESEEEESQAAQVSFSRRGRMRKPTAKLRGLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1407 2.2.26 [Sep-21-2011]
Q921C3 2304 Bromodomain and WD repeat yes N/A 0.757 0.462 0.378 0.0
A2AHJ4 1799 Bromodomain and WD repeat no N/A 0.444 0.347 0.444 1e-161
Q9NSI6 2320 Bromodomain and WD repeat yes N/A 0.434 0.263 0.446 1e-161
Q6RI45 1802 Bromodomain and WD repeat no N/A 0.434 0.339 0.448 1e-160
Q8VDD9 1821 PH-interacting protein OS no N/A 0.447 0.345 0.441 1e-154
Q8WWQ0 1821 PH-interacting protein OS no N/A 0.561 0.433 0.386 1e-154
Q54MP8 2200 Bromodomain and WD repeat yes N/A 0.303 0.194 0.291 5e-50
Q008081356 Vegetative incompatibilit yes N/A 0.221 0.229 0.284 3e-21
Q8YTC21258 Uncharacterized WD repeat no N/A 0.247 0.276 0.240 8e-21
Q8YV571683 Uncharacterized WD repeat no N/A 0.222 0.185 0.248 2e-20
>sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 Back     alignment and function desciption
 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1238 (37%), Positives = 668/1238 (53%), Gaps = 172/1238 (13%)

Query: 2    LLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLP 61
             LI +YL  GPC  AA+VL   +E   LLP+R DWEG  H+++  E+  S+ +V    L 
Sbjct: 20   FLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLL 79

Query: 62   KICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLV 121
            +ICQR+GP+LDKE+ P+   + SLL  G QSLLR+ K    +V     + A   G    +
Sbjct: 80   QICQRIGPMLDKEVPPSISRVTSLLGAGRQSLLRTAKDCRHTVWKGSAFAALHRGRPPEM 139

Query: 122  PNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLS 181
            P        VN      Y  P                P+ V++H      R R+ +G  +
Sbjct: 140  P--------VN------YGPP----------------PSLVEIH------RGRQLTGCST 163

Query: 182  RFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLAT 241
                     Y +++ H   LGHLSAV+CV FD+ G  I TG+DD L+K+W   +G+LL+T
Sbjct: 164  FSTAFPGTMYQHIKMHRRILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLST 223

Query: 242  LRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEV 301
            LRG S EISD+A++  N L+AAG+ DK IR+W L+T AP++VL GH G IT + F P+  
Sbjct: 224  LRGHSAEISDMAVNYENTLIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQFSPMAK 283

Query: 302  NGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFL 361
                Y+ ST  DG + FW++ L+   S      P+ F E+ RPG   +LCSSFS GG+FL
Sbjct: 284  GPQRYMVSTGADGTVCFWQWDLE---SLKFSPRPLKFTEKPRPG-VQMLCSSFSVGGMFL 339

Query: 362  ATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYK 421
            ATGS DH +R+Y + G D+P  I E+E H+DKVDSIQ+ ++  RF+SGSRDGTA IW ++
Sbjct: 340  ATGSTDHVIRMYFL-GFDAPEKIAELESHTDKVDSIQFCNNGDRFLSGSRDGTARIWRFE 398

Query: 422  CSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFN 481
              +WR I LDM+  +     + +E   K KVTM+AW+  D  V+TA+N +  +K+W ++ 
Sbjct: 399  QLEWRSILLDMSARISGDTSSEEERFMKPKVTMIAWNQDDSTVVTAVN-DHVLKVWSSYT 457

Query: 482  GDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQG 541
            G L+  L GH +EVFVLE+HPFDSR++LSAGHDG I IWDI  +K    K + N++EGQG
Sbjct: 458  GQLLHNLLGHADEVFVLETHPFDSRIMLSAGHDGSIFIWDI--TKGIKMKHYFNMIEGQG 515

Query: 542  EGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFE 601
             GA+FD K+S DG   A TDS+GHLL++G G  K  + IP ++FFHTDYR L R +  + 
Sbjct: 516  HGAVFDCKFSQDGQHFACTDSHGHLLIFGFGCSKPYEKIPDQMFFHTDYRPLIRDSNNY- 574

Query: 602  PTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQR------------LVP--GRENADDTEL 647
               DE T   PHLMPPPFLVD++G P+P + QR            LVP  G     D E+
Sbjct: 575  -VLDEQTQQAPHLMPPPFLVDVDGNPHPTKFQRLVPGRENSADEHLVPQLGYVATSDGEV 633

Query: 648  LPDIT---TNDDGHVE----IVEG------------------SERNGERPVEVEGQRHYN 682
            +  I    TND G       +++G                     NG    E   +R   
Sbjct: 634  IEQIISLHTNDSGDASPESSVLDGMIRQLQQQQDQRLGVDQDGTANGLPSGEGTPRRGSF 693

Query: 683  DHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRL-------PLSQH 735
                + IQ+     LR     E        +P     T ++    KR        P    
Sbjct: 694  RRLSLDIQSPPNIGLRRSGQVEGVRQMHQNAPRSQIATERDLQAWKRRVVVPEAPPGMFR 753

Query: 736  KIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKEKKKKVVRQARTRAEYSEHIQ 795
            ++   RI    E  +   I   KK F     +  +V+  + +++  R  R  A YS    
Sbjct: 754  RLEDIRIERGEEERNLYVIGRKKKTFQVPQKSNSMVLVSQSRQRTCR--RKYANYSRRNA 811

Query: 796  DQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHE-------- 847
            DQ E    LS SG+E S S   ++  D S+         G+ SS+  +W ++        
Sbjct: 812  DQCE----LS-SGNESSGSVRHETSYDQSE---------GSCSSEDDEWRNDRRSGSDSD 857

Query: 848  ----------------GVNLEPP------KRVRRHTKVKPIQVSLP-------------- 871
                            G+NL+PP      +RV R       ++S+               
Sbjct: 858  SSSDSSSQYSDWTADTGINLQPPLRMSCRRRVTRFCSTSEDEMSMENISPPKRRRKRRKE 917

Query: 872  --------KQLIPEEVPDI-----YKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYV 918
                    +++ P E+ ++     + P  W+ +   +K+P+ PQMGDEVM+F+QG++ Y+
Sbjct: 918  SKPKRESLRRMTPAELANMEHLYEFHPPVWITDTTLRKSPFVPQMGDEVMYFRQGHEAYI 977

Query: 919  DAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKP-NGKLT 977
            +AVR   IYEL+  +  PW  + L++ ELVK+VG++YE+ PP +CCLKLA + P  G+LT
Sbjct: 978  EAVRRNNIYELNPHKE-PWRKMDLRDQELVKIVGLRYEVGPPTLCCLKLAFIDPATGRLT 1036

Query: 978  NEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEG----KPS 1033
            ++ F+I+YHDMPDVIDF VLRQ Y+ A  R W   DRF S+IDDAWW+GT+      +P 
Sbjct: 1037 DKSFSIRYHDMPDVIDFLVLRQFYDEARQRNWQPCDRFRSIIDDAWWFGTVLSQEPYQPQ 1096

Query: 1034 PTKSPFLGYKILWDNNERENLSPWDLEP-PKEGKEATEPGGSLPVEPEEIQELLYHPRPD 1092
               S F  Y + WDN E E LSPWD+EP P       E G S+ V  +E+++LLY P+  
Sbjct: 1097 YPDSHFQCYIVRWDNTETEKLSPWDMEPIPDNVDPPEELGASISVTSDELEKLLYKPQEG 1156

Query: 1093 EWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISS 1130
            EW Q  RD  C++II+G+++++ L +A  F  PVD+ +
Sbjct: 1157 EWGQRSRDEECDRIISGIDQLLNLDIAAAFAGPVDLCT 1194
May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Mus musculus (taxid: 10090)
>sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=2 SV=1 Back     alignment and function description
>sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 Back     alignment and function description
>sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 Back     alignment and function description
>sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 Back     alignment and function description
>sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 Back     alignment and function description
>sp|Q54MP8|Y5837_DICDI Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=4 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1407
328792422 1754 PREDICTED: PH-interacting protein [Apis 0.769 0.617 0.456 0.0
380022150 1755 PREDICTED: PH-interacting protein-like [ 0.769 0.617 0.459 0.0
340709156 1756 PREDICTED: PH-interacting protein-like [ 0.769 0.616 0.456 0.0
350413090 1760 PREDICTED: PH-interacting protein-like [ 0.769 0.614 0.456 0.0
383862427 1759 PREDICTED: PH-interacting protein-like [ 0.768 0.614 0.458 0.0
307214674 1777 Bromodomain and WD repeat-containing pro 0.769 0.609 0.451 0.0
307166542 1794 Bromodomain and WD repeat-containing pro 0.769 0.603 0.458 0.0
332023728 1807 PH-interacting protein [Acromyrmex echin 0.750 0.584 0.445 0.0
242019103 1552 WD repeat domain-containing protein, put 0.754 0.684 0.453 0.0
345481114 1881 PREDICTED: bromodomain and WD repeat-con 0.750 0.561 0.431 0.0
>gi|328792422|ref|XP_395863.4| PREDICTED: PH-interacting protein [Apis mellifera] Back     alignment and taxonomy information
 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1183 (45%), Positives = 748/1183 (63%), Gaps = 100/1183 (8%)

Query: 2    LLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLP 61
             LI K+L  GPC EAA VL   +E   +LP+R DWEG  H+QT  E+   + ++ ++ L 
Sbjct: 18   FLIAKFLAAGPCREAADVLKRELERAKVLPQRLDWEGHIHNQTFEELEKKYSHIGSNHLL 77

Query: 62   KICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLV 121
            +IC R+GP+L+KE+ P   G  SLL  G QSLLR+ + + + V +   Y  R  G   L 
Sbjct: 78   QICARIGPVLEKEVPPCISGAISLLGAGRQSLLRTHEDVQRQVHTITSYSGRLGGKPFL- 136

Query: 122  PNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSLLVPNSVKVHNTVNVLRSREYSGPLS 181
                                             SLLVPN       V+VL+ RE SGPLS
Sbjct: 137  -----------------------------DSPYSLLVPN------IVHVLQGRENSGPLS 161

Query: 182  RFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLAT 241
            R   I +  Y+ ++ +   LGHLSAV+CVLFD+ G+ I+TGADDLL+K+W + DG+LLAT
Sbjct: 162  RREAIPTKFYNKMQLYRHTLGHLSAVYCVLFDRTGKYIITGADDLLVKVWSSIDGRLLAT 221

