Psyllid ID: psy6523

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH
ccccccEEEEccccccccccccccccccccccccccccccccEEEEEccccccHHHHccccEEcccccEEEEEcccccHHHHHccccEEEEccccEEEccccccHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccEEEEEEccccEEEccccccccccccccccccccccccEEccccccccccccEEEEEEccEEEEEEEEEcccEEEEcccccccccccccEEEEEcccccccccccccEEEEEEEEEEcccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEEccHHHHcccccccccccccEEEEcccccccccccccccccEEEEEEEcccEEEEccccEEEcccccEEEEEEEcccEEEcccccccccEEEEcccccccccccccEEEEcccccccccEEEEccccccccccccccccHHHHHHHHHcccccccccccccccccEEEEEEcccccccccccccccccccEEEEccccccccEEEEEEEEcccEEHHHHHHHHHHHHcccccccHHHHHcccccEEHHHHHHHcccHHHHHHHHHHHHHHEEEccccccccEEEEEHHHHHHHHHccccccccccccccEEEEEEcccEEEEccccccccccccEEEEEEccccEEcccccHHHHHHHHHHHHHccccc
ccEEHHHHccHHHHHHcEEEEEcccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHcHHHHHHHHHHHHccccEEEEEcccHHHHHHHccccEEEcccccccHHHHHHHHHHHHccHHHHHcccccccEEEEEcccccHHHHHHHHHHccccccEEEEEcccHHHHHHcHHccccccccccccccccccEcEccEEccccccccEEEEEEcccccEEEEEccccEEEEcHHHcccEccHHHEEEEEcccEccccccccccccEEEEEEEcccccccccccccccEEEEEEcccEEEcccccccccccccccccccEEEEEEccccccccccHHHHHccccEEEEcccccccccccccccccEEEEcccccccEcccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHEHHHHHHccHHHHHHHHHHHHHcccEEEEEEcHccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHccccccccEEccHHHHHHHHHHHcccEEEEccccccccEEEEEEcccccEEEEEEEcccHcHHHHHHHHHccHHHHHHEEccccccccHHHHHHHHHHccccc
MLELINQIHisqtfnnisvkpldifnghkniargavanrtdaCFIRVIGSELVQKYVgegavanrtdaCFIRVIGSELVQKYVGEGARMIDaiggarfddgaggdnEVQRTMLELINQpekfvnlgieppkgvllfgppgtgktLCARAVANRTDACFIRVIGSELVQKYVGERVlmegcnnegcgvpnrmdrivggwttevneyPWVVALEQAgkffcggtlisdrYVLTAAHCVRSSKRQKDLIVVISEHnratvyetQIETRRVVKVLthpkynaqgakshdhdiallkldtplefkptvspvclpqlgekftqrtgtvvgwgrveesgqiasdlratqvpvmsnqecrqfpgfeakltgnmmcagyveggkdscqvTLDEADIALLKsygqgqytkSIKAVEDDIQAVIKRVNEltgikesdtglappalwdltadkqtlqneqplqihiplppkidptvtmmqveekpdvtysdiggCKEQIEKLREVVEtpllhldgfdprgnikvlmatnrpdtldpalmrpgrldrkvefglpdlegrtHIFKIHARSMSVERDIRFELLArlcpnstgaeIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIInadsenpkyIINVKQFAKFVVDLadsvaptdieegmrvgvdrnkyqihiplppkidptvtmmqveekpdvtysdiggCKEQIEKLREVVETPLLH
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEgcnnegcgvpnRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVrsskrqkdlivvisehnratvyetqietrrvVKVLTHPKynaqgakshdhDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNeltgikesdtglaPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPllhldgfdprgNIKVLmatnrpdtldpalmrpgrldrkvefglpdlegrthifkiharsmsVERDIRFELLArlcpnstgaeirsvCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKiinadsenpkyiINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIhiplppkidptvTMMQVEEKpdvtysdiggCKEQIEKLREvvetpllh
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIdaiggarfddgaggdNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH
***LINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADK********LQIHIPLP*KIDPTVTMMQV***PDVTYSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNR*******LM**GRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV****DVTYSDIGGCKE***************
**ELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDD***G**EVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELV******************GVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRA*********RRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGK******LDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGL*********************************TVTMMQVE*KP*VTY************LREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLL*
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVT**********IEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLELINQIHISQTFNNISVKPLDIFNGHKNIARGAVANRTDACFIRVIGSELVQKYVGEGAVANRTDACFIRVIGSELVQKYVGEGARMIDAIGGARFDDGAGGDNEVQRTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query713 2.2.26 [Sep-21-2011]
P46472433 26S protease regulatory s N/A N/A 0.176 0.290 0.860 3e-59
P46471433 26S protease regulatory s yes N/A 0.176 0.290 0.852 3e-59
Q63347433 26S protease regulatory s yes N/A 0.176 0.290 0.852 3e-59
Q4R4R0433 26S protease regulatory s N/A N/A 0.176 0.290 0.852 3e-59
P35998433 26S protease regulatory s yes N/A 0.176 0.290 0.852 3e-59
Q5E9F9433 26S protease regulatory s yes N/A 0.176 0.290 0.852 3e-59
Q5R8D7433 26S protease regulatory s yes N/A 0.176 0.290 0.844 2e-58
Q18787435 26S protease regulatory s yes N/A 0.179 0.294 0.793 1e-55
Q86JA1428 26S protease regulatory s yes N/A 0.103 0.172 0.804 2e-55
Q41365426 26S protease regulatory s N/A N/A 0.200 0.335 0.713 4e-55
>sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 Back     alignment and function desciption
 Score =  230 bits (587), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 117/129 (90%), Gaps = 3/129 (2%)

Query: 500 HLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSV 559
            LDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRK+EF LPDLEGRTHIFKIHARSMSV
Sbjct: 305 QLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSV 364

Query: 560 ERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIIN 619
           ERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVA+EKDFLEAVNKV +     +
Sbjct: 365 ERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIKSYAKFS 424

Query: 620 ADSENPKYI 628
           A    P+Y+
Sbjct: 425 A---TPRYM 430
The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Xenopus laevis (taxid: 8355)
>sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 Back     alignment and function description
>sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 Back     alignment and function description
>sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 Back     alignment and function description
>sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 Back     alignment and function description
>sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 Back     alignment and function description
>sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 Back     alignment and function description
>sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 Back     alignment and function description
>sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 Back     alignment and function description
>sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
349802805296 putative proteasome ( macropain) 26s atp 0