Query: 242  LRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEV 301
             RG S EI DIA++  N LLAAG++D+ +R+W  QT++P++VL GH G+IT VNFCP+  
Sbjct: 222  FRGASAEIMDIAVNFDNTLLAAGSLDRILRVWCFQTMSPVAVLSGHSGMITSVNFCPISC 281

Query: 302  NGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFL 361
            NG  YL STSTDG + FW +    +       +P+ ++E++RPG A ++C+SFSPGG F+
Sbjct: 282  NGVYYLVSTSTDGSVAFWSHTKKGNERAIFQPKPIQYHEKMRPGQAQMICASFSPGGAFM 341

Query: 362  ATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYK 421
            A GS DHHVRVY M G + P  +LEVE HSD VDSIQW+H+ L+F+SGS+DGTA +W+++
Sbjct: 342  AAGSADHHVRVYSMLGDEGPCRVLEVEAHSDTVDSIQWAHNGLKFISGSKDGTANVWHFE 401

Query: 422  CSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFN 481
              QW + RL M T LP   ET D++NKK KVTMV+WD SD WVITA+N +  +K+W+A +
Sbjct: 402  QQQWMYKRLLMTTKLPGESETEDDSNKKAKVTMVSWDVSDEWVITAVN-DSCLKVWNAKS 460

Query: 482  GDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQG 541
            G+LV++L+GH +EVFVLESHP D RV+LSAGHDG +IIWD+L+++      F N +EGQG
Sbjct: 461  GELVKILRGHKDEVFVLESHPIDPRVILSAGHDGQLIIWDVLNTEP--IACFQNFIEGQG 518

Query: 542  EGALFDGKWSPDGTTCALTDSYGHLLVYGLG-GFKRPQNIPRELFFHTDYRTLNRPNGLF 600
             GA+FD KWSPDGT  A TDS+GHLL+YG G G ++ + +P+ELFFHTDYR L R    +
Sbjct: 519  NGAVFDAKWSPDGTMLAATDSHGHLLIYGFGSGVEKLKIVPKELFFHTDYRPLIRDANNY 578

Query: 601  EPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVE 660
                DE T   PHLMPPPFLVD++G PYPP +QRLVPGREN    +L+P+I     G  E
Sbjct: 579  --VLDEQTQTAPHLMPPPFLVDVDGNPYPPALQRLVPGRENCRGEQLVPNIAVGAGGMQE 636

Query: 661  IVEG-----SERNGERPVEVEGQRH--------YNDHGHVYIQTSHVHVLR----SRANG 703
            ++EG        N ++ +E   QR           D          V  +     SR+  
Sbjct: 637  VIEGLPAQEPRSNIDQLIEALAQRQNINADAESAADEREENAAEQPVRQMASPRGSRSGL 696

Query: 704  ESSAATEGTSPSG-----TAPTAQNKNFVKR-LPLSQHKIVVERINAFAEIESEEFIKES 757
              +   EG   S         T  NK  + R +  +  +  ++ ++A AE+E E   +E 
Sbjct: 697  RRAGDVEGVRQSSGNWQRDNTTPWNKPILARPMNPAVRETQIKVLHATAEMELENLKREM 756

Query: 758  KKL---FDSSTTTQPLV---VKKEKKKKVVRQA-RTRAEYSEHIQ-DQYEDPDNLSLSGS 809
            +K      ++  T+  +   +   K+ +  R   RTRA   E  + D +E+PDN+  +GS
Sbjct: 757  RKRPQPVSNTANTEDNIGSRIANRKRNRTTRHGYRTRATRGEEQEDDDFENPDNVGTTGS 816

Query: 810  EESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHE-GVNLEPPKRVRRHTKVKPIQV 868
              S++ +D +  +  DLC  SS+S   SS++YSDWI + G+NLEPPKR +R   VK   +
Sbjct: 817  SASSNSNDSTAHE-EDLCSDSSTS--ESSTEYSDWIADHGLNLEPPKRSKRK-PVKKRSL 872

Query: 869  SLP------------KQLIP-----EEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFK 911
            + P            K+ IP     +++PD+++PS+WL E++P+KAPYYPQMGDE+++F+
Sbjct: 873  TPPSDMDRRRNRRPRKKDIPLSTGIDDIPDVFRPSEWLTEIIPRKAPYYPQMGDEIVYFR 932

Query: 912  QGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMK 971
            QG+Q Y+DAVR+K +YEL   R  PW  + ++  E VKVVGIKYEI PPR+CCLKLA+M 
Sbjct: 933  QGHQFYLDAVRNKKVYELG-PRCEPWNKVNIRAQEFVKVVGIKYEIRPPRLCCLKLALMD 991

Query: 972  PNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEG- 1030
             +G+LT E F IKYHDM DV+DF VLRQ ++TA+AR W+ GDRF  MIDD WW G I+  
Sbjct: 992  EDGRLTGENFTIKYHDMADVLDFLVLRQTFDTALARSWSEGDRFRCMIDDGWWMGQIQSM 1051

Query: 1031 KPSPTKSP---FLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLY 1087
            +P     P   F+ +++ WDN E E +SPWDLEP  E +   E GG++PV PEEI+ +LY
Sbjct: 1052 EPLDEDFPESFFMCFRVRWDNGEYERMSPWDLEPIDENRLPAELGGAVPVLPEEIRTILY 1111

Query: 1088 HPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISS 1130
             P  +EWP GDR+ATC +II GL++VM L++AEPF+ PVD+++
Sbjct: 1112 QPHAEEWPMGDREATCRRIIRGLDQVMSLAIAEPFMAPVDLNA 1154

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380022150|ref|XP_003694916.1| PREDICTED: PH-interacting protein-like [Apis florea] Back     alignment and taxonomy information
>gi|340709156|ref|XP_003393179.1| PREDICTED: PH-interacting protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413090|ref|XP_003489876.1| PREDICTED: PH-interacting protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862427|ref|XP_003706685.1| PREDICTED: PH-interacting protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307214674|gb|EFN89603.1| Bromodomain and WD repeat-containing protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307166542|gb|EFN60609.1| Bromodomain and WD repeat-containing protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023728|gb|EGI63952.1| PH-interacting protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242019103|ref|XP_002430005.1| WD repeat domain-containing protein, putative [Pediculus humanus corporis] gi|212515063|gb|EEB17267.1| WD repeat domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345481114|ref|XP_001606427.2| PREDICTED: bromodomain and WD repeat-containing protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1407
FB|FBgn0011785 2232 BRWD3 "BRWD3" [Drosophila mela 0.376 0.237 0.495 1.5e-226
MGI|MGI:3029414 1799 Brwd3 "bromodomain and WD repe 0.358 0.280 0.498 1.6e-209
UNIPROTKB|F1N1C9 1658 BRWD3 "Uncharacterized protein 0.352 0.299 0.496 9.4e-209
RGD|1559445 1799 Brwd3 "bromodomain and WD repe 0.358 0.280 0.498 1.5e-207
UNIPROTKB|Q6RI45 1802 BRWD3 "Bromodomain and WD repe 0.357 0.279 0.500 4.8e-206
UNIPROTKB|F1N8L6 1495 BRWD3 "Uncharacterized protein 0.359 0.338 0.486 3.8e-202
UNIPROTKB|E1BSG1 2293 BRWD1 "Uncharacterized protein 0.348 0.214 0.490 7.5e-197
MGI|MGI:1890651 2304 Brwd1 "bromodomain and WD repe 0.343 0.210 0.483 3.4e-196
ZFIN|ZDB-GENE-050208-261 1805 phip "pleckstrin homology doma 0.376 0.293 0.487 4.5e-196
UNIPROTKB|F1MPF7 1759 PHIP "Uncharacterized protein" 0.379 0.303 0.462 1.3e-193
FB|FBgn0011785 BRWD3 "BRWD3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1336 (475.4 bits), Expect = 1.5e-226, Sum P(5) = 1.5e-226
 Identities = 272/549 (49%), Positives = 367/549 (66%)

Query:   123 NSVKVHNTVNVLRSREYSGPLSRSLM-ISSHKTSLLVPNSV---KVHNTVNVLRSREYSG 178
             NS+      N+LR++E +    RSL    +    + +P+SV     HN   VL  RE+ G
Sbjct:    99 NSLLGTGRQNLLRTKE-TVYCHRSLRDYCTRLNGVSLPDSVLTKPTHNLDRVLTGREHGG 157

Query:   179 PLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKL 238
              + R L++ +  Y   +     +GHLS+V+CVLFD+ G  I+TGADDLLIK+W A DG+L
Sbjct:   158 EVRRKLLVPTDLYRRTKLLRRTVGHLSSVYCVLFDRTGRYIITGADDLLIKIWSAADGRL 217

Query:   239 LATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCP 298
             LATLRG S EI+DIAI+  N +LAAG++D  +R+W++QT +PI+VL  H G+IT VNFCP
Sbjct:   218 LATLRGASSEITDIAINLDNTMLAAGSLDHILRVWDMQTTSPIAVLSAHTGMITSVNFCP 277

Query:   299 LEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGG 358
                +   YL +TSTDG I FW+Y        T   +P  ++E++RPG A ++C++FSPGG
Sbjct:   278 SPRSDLKYLVTTSTDGSIAFWQYSTPRGQKITFAPKPTQYHEKLRPGQAQMMCTTFSPGG 337

Query:   359 LFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIW 418
             +FLA GS DHHVRVY M G D P  ILE E ++D VDS+QWSH  LRF+SGS+DGTA IW
Sbjct:   338 IFLAAGSADHHVRVYMM-GEDGPKRILETEAYTDAVDSVQWSHRGLRFISGSKDGTAHIW 396

Query:   419 YYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWD 478
              ++  QW+  +L M   L    E   E  K++KVTMVAWDASDR+VITA+N +F IKIWD
Sbjct:   397 TFESQQWKSSKLCMTERLASCPEP--EEGKRLKVTMVAWDASDRYVITAVN-DFTIKIWD 453

Query:   479 AFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGY--KWFHNI 536
             + +  L +VL+GH +E++VLES+P D  VLLSAGHDG + +WDI    ++G     F N 
Sbjct:   454 SKSAKLHRVLRGHKDELYVLESNPRDEHVLLSAGHDGQVFLWDI----EQGVCVANFLND 509

Query:   537 VEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGG-FKRPQNIPRELFFHTDYRTLNR 595
             ++GQG G++FD KWSPDGT  A TDS+GH+L++GLG   ++ + +P ELFFHTD+R L R
Sbjct:   510 IDGQGHGSVFDAKWSPDGTMIAATDSHGHILIFGLGVCIEKYKMLPTELFFHTDFRPLLR 569

Query:   596 PNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTND 655
                      DE T + PHLMPPPFLVD +G P+P   QR VPGRE+    +L+P++T   
Sbjct:   570 DAQ--HHVVDEQTQIMPHLMPPPFLVDADGNPHPSRFQRFVPGRESCSLDQLIPNLTVGV 627

Query:   656 DGHVEIVEG 664
             DG V I +G
Sbjct:   628 DG-VVIDDG 635
GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IGI
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
MGI|MGI:3029414 Brwd3 "bromodomain and WD repeat domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1C9 BRWD3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1559445 Brwd3 "bromodomain and WD repeat domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6RI45 BRWD3 "Bromodomain and WD repeat-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8L6 BRWD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSG1 BRWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1890651 Brwd1 "bromodomain and WD repeat domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-261 phip "pleckstrin homology domain interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPF7 PHIP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1407
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-49
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-37
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-34
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-30
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-18
smart0032040 smart00320, WD40, WD40 repeats 3e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 7e-06
smart0032040 smart00320, WD40, WD40 repeats 5e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-05
smart0032040 smart00320, WD40, WD40 repeats 1e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 5e-04
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 5e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 6e-04
smart0032040 smart00320, WD40, WD40 repeats 9e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
pfam03344 715 pfam03344, Daxx, Daxx Family 0.003
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score =  176 bits (449), Expect = 3e-49
 Identities = 95/320 (29%), Positives = 148/320 (46%), Gaps = 37/320 (11%)

Query: 202 GHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILL 261
           GH   V CV F   G+++ TG+ D  IK+W    G+LL TL+G +G + D+A       L
Sbjct: 7   GHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYL 66

Query: 262 AAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKY 321
           A+G+ DKTIR+W+L+T   +  L GH   ++ V F P        L+S+S D  I  W  
Sbjct: 67  ASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDG----RILSSSSRDKTIKVW-- 120

Query: 322 KLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSP 381
             D++  K +          +R     +   +FSP G F+A+ S D  ++++ +      
Sbjct: 121 --DVETGKCLT--------TLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRT-GKC 169

Query: 382 LGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKE 441
           +  L    H+ +V+S+ +S    + +S S DGT  +W     +       + T   H   
Sbjct: 170 VATL--TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKC------LGTLRGHENG 221

Query: 442 TSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESH 501
                     V  VA+      + +  + +  I++WD   G+ VQ L GHTN V  L   
Sbjct: 222 ----------VNSVAFSPDGYLLASG-SEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWS 270

Query: 502 PFDSRVLLSAGHDGLIIIWD 521
           P D + L S   DG I IWD
Sbjct: 271 P-DGKRLASGSADGTIRIWD 289

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1407
KOG0644|consensus1113 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0273|consensus524 100.0
KOG0272|consensus459 100.0
KOG0319|consensus775 100.0
KOG0291|consensus893 100.0
KOG0286|consensus343 100.0
KOG0272|consensus459 100.0
KOG0318|consensus603 100.0
KOG0306|consensus888 100.0
KOG0319|consensus775 100.0
KOG0318|consensus603 100.0
KOG0291|consensus893 100.0
KOG0279|consensus315 100.0
KOG0293|consensus519 100.0
KOG0296|consensus399 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0265|consensus338 100.0
KOG0285|consensus460 100.0
KOG0295|consensus406 100.0
KOG0306|consensus888 99.98
KOG0645|consensus312 99.98
KOG0315|consensus311 99.97
KOG0273|consensus524 99.97
KOG0284|consensus464 99.97
KOG0282|consensus503 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0263|consensus707 99.97
KOG0296|consensus399 99.97
KOG0276|consensus794 99.97
KOG0266|consensus456 99.97
KOG0284|consensus464 99.97
KOG0295|consensus406 99.97
KOG0292|consensus1202 99.97
KOG0281|consensus499 99.97
KOG0645|consensus312 99.96
KOG0263|consensus707 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0316|consensus307 99.96
KOG0275|consensus508 99.96
KOG0281|consensus499 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0292|consensus1202 99.96
KOG0282|consensus503 99.96
KOG0266|consensus456 99.96
KOG0276|consensus794 99.96
KOG0293|consensus519 99.95
KOG1539|consensus910 99.95
KOG0313|consensus423 99.95
KOG0265|consensus338 99.95
KOG0643|consensus327 99.95
KOG1408|consensus1080 99.95
KOG0772|consensus641 99.95
KOG1539|consensus910 99.95
KOG0278|consensus334 99.95
KOG0313|consensus423 99.94
KOG0288|consensus459 99.94
KOG1446|consensus311 99.94
KOG1407|consensus313 99.94
KOG0973|consensus942 99.94
KOG0274|consensus537 99.94
KOG0278|consensus334 99.94
KOG0640|consensus430 99.94
KOG0285|consensus460 99.94
KOG0643|consensus327 99.94
KOG0305|consensus484 99.93
KOG0289|consensus506 99.93
KOG1407|consensus313 99.93
KOG0308|consensus735 99.93
KOG0772|consensus641 99.93
KOG0283|consensus712 99.93
KOG2106|consensus626 99.93
KOG0640|consensus430 99.92
KOG0275|consensus508 99.92
KOG0310|consensus487 99.92
KOG1063|consensus764 99.92
KOG0299|consensus479 99.92
KOG1446|consensus311 99.92
PTZ00421493 coronin; Provisional 99.92
KOG0268|consensus433 99.92
KOG1408|consensus1080 99.92
KOG0300|consensus481 99.92
KOG0641|consensus350 99.92
KOG0277|consensus311 99.92
KOG0274|consensus537 99.92
KOG2048|consensus691 99.91
KOG0283|consensus712 99.91
KOG2096|consensus420 99.91
KOG0647|consensus347 99.91
KOG0301|consensus745 99.91
KOG0277|consensus311 99.91
KOG0268|consensus433 99.91
PTZ00421493 coronin; Provisional 99.9
KOG0973|consensus942 99.9
KOG0288|consensus459 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
PTZ00420568 coronin; Provisional 99.9
PTZ00420568 coronin; Provisional 99.9
KOG2106|consensus626 99.9
KOG0316|consensus307 99.9
KOG1332|consensus299 99.9
KOG0294|consensus362 99.89
KOG0308|consensus735 99.89
KOG1273|consensus405 99.89
KOG2048|consensus691 99.89
KOG0646|consensus476 99.89
KOG0647|consensus347 99.89
KOG0294|consensus362 99.89
KOG0310|consensus487 99.89
KOG0305|consensus484 99.89
KOG0289|consensus506 99.88
KOG0301|consensus745 99.88
KOG0299|consensus479 99.88
KOG1036|consensus323 99.88
KOG1036|consensus323 99.88
KOG2096|consensus420 99.88
KOG1063|consensus764 99.88
KOG0300|consensus481 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG1445|consensus1012 99.88
KOG0641|consensus350 99.87
KOG0639|consensus705 99.87
KOG1274|consensus933 99.87
KOG0269|consensus839 99.87
KOG4283|consensus397 99.87
KOG2445|consensus361 99.86
KOG0646|consensus476 99.86
KOG0264|consensus422 99.86
KOG0264|consensus422 99.86
KOG0650|consensus733 99.86
KOG0321|consensus720 99.86
KOG4283|consensus397 99.85
KOG0639|consensus705 99.85
KOG2055|consensus514 99.84
KOG2055|consensus514 99.84
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG1274|consensus933 99.83
KOG1538|consensus1081 99.83
COG2319466 FOG: WD40 repeat [General function prediction only 99.83
KOG4328|consensus498 99.83
KOG1332|consensus299 99.82
KOG0267|consensus825 99.82
KOG4328|consensus498 99.81
KOG1273|consensus405 99.8
KOG0321|consensus720 99.8
KOG1445|consensus1012 99.8
KOG0270|consensus463 99.8
KOG0267|consensus825 99.8
KOG0269|consensus839 99.79
KOG1963|consensus792 99.79
KOG0302|consensus440 99.78
KOG0307|consensus1049 99.78
KOG1009|consensus434 99.78
KOG4227|consensus609 99.78
PF0650783 Auxin_resp: Auxin response factor; InterPro: IPR01 99.78
KOG1034|consensus385 99.77
KOG1963|consensus792 99.77
KOG2445|consensus361 99.77
KOG0322|consensus323 99.76
KOG0302|consensus440 99.76
KOG4378|consensus673 99.76
KOG0307|consensus1049 99.76
KOG0650|consensus733 99.76
KOG1034|consensus385 99.76
KOG4378|consensus673 99.76
KOG0270|consensus463 99.75
KOG1188|consensus376 99.72
KOG1587|consensus555 99.72
KOG2919|consensus406 99.71
KOG2919|consensus406 99.71
KOG1538|consensus1081 99.7
KOG0290|consensus364 99.7
KOG0642|consensus577 99.69
KOG0642|consensus577 99.69
KOG1188|consensus376 99.68
KOG1009|consensus434 99.68
KOG1587|consensus555 99.68
PRK11028330 6-phosphogluconolactonase; Provisional 99.68
KOG4227|consensus609 99.67
PRK11028330 6-phosphogluconolactonase; Provisional 99.65
KOG0303|consensus472 99.65
KOG4497|consensus447 99.64
KOG1240|consensus1431 99.64
KOG1334|consensus559 99.64
KOG1007|consensus370 99.64
KOG1517|consensus1387 99.63
KOG1517|consensus1387 99.63
KOG0322|consensus323 99.62
KOG1007|consensus370 99.62
KOG0649|consensus325 99.62
KOG1334|consensus559 99.62
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.6
KOG1310|consensus758 99.59
KOG1523|consensus361 99.58
KOG1523|consensus361 99.58
KOG4497|consensus447 99.56
KOG2110|consensus391 99.56
KOG0303|consensus472 99.56
PRK01742429 tolB translocation protein TolB; Provisional 99.54
KOG1524|consensus737 99.54
KOG1524|consensus737 99.54
KOG0290|consensus364 99.53
KOG0771|consensus398 99.53
KOG0771|consensus398 99.52
KOG2315|consensus566 99.51
KOG1832|consensus1516 99.5
KOG2110|consensus391 99.5
KOG0649|consensus325 99.49
PRK01742429 tolB translocation protein TolB; Provisional 99.47
KOG1310|consensus758 99.47
KOG1354|consensus433 99.46
KOG1240|consensus1431 99.44
KOG2139|consensus445 99.43
KOG1272|consensus545 99.42
KOG2321|consensus703 99.39
KOG2139|consensus445 99.39
PRK03629429 tolB translocation protein TolB; Provisional 99.39
KOG0644|consensus1113 99.39
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.39
KOG2321|consensus703 99.38
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.37
PRK02889427 tolB translocation protein TolB; Provisional 99.37
KOG2394|consensus636 99.37
PRK03629429 tolB translocation protein TolB; Provisional 99.36
KOG2111|consensus346 99.35
PRK04922433 tolB translocation protein TolB; Provisional 99.33
KOG1912|consensus1062 99.32
PRK04922433 tolB translocation protein TolB; Provisional 99.32
PRK05137435 tolB translocation protein TolB; Provisional 99.32
KOG1272|consensus545 99.31
KOG2111|consensus346 99.3
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.29
KOG1409|consensus404 99.28
KOG3881|consensus412 99.26
PRK02889427 tolB translocation protein TolB; Provisional 99.24
KOG0974|consensus967 99.23
KOG1354|consensus433 99.22
PRK05137435 tolB translocation protein TolB; Provisional 99.22
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.2
KOG2394|consensus636 99.2
KOG0974|consensus967 99.2
COG4946668 Uncharacterized protein related to the periplasmic 99.2
KOG2041|consensus1189 99.2
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.18
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.16
KOG2315|consensus566 99.15
KOG2314|consensus698 99.14
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.14
KOG3881|consensus412 99.13
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.13
PRK04792448 tolB translocation protein TolB; Provisional 99.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.09
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.08
PRK00178430 tolB translocation protein TolB; Provisional 99.07
PRK00178430 tolB translocation protein TolB; Provisional 99.07
KOG1409|consensus404 99.05
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.05
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.02
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.02
PRK01029428 tolB translocation protein TolB; Provisional 99.02
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.99
KOG4547|consensus541 98.98
KOG1912|consensus1062 98.96
KOG2041|consensus1189 98.95
PRK04792448 tolB translocation protein TolB; Provisional 98.95
PRK01029428 tolB translocation protein TolB; Provisional 98.94
COG4946668 Uncharacterized protein related to the periplasmic 98.92
KOG1064|consensus2439 98.91
KOG2314|consensus698 98.9
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.87
KOG4547|consensus541 98.86
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.85
KOG4190|consensus1034 98.84
KOG0309|consensus1081 98.84
KOG0280|consensus339 98.84
KOG1064|consensus2439 98.83
KOG4190|consensus1034 98.83
KOG4532|consensus344 98.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.78
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.74
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.73
KOG4714|consensus319 98.69
KOG0280|consensus339 98.67
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.67
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.64
KOG0309|consensus1081 98.61
KOG0882|consensus558 98.55
KOG1832|consensus1516 98.52
KOG1645|consensus463 98.5
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.47
KOG4532|consensus344 98.45
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.44
KOG3914|consensus390 98.43
KOG0882|consensus558 98.4
PRK04043419 tolB translocation protein TolB; Provisional 98.36
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.32
PRK04043419 tolB translocation protein TolB; Provisional 98.3
KOG1920|consensus1265 98.28
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.27
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.23
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.2
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.2
KOG1275|consensus1118 98.19
KOG3914|consensus390 98.19
KOG1920|consensus1265 98.14
KOG4649|consensus354 98.12
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.11
KOG1275|consensus1118 98.08
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.07
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.05
KOG2114|consensus933 98.04
KOG4714|consensus319 98.04
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.04
KOG2695|consensus425 98.02
PRK02888635 nitrous-oxide reductase; Validated 98.01
KOG2066|consensus846 98.01
KOG2114|consensus933 98.0
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.98
KOG2066|consensus846 97.96
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.95
KOG1645|consensus463 97.92
KOG3617|consensus 1416 97.87
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.8
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.8
KOG3621|consensus726 97.8
KOG4649|consensus354 97.79
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.77
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.77
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.75
KOG2695|consensus425 97.73
KOG1897|consensus1096 97.7
KOG2276|consensus473 97.7
KOG3621|consensus726 97.69
PRK02888635 nitrous-oxide reductase; Validated 97.58
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.55
KOG1008|consensus783 97.49
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.45
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.37
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.35
KOG3617|consensus 1416 97.34
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.25
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.23
KOG1008|consensus783 97.21
COG3391381 Uncharacterized conserved protein [Function unknow 97.2
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.16
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.16
COG3391381 Uncharacterized conserved protein [Function unknow 97.12
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.07
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.07
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.05
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.05
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.02
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.02
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.0
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.96
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.85
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.84
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.83
KOG1897|consensus1096 96.78
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.77
KOG2079|consensus1206 96.69
KOG4640|consensus665 96.66
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.66
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.55
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.53
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.49
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.47
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.41
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.17
KOG2079|consensus1206 96.02
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.93
PRK13616591 lipoprotein LpqB; Provisional 95.82
PRK10115686 protease 2; Provisional 95.76
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.72
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.68
KOG2444|consensus238 95.57
KOG3630|consensus 1405 95.57
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.57
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.52
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.5
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.38
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.34
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.33
PRK13616591 lipoprotein LpqB; Provisional 95.18
PF14727418 PHTB1_N: PTHB1 N-terminus 95.15
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.12
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.08
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.04
KOG3630|consensus 1405 95.03
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.02
COG5276370 Uncharacterized conserved protein [Function unknow 95.0
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 94.88
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.6
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.58
PRK10115686 protease 2; Provisional 94.38
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.38
PHA02713557 hypothetical protein; Provisional 94.37
KOG4499|consensus310 94.25
PHA02713557 hypothetical protein; Provisional 94.25
PRK13684334 Ycf48-like protein; Provisional 94.23
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.23
KOG4640|consensus665 94.13
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.92
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.74
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.66
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 93.5
KOG4441|consensus571 93.44
KOG2395|consensus644 93.41
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.38
PF0851327 LisH: LisH; InterPro: IPR013720 The LisH motif is 93.12
KOG4441|consensus571 92.86
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.62
PF15390671 DUF4613: Domain of unknown function (DUF4613) 92.61
PHA03098534 kelch-like protein; Provisional 92.55
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.43
KOG4499|consensus310 92.24
KOG2444|consensus238 92.15
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.92
KOG2395|consensus644 91.81
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.7
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 91.6
PF15390671 DUF4613: Domain of unknown function (DUF4613) 91.58
COG5276370 Uncharacterized conserved protein [Function unknow 91.43
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 91.33
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 91.29
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 91.29
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 91.06
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.74
KOG2377|consensus657 90.72
KOG2280|consensus829 90.41
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 90.17
PHA03098534 kelch-like protein; Provisional 90.12
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 89.96
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 89.9
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 89.52
KOG4460|consensus741 89.04
KOG1898|consensus1205 89.01
COG3823262 Glutamine cyclotransferase [Posttranslational modi 89.0
KOG4659|consensus 1899 88.49
PRK13684334 Ycf48-like protein; Provisional 88.33
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 88.16
KOG2280|consensus829 87.74
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 87.56
PHA02790480 Kelch-like protein; Provisional 87.26
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.25
smart0074361 Agenet Tudor-like domain present in plant sequence 87.2
COG3292671 Predicted periplasmic ligand-binding sensor domain 86.99
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 86.97
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 86.89
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 86.8
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 86.71
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 86.12
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 85.88
KOG2377|consensus657 85.39
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 85.37
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 85.33
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 85.22
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 84.72
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 84.11
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 83.98
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 83.97
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 83.95
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 83.76
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 83.5
PRK07079469 hypothetical protein; Provisional 83.15
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 83.13
KOG1916|consensus1283 82.69
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 82.65
PLN02153341 epithiospecifier protein 82.33
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.33
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 82.32
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 82.16
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 81.94
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 81.48
KOG1916|consensus 1283 81.26
PRK05111383 acetylornithine deacetylase; Provisional 81.15
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 81.12
KOG4460|consensus741 80.68
KOG1983|consensus993 80.67
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 80.53
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 80.46
KOG1900|consensus1311 80.44
TIGR01886466 dipeptidase dipeptidase PepV. This model represent 80.34
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 80.21
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 80.15
PRK06446436 hypothetical protein; Provisional 80.08
>KOG0644|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.3e-129  Score=1142.43  Aligned_cols=986  Identities=30%  Similarity=0.489  Sum_probs=780.5

Q ss_pred             ChhhHHHHhcCChHHHHHHHHHHHHhcCCCCcccC-CCCCcccchhhhhhccCCCCCCCcHHHHHHHhccccccccCCC-
Q psy6522           1 MLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYD-WEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPN-   78 (1407)
Q Consensus         1 ~~LI~r~L~~g~~~~Aa~~L~~El~~~~llp~r~d-~~G~~~~~t~~~l~~~~~~i~~~~L~~l~q~l~~ll~~~~p~~-   78 (1407)
                      ||||++||+.|||++|+.+|+.|++++++||.|++ |.++++...++.++..|.||.++||++||++|++.+++..|+. 
T Consensus        19 yflil~~lS~gPcert~~vl~~elee~~ll~pr~~~W~sn~~~dd~eslvls~~hI~kdhll~i~kqlv~~~d~~~pp~~   98 (1113)
T KOG0644|consen   19 YFLILHYLSAGPCERTAQVLRQELEEYSLLPPRYHDWESNSGNDDGESLVLSYKHIAKDHLLQILKQLVPMLDKPIPPRY   98 (1113)
T ss_pred             HHHHHhhcccCchhhcchhhhhhhhhhhccCccccccccCCCCcccceeeccccccchHHHHHHHHHhccCcCCCCCcce
Confidence            89999999999999999999999999988866655 9999999999999999999999999999999999999999997 


Q ss_pred             --CCCCccccccCcchhhccccccccccccchhhhhhhcCCCccccccceeeccccccccccccCCCcceEEEcCCCcce
Q psy6522          79 --FPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKTSL  156 (1407)
Q Consensus        79 --~~~~~sLl~~g~~sLLr~~k~~~~~~~~~~~~~a~~~g~P~~~p~~~~v~ni~~~v~s~~~~~p~~~~~~issh~~~i  156 (1407)
                        +.+++||||.|+|+|++..+.|...+|.++.+...|-+.++..++.                                
T Consensus        99 ~~~a~vpTlLgtg~qsLl~r~k~~~~~~~~~s~~~~~h~~~~~~~~~s--------------------------------  146 (1113)
T KOG0644|consen   99 CTIARVPTLLGTGRQSLLRRAKDIRHTVWKGSAFRWPHMHADQVRGVS--------------------------------  146 (1113)
T ss_pred             eeeecccchhcchhHHHHhhhhhcccccccccccccccccCcccccce--------------------------------
Confidence              8899999999999999999999999999999999999988888864                                


Q ss_pred             eecccccccceeeeecceeeeccCCceEEEecCCCCceeEEEEEcCCCCCEEEEEEcCCCCEEEEEECCCeEEEEEcCCC
Q psy6522         157 LVPNSVKVHNTVNVLRSREYSGPLSRFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDG  236 (1407)
Q Consensus       157 l~~~~~~~~n~~~vl~~r~~tg~~~~~~~i~~~~~~~~~~~~~L~GH~~~V~~vafSpdG~~LaTGS~DG~V~IWDl~tg  236 (1407)
                          .....+.+.++......++....+..+...+++++.++.|.||.++|+|++|+..|.+|+||+.|..|+||+..++
T Consensus       147 ----l~s~~~~~~~h~~a~~i~~at~~~akPgtmvqkmk~ikrLlgH~naVyca~fDrtg~~Iitgsdd~lvKiwS~et~  222 (1113)
T KOG0644|consen  147 ----LRSIGGGFEIHHRAPSIGCATFSIAKPGTMVQKMKNIKRLLGHRNAVYCAIFDRTGRYIITGSDDRLVKIWSMETA  222 (1113)
T ss_pred             ----eccCCcchhhhhcCcccccceeeecCcHHHHHHHHHHHHHHhhhhheeeeeeccccceEeecCccceeeeeeccch
Confidence                1222333333444445555666666677778899999999999999999999999999999999999999999999


Q ss_pred             cEEEEEeCCCCCeEEEEEcCCCCEEEEEECCCeEEEEeCCCCceEEEEeccCCceEEEEeccCCCCCceEEEEEecCCce
Q psy6522         237 KLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCI  316 (1407)
Q Consensus       237 ~~l~tl~gH~~~ItsLafSpDg~lLaSgs~DGtIrVWDl~tg~~v~~l~~H~~~VtsLafspd~~~~~~~LaSgs~DGtI  316 (1407)
                      .++.+++||.+.|+.++.+.++.++++++.|..|+||.+.++.++..+.+|++.|++|+|+|.        .+.+.||++
T Consensus       223 ~~lAs~rGhs~ditdlavs~~n~~iaaaS~D~vIrvWrl~~~~pvsvLrghtgavtaiafsP~--------~sss~dgt~  294 (1113)
T KOG0644|consen  223 RCLASCRGHSGDITDLAVSSNNTMIAAASNDKVIRVWRLPDGAPVSVLRGHTGAVTAIAFSPR--------ASSSDDGTC  294 (1113)
T ss_pred             hhhccCCCCccccchhccchhhhhhhhcccCceEEEEecCCCchHHHHhccccceeeeccCcc--------ccCCCCCce
Confidence            999999999999999999999999999999999999999999999999999999999999994        378899999


Q ss_pred             eEEeeccccccceeeeccccccccccCCCCcceEEEEECCCCceEEEeeCCceEEEEeccCCCCCceeEEEeecCCCcce
Q psy6522         317 GFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDS  396 (1407)
Q Consensus       317 ~vWDl~t~~~~~~~~~~~~~~~~~~~~~h~~~I~~vafSpdg~~Lasgs~DG~I~IwDl~~~~~~~~i~~l~~h~~~V~s  396 (1407)
                      ++||.+-.   .......|..+...                                                  ..+.+
T Consensus       295 ~~wd~r~~---~~~y~prp~~~~~~--------------------------------------------------~~~~s  321 (1113)
T KOG0644|consen  295 RIWDARLE---PRIYVPRPLKFTEK--------------------------------------------------DLVDS  321 (1113)
T ss_pred             Eecccccc---ccccCCCCCCcccc--------------------------------------------------cceee
Confidence            99998722   11111111111110                                                  12334


Q ss_pred             EEEcCCCCEEEEEeCCCeEEEEEccCCceEEeeeccCcCCCCCccccccccccccEEEEEECCCC-CEEEEEEecCCeEE
Q psy6522         397 IQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASD-RWVITAINFNFQIK  475 (1407)
Q Consensus       397 IafSpdg~~LaSgs~DGtI~IWDl~t~~~~~~~l~~~~~~~~~~~~~~~~~~~~~VtslafSpdg-~~Lasgs~~DG~I~  475 (1407)
                      +.|..++..+++|+.|+....|.+....|...                      .+..+.++.+- .+.+++-. +..+.
T Consensus       322 ~~~~~~~~~f~Tgs~d~ea~n~e~~~l~~~~~----------------------~lif~t~ssd~~~~~~~ar~-~~~~~  378 (1113)
T KOG0644|consen  322 ILFENNGDRFLTGSRDGEARNHEFEQLAWRSN----------------------LLIFVTRSSDLSSIVVTARN-DHRLC  378 (1113)
T ss_pred             eeccccccccccccCCcccccchhhHhhhhcc----------------------ceEEEeccccccccceeeee-eeEee
Confidence            44555555666666666666665443322211                      11111122121 34444555 88999


Q ss_pred             EEECCCCceEEEEecCCCCeEEEEEecCCCCEEEEEeCCCcEEEEECCCCCccceeeeeeeecCCCCCceeEEEECCCCC
Q psy6522         476 IWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGT  555 (1407)
Q Consensus       476 IWDl~tg~~l~~l~gH~~~V~sLafsP~dg~~LaSgs~DG~V~IWDi~sgk~~~l~~~~~~~~g~~~~~I~slafSpDG~  555 (1407)
                      +|++.+|.+++.+.+|...++.+.+||++..+..+++.||...|||+..+  .+++.+.     .+++.+.+.+||+||+
T Consensus       379 vwnl~~g~l~H~l~ghsd~~yvLd~Hpfn~ri~msag~dgst~iwdi~eg--~pik~y~-----~gh~kl~d~kFSqdgt  451 (1113)
T KOG0644|consen  379 VWNLYTGQLLHNLMGHSDEVYVLDVHPFNPRIAMSAGYDGSTIIWDIWEG--IPIKHYF-----IGHGKLVDGKFSQDGT  451 (1113)
T ss_pred             eeecccchhhhhhcccccceeeeeecCCCcHhhhhccCCCceEeeecccC--Ccceeee-----cccceeeccccCCCCc
Confidence            99999999999999999999999999999999999999999999999999  7777665     3478899999999999


Q ss_pred             EEEEEeCCCeEEEEEcCCCccccccCCceEecCCCcEEEecCCCeeeEeeCCCCCCCCcCCCCcccCCCCccCCCCCceE
Q psy6522         556 TCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRL  635 (1407)
Q Consensus       556 ~LAsgs~DG~I~Iwdl~sg~~~~~lp~~v~Fs~D~~~Lv~~~~~~~~v~Dv~T~~~~~~~p~pfl~d~~G~~yppd~Q~L  635 (1407)
                      .++..+..|.++|+..+.++.++..++.+||+.||++|+++.+++  |+|.+|++.||.++++|+++.++++||..+|.|
T Consensus       452 s~~lsd~hgql~i~g~gqs~s~k~ak~dqffl~dyrplirdTn~~--vldqeTq~~ph~~~p~~l~ds~~iphpe~yqtl  529 (1113)
T KOG0644|consen  452 SIALSDDHGQLYILGTGQSKSQKKAKYDQFFLGDYRPLIRDTNGY--VLDQETQLAPHRNPPDFLCDSDMIPHPEPYQTL  529 (1113)
T ss_pred             eEecCCCCCceEEeccCCCccccccccceEeecCcccccccccch--hhhhHhhhccccCCCCceeccCCCcCCchhhhc
Confidence            999999999999999999999999999999999999999999999  999999999999999999999999999999999


Q ss_pred             EeCCCCCCCCCccccccCCCCCcEEEeecc------------ccc--CCCchHHHh-hhhhcccC---------------
Q psy6522         636 VPGRENADDTELLPDITTNDDGHVEIVEGS------------ERN--GERPVEVEG-QRHYNDHG---------------  685 (1407)
Q Consensus       636 v~GR~~sdn~~L~~~~~l~~dg~v~liEg~------------ee~--gs~gf~~~~-~~~~~~ig---------------  685 (1407)
                      ++||..+...++.|++++.+--.-+.+++.            +|+  ...|.-.-+ +.+.+++|               
T Consensus       530 ~q~rr~sa~dh~mp~l~fia~~~~E~e~~Vls~~nds~~~~~~es~seldg~isq~krt~n~r~g~k~s~~~hg~s~ss~  609 (1113)
T KOG0644|consen  530 FQGRRLSALDHLMPPLEFIATMDWEPEEQVLSDQNDSEYNRSPESLSELDGMISQLKRTQNQRMGAKQSKRKHGLSKSSR  609 (1113)
T ss_pred             ccccccchhhhcCCcccchhhhccccchhhhhhcccccccCCcccchhhhhhhhhhhhhhccccccchhhccCCCCcccc
Confidence            999999999999999977554222222222            221  111111111 11122233               


Q ss_pred             ---------CcccccCccccccccccCCCCccccccc-cCCCCCcccc------cccc-----ccCCchhhhhHHH--HH
Q psy6522         686 ---------HVYIQTSHVHVLRSRANGESSAATEGTS-PSGTAPTAQN------KNFV-----KRLPLSQHKIVVE--RI  742 (1407)
Q Consensus       686 ---------~~d~~~~~~~~~rr~~~~~~~~~~~g~~-~~~~~~~~~~------~~~v-----~~~~~~~~~~~~~--~~  742 (1407)
                               ..+++.+++.++++.     +||++|+. ||+|+|+.|.      ++|+     ++...++....++  ..
T Consensus       610 ~~R~~~Rn~~~~isk~sg~~~~~~-----sg~~e~~~q~~~~~p~eq~~~~~~~~~wR~e~~vce~legt~pe~ed~~~~  684 (1113)
T KOG0644|consen  610 PPRAAARNASSDISKISGISLDRK-----SGQVEGVTQMHQNAPSEQIATLRTLQAWRREVVVCEELEGTFPELEDEAMA  684 (1113)
T ss_pred             CCcccccccchhhccCCCcccccc-----ccCCccchhhccCCCHHHHhhhhHHHHhhcccCccccccccCccccccccc
Confidence                     478889999998884     99999999 9999999988      4784     3333444445554  55


Q ss_pred             HhhhhhhhHHHHHHhcccCCC----CCCcccchhh-hccccchhhhhhhcccCCccccccCCC---cccccCCCCCCCCC
Q psy6522         743 NAFAEIESEEFIKESKKLFDS----STTTQPLVVK-KEKKKKVVRQARTRAEYSEHIQDQYED---PDNLSLSGSEESAS  814 (1407)
Q Consensus       743 ~~~~~~e~~~~~~e~~r~~~~----~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~r~~~---~~~~~~~~~~~~~~  814 (1407)
                      ..+++.+.+.|+.-+||++..    +++.+..... ....    -+..+.++.+.-.-.+.++   ....+.+.+.    
T Consensus       685 ~dtdev~rng~kngRKrk~~l~~~~Snksd~vtlV~~d~~----~~~~~~s~aP~~~ld~lNDgfsD~kiD~t~D~----  756 (1113)
T KOG0644|consen  685 VDTDEVERNGYKNGRKRKLELRHPLSNKSDSVTLVSQDLA----DQSTCVSRAPNGGLDSLNDGFSDVKIDLTLDC----  756 (1113)
T ss_pred             cccchhhhcCCCcccccchhccCccccccccchhhhhhhh----cccceeeeCCcccccccccccccccccchhhh----
Confidence            667889999999888888432    3333222100 0010    0111111111110111111   0000111000    


Q ss_pred             CcCCcccccc-----c-ccCCCCCCCCCCCCccccccc-cCCCCCCCccccccc-c-----------CCCCcc-------
Q psy6522         815 DSDQSQVDVS-----D-LCESSSSSGGTSSSDYSDWIH-EGVNLEPPKRVRRHT-K-----------VKPIQV-------  868 (1407)
Q Consensus       815 ~~~~~~~~~~-----~-~~~~~~~s~~~sss~ysd~~~-~g~~~~~p~~~~r~~-~-----------~~~~~~-------  868 (1407)
                       +++.-..++     + ..++....+++.||.|++|++ .++|++-.+|.+-++ .           ..||.+       
T Consensus       757 -se~~gs~~Eis~Rndrr~eS~~~esds~SSa~sv~l~dgsi~~~tsrrgRi~k~~~st~a~Lt~e~~~~p~~~~~~s~s  835 (1113)
T KOG0644|consen  757 -SEDSGSGEEISLRNDRRSESNPEESDSLSSAYSVWLADGSINLQTSRRGRITKFCSSTEAELTTELSSPPCSQDKGSGS  835 (1113)
T ss_pred             -hhcCCcccceeeecchhhccCcccccchhhhhheecccCCccccccccccccccCccchhhhhhcccCCCccccccccc
Confidence             111111111     0 122234456788999999999 899999444321111 0           012311       


Q ss_pred             cCCCC-----CCCCCCCCCcCCCCccccccCCCC-CCCCCCCCeeEEeccchHHHHHHHhhcCceecccccCCCCcCCCC
Q psy6522         869 SLPKQ-----LIPEEVPDIYKPSDWLAEVVPKKA-PYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLIL  942 (1407)
Q Consensus       869 ~~~~~-----~~~~~~~~~~~~~~w~~~~~~~~~-p~~pq~gd~v~yf~qGh~~~~~a~~~~~~~~~~~~~~~p~~~~~l  942 (1407)
                      ++++.     ..+..+...|.++.|||.++-+.+ ||||||||||+||||||+|||+|++..++ ..|  .+.||+++.+
T Consensus       836 ~s~~~~~p~~~~~~~~~~~~~~~sWltls~hee~~ryipQmgDEViyfrQghqeyl~~~~~n~~-~~~--~~~p~~~~~v  912 (1113)
T KOG0644|consen  836 KSHKRSTPAPLENMKPQQLFEKPSWLTLSIHEEGCRYIPQMGDEVIYFRQGHQEYLEAVRLNNI-ELN--NKEPWNKMAV  912 (1113)
T ss_pred             cCcccCCCccccccchhhhcCCceeEEeehhhcCCcccccccceeehhhhhhHHHHhhhhhccc-ccc--ccCcccccch
Confidence            11111     123344578899999999998855 99999999999999999999999999988 777  7899999999


Q ss_pred             CCcceEEEEeEEEEEcCCeeEEEEEEEecCCCcccCceEEEEeCCCCCCceEEEehhhHHHHHhCCCCCCCeEEEEecCe
Q psy6522         943 QEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDA 1022 (1407)
Q Consensus       943 ~~~~~~~v~~i~~~~~~~~~~~l~l~~~~~~~~~~~~~f~v~y~~~~~~~df~v~~~~y~~a~~~~~~~g~rf~~~~~~~ 1022 (1407)
                      +-+++.|+++|.|...+|+||||+|+++||..++..+.|+|+||||++++||||+|++|++|++|||+.||+||++|.|+
T Consensus       913 ~~~kv~kl~~~~y~~~~~s~c~m~l~~idp~s~~~~k~F~ltlpdlv~fpDFlV~rsrYd~AiQrnW~~~d~crvwwrda  992 (1113)
T KOG0644|consen  913 EICKVEKLVYITYPGSGDSCCKMKLAVIDPASKLMDKSFKLTLPDLVTFPDFLVERSRYDAAIQRNWTCRDKCRVWWRDA  992 (1113)
T ss_pred             hhheeeeeeeeeccCCCcchheeeeeeecchhhhhhccceeecccccCcchhhhhhhhHHHHHhhccccccceeEEEccC
Confidence            88888888899999999999999999999988999999999999999999999999999999999999999999999765


Q ss_pred             ------EEEEEEccc----CCCCCCCceeEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCChHHHHhhccCCCC
Q psy6522        1023 ------WWWGTIEGK----PSPTKSPFLGYKILWDNNERENLSPWDLEPP-KEGKEATEPGGSLPVEPEEIQELLYHPRP 1091 (1407)
Q Consensus      1023 ------~~~G~i~~~----~~~p~s~w~~~~V~wd~~~~~~~SpW~~e~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1091 (1407)
                            ||+|+|.++    ++||||||+||.|+|||+|.+.+||||++|| |+--++..++.++.|+-++++..+|++++
T Consensus       993 ~~e~g~WWeG~ils~~pksp~fpdSpwery~v~~~~~e~~~~spwe~~~i~de~~~~fpvpls~evi~~rlEn~yYrs~e 1072 (1113)
T KOG0644|consen  993 GEEDGAWWEGRILSVKPKSPDFPDSPWERYIVRYDNTETELHSPWEMEPIPDEVDNRFPVPLSLEVIRSRLENNYYRSQE 1072 (1113)
T ss_pred             CCcCCceeeeeeeeccCCCCCCCCCcceeEEEEecCCcccccCccccCCCccccCCCCCCcccHHHHHHHHHhhhhhhhH
Confidence                  999999998    8999999999999999999999999999999 67777888899999999999999999999


Q ss_pred             CCCCCCCchhhHHHHHHHHHhHhCccccccccccCCccccCCc
Q psy6522        1092 DEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISSLSEE 1134 (1407)
Q Consensus      1092 ~~w~~~~~~~~c~r~~~~~~~~~~~~~~~~f~~pv~l~~yp~y 1134 (1407)
                      ++|...+++++|.+++-|+++  +++++-.|+.|+++..||.|
T Consensus      1073 ~~~hdvs~mlsnae~~fg~~~--~~~~ki~~l~~~~~~Tlpk~ 1113 (1113)
T KOG0644|consen 1073 ALRHDVSVMLSNAETFFGRNK--NVAIKISFLSPWFDRTLPKL 1113 (1113)
T ss_pred             hhhcchhhhhcccceeecccc--cHHHHhhhcchhhhhhccCC
Confidence            999999999999999999999  88999999999999999986

>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PF06507 Auxin_resp: Auxin response factor; InterPro: IPR010525 This pattern represents a conserved region of auxin-responsive transcription factors Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG2276|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF08513 LisH: LisH; InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>PRK07079 hypothetical protein; Provisional Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK05111 acetylornithine deacetylase; Provisional Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>TIGR01886 dipeptidase dipeptidase PepV Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PRK06446 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1407
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 9e-18
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-16
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-05
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-16
2g9a_A311 Structural Basis For The Specific Recognition Of Me 8e-06
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-16
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 8e-06
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-16
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-06
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-16
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-05
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 3e-16
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 9e-06
2g99_A308 Structural Basis For The Specific Recognition Of Me 3e-16
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-05
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-16
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-05
2h9l_A329 Wdr5delta23 Length = 329 3e-16
2h9l_A329 Wdr5delta23 Length = 329 1e-05
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-16
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 4e-16
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 4e-16
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-05
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-16
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 7e-06
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 5e-16
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-05
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-16
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 7e-06
2gnq_A336 Structure Of Wdr5 Length = 336 6e-16
2gnq_A336 Structure Of Wdr5 Length = 336 1e-05
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-16
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-05
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 9e-16
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-06
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 4e-11
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 8e-11
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-10
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 5e-10
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-07
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 6e-06
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-07
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-06
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 4e-07
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 5e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 4e-07
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 5e-05
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-07
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 5e-05
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 5e-07
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 6e-05
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 5e-07
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-05
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-07
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 4e-06
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 6e-07
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 4e-05
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 3e-06
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 3e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-05
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 2e-05
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 2e-05
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 3e-05
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-05
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 5e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 7e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-04
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 9e-05
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 1e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 2e-04
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 2e-04
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-04
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 3e-04
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-04
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 6e-04
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-04
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 6e-04
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 9e-04
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 7e-04
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 7e-04
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 7e-04
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 7e-04
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 7e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 146/321 (45%), Gaps = 45/321 (14%)
Query: 202 GHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILL 261
           GH S+V+ V F   G+ I + +DD  +KLW  R+G+LL TL G S  +  +A       +
Sbjct: 55  GHSSSVWGVAFSPDGQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAFSPDGQTI 113
Query: 262 AAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKY 321
           A+ + DKT+++WN +    +  L GH   + GV F P   +G   +AS S D  +  W  
Sbjct: 114 ASASDDKTVKLWN-RNGQLLQTLTGHSSSVWGVAFSP---DG-QTIASASDDKTVKLW-- 166
Query: 322 KLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSP 381
                      +      + +   ++ +   +FSP G  +A+ S D  V+++  +G    
Sbjct: 167 -----------NRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQ--- 212
Query: 382 LGILE-VEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTK 440
             +L+ +  HS  V  + +S       S S D T  +W       R  +L + T   H+ 
Sbjct: 213 --LLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWN------RNGQL-LQTLTGHSS 263
Query: 441 ETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLES 500
                      V  VA+   D   I + + +  +K+W+  NG L+Q L GH++ V+ +  
Sbjct: 264 S----------VNGVAFRP-DGQTIASASDDKTVKLWNR-NGQLLQTLTGHSSSVWGVAF 311
Query: 501 HPFDSRVLLSAGHDGLIIIWD 521
            P D + + SA  D  + +W+
Sbjct: 312 SP-DGQTIASASDDKTVKLWN 331
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1407
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.98
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.98
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.98
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3jro_A753 Fusion protein of protein transport protein SEC13 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3jro_A753 Fusion protein of protein transport protein SEC13 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.94
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.92
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.88
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.85
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.85
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.85
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.81
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.81
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.8
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.8
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.8
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.79
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.78
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.77
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.77
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.76
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.76
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.75
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.74
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.74
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.74
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.73
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.69
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.68
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.66
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.64
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.6
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.59
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.58
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.58
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.57
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.56
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.55
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.55
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.54
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.53
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.53
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.53
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.53
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.5
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.47
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.45
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.45
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.43
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.42
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.41
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.38
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.38
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.37
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.35
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.34
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.31
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.28
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.28
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.28
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.27
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.25
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.24
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.2
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.18
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.18
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.13
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.13
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.12
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.11
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.1
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.08
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.07
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.06
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.03
2qe8_A343 Uncharacterized protein; structural genomics, join 99.03
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.0
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.99
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.98
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.98
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.95
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.94
2qe8_A343 Uncharacterized protein; structural genomics, join 98.9
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.9
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.88
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.86
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.85
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.84
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.84
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.75
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.73
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.72
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.7
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.65
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.64
2ece_A462 462AA long hypothetical selenium-binding protein; 98.64
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.62
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.61
2ece_A462 462AA long hypothetical selenium-binding protein; 98.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.54
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.53
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.52
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.48
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.44
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.44
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.23
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.22
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.21
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.19
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.13
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.11
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.11
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.07
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.06
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.03
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.03
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.95
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.92
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.91
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.9
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.89
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.88
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.87
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.86
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.86
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.85
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.85
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.84
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.83
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.79
3v65_B386 Low-density lipoprotein receptor-related protein; 97.79
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.78
3v65_B386 Low-density lipoprotein receptor-related protein; 97.76
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.76
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.74
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.71
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.71
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.69
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.65
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.61
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.58
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.55
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.52
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.51
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.49
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.49
3kya_A496 Putative phosphatase; structural genomics, joint c 97.33
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.27
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.25
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.23
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.17
3kya_A496 Putative phosphatase; structural genomics, joint c 97.12
3ott_A758 Two-component system sensor histidine kinase; beta 97.11
3ott_A758 Two-component system sensor histidine kinase; beta 97.09
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.06
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.9
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.87
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.83
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.83
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.78
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.69
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.52
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.52
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.5
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.39
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.37
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.2
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.18
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.13
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.11
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.86
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.84
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.72
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.47
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.44
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.4
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.28
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.16
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.09
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 95.02
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 94.9
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.84
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.81
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.5
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.23
2xtc_A90 F-box-like/WD repeat-containing protein TBL1X; tra 94.11
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.03
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.91
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.58
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.5
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 92.92
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 92.73
3nxb_A116 CAT eye syndrome critical region protein 2; struct 92.59
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 92.19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.91
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 91.54
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 91.53
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 90.79
2d9e_A121 Peregrin; four-helix bundle, transcription activat 90.75
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.59
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.11
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 88.97
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 88.94
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 88.74
2dat_A123 Possible global transcription activator SNF2L2; br 88.62
3uv4_A158 Second bromodomain of human transcription initiat 88.4
3d7c_A112 General control of amino acid synthesis protein 5; 88.11
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 87.9
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 87.51
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 87.29
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 86.8
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 86.38
3rcw_A135 Bromodomain-containing protein 1; transcription, s 86.18
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 86.1
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 85.77
3p1f_A119 CREB-binding protein; structural genomics consorti 85.37
3dai_A130 ATPase family AAA domain-containing protein 2; anc 85.34
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 85.3
3fkm_X166 Signaling protein; bromodomain, malaria, structura 84.98
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 84.7
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 84.57
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 84.45
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 84.25
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 83.52
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 83.52
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 83.31
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 82.75
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 82.4
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 82.25
2grc_A129 Probable global transcription activator SNF2L4; br 82.2
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 82.19
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 81.98
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 80.74
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 80.64
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 80.19
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=5.6e-43  Score=444.39  Aligned_cols=436  Identities=15%  Similarity=0.146  Sum_probs=334.3

Q ss_pred             ceEEEecCCCCceeEEEEEcCCCCCEEEEEEcCCCCEEEEEECCCeEEEEEcCCC--cEEEEEeCCCCCeEEEEEcCCCC
Q psy6522         182 RFLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDG--KLLATLRGCSGEISDIAIDNRNI  259 (1407)
Q Consensus       182 ~~~~i~~~~~~~~~~~~~L~GH~~~V~~vafSpdG~~LaTGS~DG~V~IWDl~tg--~~l~tl~gH~~~ItsLafSpDg~  259 (1407)
                      ..+.+|...  .......+.+|...|++++|+|+|++||+|+.||+|+|||+.++  .+..++.+|.+.|.+++|+|+++
T Consensus        39 ~~v~l~~~~--~~~~~~~~~~h~~~v~~~~~spdg~~lasg~~d~~v~lWd~~~~~~~~~~~~~~~~~~v~~v~fs~dg~  116 (611)
T 1nr0_A           39 TSVYTVPVG--SLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESK  116 (611)
T ss_dssp             TEEEEEETT--CSSCCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSC
T ss_pred             CEEEEecCC--CcccCeEecCCCCceEEEEECCCCcEEEEEeCCCCEEEeECCCCcceeeEeecccCCceEEEEECCCCC
Confidence            456666542  34566788999999999999999999999999999999999754  45668899999999999999999


Q ss_pred             EEEEEECC----CeEEEEeCCCCceEEEEeccCCceEEEEeccCCCCCceEEEEEecCCceeEEeeccccccceeeeccc
Q psy6522         260 LLAAGTVD----KTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEP  335 (1407)
Q Consensus       260 lLaSgs~D----GtIrVWDl~tg~~v~~l~~H~~~VtsLafspd~~~~~~~LaSgs~DGtI~vWDl~t~~~~~~~~~~~~  335 (1407)
                      +|++++.+    +.|++||  ++.....+.+|...|++++|+|++   ...|++++.|++|++||......         
T Consensus       117 ~l~~~~~~~~~~~~v~~wd--~~~~~~~l~gh~~~v~~v~f~p~~---~~~l~s~s~D~~v~lwd~~~~~~---------  182 (611)
T 1nr0_A          117 RIAAVGEGRERFGHVFLFD--TGTSNGNLTGQARAMNSVDFKPSR---PFRIISGSDDNTVAIFEGPPFKF---------  182 (611)
T ss_dssp             EEEEEECCSSCSEEEEETT--TCCBCBCCCCCSSCEEEEEECSSS---SCEEEEEETTSCEEEEETTTBEE---------
T ss_pred             EEEEEECCCCceeEEEEee--CCCCcceecCCCCCceEEEECCCC---CeEEEEEeCCCeEEEEECCCCeE---------
Confidence            99999875    4677777  566777889999999999999975   24799999999999999765422         


Q ss_pred             cccccccCCCCcceEEEEECCCCceEEEeeCCceEEEEeccCCCCCceeEEEe-------ecCCCcceEEEcCCCCEEEE
Q psy6522         336 VMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVE-------EHSDKVDSIQWSHSHLRFVS  408 (1407)
Q Consensus       336 ~~~~~~~~~h~~~I~~vafSpdg~~Lasgs~DG~I~IwDl~~~~~~~~i~~l~-------~h~~~V~sIafSpdg~~LaS  408 (1407)
                         ...+..|...|.+++|+|+|.+|++|+.|+.|++||+..   ...+..+.       +|.+.|.+++|+|++.+|++
T Consensus       183 ---~~~l~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~---g~~~~~~~~~~~~~~~h~~~V~~v~~spdg~~l~s  256 (611)
T 1nr0_A          183 ---KSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVD---GTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIAS  256 (611)
T ss_dssp             ---EEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTT---CCEEEECBCTTSSSCSSSSCEEEEEECTTSSEEEE
T ss_pred             ---eeeeccccCceEEEEECCCCCEEEEEECCCcEEEEECCC---CcEeeeeccccccccccCCCEEEEEECCCCCEEEE
Confidence               123456788999999999999999999999999999843   23344442       79999999999999999999


Q ss_pred             EeCCCeEEEEEccCCceEEeeeccCcC---------------------------CCCCccccccccccccEEEEEECCCC
Q psy6522         409 GSRDGTALIWYYKCSQWRFIRLDMNTC---------------------------LPHTKETSDETNKKIKVTMVAWDASD  461 (1407)
Q Consensus       409 gs~DGtI~IWDl~t~~~~~~~l~~~~~---------------------------~~~~~~~~~~~~~~~~VtslafSpdg  461 (1407)
                      ++.|++|+|||+.++++..........                           ...........+|...|++++|+|++
T Consensus       257 ~s~D~~v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh~~~v~~l~~spdg  336 (611)
T 1nr0_A          257 ASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGHNKAITALSSSADG  336 (611)
T ss_dssp             EETTSEEEEEETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCCSSCEEEEEECTTS
T ss_pred             EeCCCeEEEEeCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCCCCCEEEEEEeCCC
Confidence            999999999999988765432110000                           00000112234688899999999999


Q ss_pred             CEEEEEEecCCeEEEEECCCCceEEEE-ec--------------------------------------------------
Q psy6522         462 RWVITAINFNFQIKIWDAFNGDLVQVL-KG--------------------------------------------------  490 (1407)
Q Consensus       462 ~~Lasgs~~DG~I~IWDl~tg~~l~~l-~g--------------------------------------------------  490 (1407)
                      ++|++++. |+.|++||+.++.+...+ .+                                                  
T Consensus       337 ~~l~s~s~-D~~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~~~  415 (611)
T 1nr0_A          337 KTLFSADA-EGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQPL  415 (611)
T ss_dssp             SEEEEEET-TSCEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSCEE
T ss_pred             CEEEEEeC-CCcEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCCCc
Confidence            99999998 999999999876543322 11                                                  


Q ss_pred             -------------------------------CCCCeEEEEEecCCCCEEEEEeCCCcEEEEECCCCCccceeeeeeeecC
Q psy6522         491 -------------------------------HTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEG  539 (1407)
Q Consensus       491 -------------------------------H~~~V~sLafsP~dg~~LaSgs~DG~V~IWDi~sgk~~~l~~~~~~~~g  539 (1407)
                                                     |...+.+++|+| ++++|++|+.||+|+|||+.++....+..      .
T Consensus       416 ~~~~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~va~sp-dg~~lasgs~D~~v~lwd~~~~~~~~~~~------~  488 (611)
T 1nr0_A          416 GLAVSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSN-DKQFVAVGGQDSKVHVYKLSGASVSEVKT------I  488 (611)
T ss_dssp             EEEECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECT-TSCEEEEEETTSEEEEEEEETTEEEEEEE------E
T ss_pred             EEEEeCCCcEEEEEeCceEEEEeCCceeeeecCCCceEEEEeC-CCCEEEEeCCCCeEEEEEccCCceeeeec------c
Confidence                                           234567899999 99999999999999999997762111222      1


Q ss_pred             CCCCceeEEEECCCCCEEEEEeCCCeEEEEEcCC-Cccccc--cC------CceEecCCCcEEEec-CCCeeeEeeCCCC
Q psy6522         540 QGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGG-FKRPQN--IP------RELFFHTDYRTLNRP-NGLFEPTYDEVTN  609 (1407)
Q Consensus       540 ~~~~~I~slafSpDG~~LAsgs~DG~I~Iwdl~s-g~~~~~--lp------~~v~Fs~D~~~Lv~~-~~~~~~v~Dv~T~  609 (1407)
                      .|...|++++|+|||++||+++.|++|++|++.+ ++.+..  +.      ..+.|+||++.|+.. ..+.+.+||..+.
T Consensus       489 ~h~~~v~~v~fspdg~~las~s~d~~v~~w~~~~~~~~~~~~~~~~H~~~V~~v~fspdg~~lasgs~D~~v~lW~~~~~  568 (611)
T 1nr0_A          489 VHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNFELAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMNKP  568 (611)
T ss_dssp             ECSSCEEEEEECTTSSEEEEEETTSCEEEEEGGGTTEESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTCT
T ss_pred             CCCCceEEEEECCCCCEEEEEcCCCCEEEEEcCCCCceeeeeeeeecccceeEEEECCCCCEEEEEECCCcEEEEECCCc
Confidence            3567899999999999999999999999999987 554433  11      268999999999854 4566779999876


Q ss_pred             CC-C-CcCCCCcccCCCCccCCCCCceEEeCCCCCCCCCcccc
Q psy6522         610 LP-P-HLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPD  650 (1407)
Q Consensus       610 ~~-~-~~~p~pfl~d~~G~~yppd~Q~Lv~GR~~sdn~~L~~~  650 (1407)
                      .. . ..+..+..-.+....|+|+++ ||+|..  |..-.+|+
T Consensus       569 ~~~~~~~~~~h~~~~v~~v~fs~d~~-l~s~~~--D~~i~lW~  608 (611)
T 1nr0_A          569 SDHPIIIKGAHAMSSVNSVIWLNETT-IVSAGQ--DSNIKFWN  608 (611)
T ss_dssp             TSCCEEETTSSTTSCEEEEEEEETTE-EEEEET--TSCEEEEE
T ss_pred             ccccchhhccCcccCeeEEEEcCCCE-EEEecC--CCCEEEEe
Confidence            42 2 222222123366778999998 887644  33444443
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xtc_A F-box-like/WD repeat-containing protein TBL1X; transcription; 2.22A {Homo sapiens} PDB: 2xte_A 2xtd_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1407
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-33
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-31
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-20
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-19
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-32
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-30
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-28
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-12
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-26
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-17
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-20
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-20
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.004
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-20
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-19
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-18
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-18
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-17
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-16
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-15
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-15
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-13
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-12
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-12
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-10
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 6e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-07
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.001
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-06
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  129 bits (324), Expect = 3e-33
 Identities = 67/324 (20%), Positives = 128/324 (39%), Gaps = 25/324 (7%)

Query: 202 GHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILL 261
           GH S V  V+F  +  V+V+ ++D  IK+W    G    TL+G +  + DI+ D+   LL
Sbjct: 15  GHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLL 74

Query: 262 AAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKY 321
           A+ + D TI++W+ Q    I  + GH   ++ V+  P      +++ S S D  I  W+ 
Sbjct: 75  ASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMP----NGDHIVSASRDKTIKMWEV 130

Query: 322 KLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSP 381
           +    +     H   +                 +  G  +A+ S D  VRV+ +   +  
Sbjct: 131 QTGYCVKTFTGHREWVR------------MVRPNQDGTLIASCSNDQTVRVWVVATKEC- 177

Query: 382 LGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKE 441
               E+ EH   V+ I W+            G+      K   +        T       
Sbjct: 178 --KAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVS 235

Query: 442 TSDETNK----KIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFV 497
           T             V  V + +  +++++    +  +++WD  N   ++ L  H + V  
Sbjct: 236 TGMCLMTLVGHDNWVRGVLFHSGGKFILSC-ADDKTLRVWDYKNKRCMKTLNAHEHFVTS 294

Query: 498 LESHPFDSRVLLSAGHDGLIIIWD 521
           L+ H   +  +++   D  + +W+
Sbjct: 295 LDFHK-TAPYVVTGSVDQTVKVWE 317
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1407
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.91
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.86
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.85
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.75
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.74
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.74
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.72
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.69
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.66
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.53
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.35
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.34
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.15
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.01
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.96
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.88
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.77
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.75
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.69
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.69
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.68
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.67
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.66
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.63
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.56
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.51
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.49
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.92
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.8
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.78
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.52
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.45
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.45
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.36
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.36
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.26
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.14
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.11
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.11
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.95
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.94
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.87
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.56
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.48
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.47
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.43
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.11
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.04
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.0
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.92
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.8
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.73
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.97
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.87
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 93.94
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.83
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 91.6
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.39
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.47
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 90.1
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 89.46
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.45
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.01
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 87.63
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 87.37
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 86.33
g1q7l.1280 Aminoacylase-1, catalytic domain {Human (Homo sapi 80.86
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=6e-37  Score=342.21  Aligned_cols=309  Identities=23%  Similarity=0.373  Sum_probs=266.8

Q ss_pred             EEEEEcCCCCCEEEEEEcCCCCEEEEEECCCeEEEEEcCCCcEEEEEeCCCCCeEEEEEcCCCCEEEEEECCCeEEEEeC
Q psy6522         196 QHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNL  275 (1407)
Q Consensus       196 ~~~~L~GH~~~V~~vafSpdG~~LaTGS~DG~V~IWDl~tg~~l~tl~gH~~~ItsLafSpDg~lLaSgs~DGtIrVWDl  275 (1407)
                      ..++|.||.++|+||+|+|++++||||+.||+|+|||+.+++++.++.+|...|.+++|++++.++++++.++.+.+|+.
T Consensus         9 ~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (317)
T d1vyhc1           9 EKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDF   88 (317)
T ss_dssp             CSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEET
T ss_pred             ccEEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeecccccccccccccccccccc
Confidence            34678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceEEEEeccCCceEEEEeccCCCCCceEEEEEecCCceeEEeeccccccceeeeccccccccccCCCCcceEEEEEC
Q psy6522         276 QTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFS  355 (1407)
Q Consensus       276 ~tg~~v~~l~~H~~~VtsLafspd~~~~~~~LaSgs~DGtI~vWDl~t~~~~~~~~~~~~~~~~~~~~~h~~~I~~vafS  355 (1407)
                      ........+.+|...+.++.|++++    ..|++++.|+.+++||+.++.....            +..|...+.+++|+
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~d~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~  152 (317)
T d1vyhc1          89 QGFECIRTMHGHDHNVSSVSIMPNG----DHIVSASRDKTIKMWEVQTGYCVKT------------FTGHREWVRMVRPN  152 (317)
T ss_dssp             TSSCEEECCCCCSSCEEEEEECSSS----SEEEEEETTSEEEEEETTTCCEEEE------------EECCSSCEEEEEEC
T ss_pred             cccccccccccccccceeeeccCCC----ceEEeeccCcceeEeecccceeeeE------------EccCCCcceeeecc
Confidence            9999888899999999999999976    8999999999999999987643322            23456789999999


Q ss_pred             CCCceEEEeeCCceEEEEeccCCCCCceeEEEeecCCCcceEEEcCCCCEEEEEeCCCeEEEEEccCCceEEeeeccCcC
Q psy6522         356 PGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTC  435 (1407)
Q Consensus       356 pdg~~Lasgs~DG~I~IwDl~~~~~~~~i~~l~~h~~~V~sIafSpdg~~LaSgs~DGtI~IWDl~t~~~~~~~l~~~~~  435 (1407)
                      +++.+|++++.|+.|++|++.   ....+..+..|...+.+++|++++..+......+                      
T Consensus       153 ~~~~~l~~~~~d~~v~~~~~~---~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~----------------------  207 (317)
T d1vyhc1         153 QDGTLIASCSNDQTVRVWVVA---TKECKAELREHRHVVECISWAPESSYSSISEATG----------------------  207 (317)
T ss_dssp             TTSSEEEEEETTSCEEEEETT---TCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCS----------------------
T ss_pred             cCCCEEEEEeCCCeEEEEeec---cceeeEEEecCCCCceEEEEeeccccceeecccc----------------------
Confidence            999999999999999999993   3455667788999999999988764322211111                      


Q ss_pred             CCCCccccccccccccEEEEEECCCCCEEEEEEecCCeEEEEECCCCceEEEEecCCCCeEEEEEecCCCCEEEEEeCCC
Q psy6522         436 LPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDG  515 (1407)
Q Consensus       436 ~~~~~~~~~~~~~~~~VtslafSpdg~~Lasgs~~DG~I~IWDl~tg~~l~~l~gH~~~V~sLafsP~dg~~LaSgs~DG  515 (1407)
                                      .....+...+.++++++. |+.|++||+.+++++..+.+|...|.+++|+| ++.+|++|+.||
T Consensus       208 ----------------~~~~~~~~~~~~~~~~~~-d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~~~~l~s~~~dg  269 (317)
T d1vyhc1         208 ----------------SETKKSGKPGPFLLSGSR-DKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHS-GGKFILSCADDK  269 (317)
T ss_dssp             ----------------CC-------CCEEEEEET-TSEEEEEETTTTEEEEEEECCSSCEEEEEECS-SSSCEEEEETTT
T ss_pred             ----------------ceeeeeccCCceeEeccC-CCEEEEEECCCCcEEEEEeCCCCCEEEEEECC-CCCEEEEEECCC
Confidence                            111223456778888887 99999999999999999999999999999999 999999999999


Q ss_pred             cEEEEECCCCCccceeeeeeeecCCCCCceeEEEECCCCCEEEEEeCCCeEEEEE
Q psy6522         516 LIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYG  570 (1407)
Q Consensus       516 ~V~IWDi~sgk~~~l~~~~~~~~g~~~~~I~slafSpDG~~LAsgs~DG~I~Iwd  570 (1407)
                      .|+|||+.++  +.+..+.     .|.+.|++++|+|++++||+|+.||+|+|||
T Consensus       270 ~i~iwd~~~~--~~~~~~~-----~h~~~V~~~~~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         270 TLRVWDYKNK--RCMKTLN-----AHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             EEEEECCTTS--CCCEEEE-----CCSSCEEEEEECSSSSCEEEEETTSEEEEEC
T ss_pred             eEEEEECCCC--cEEEEEc-----CCCCCEEEEEEcCCCCEEEEEeCCCeEEEeC
Confidence            9999999998  7777765     4678999999999999999999999999996
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure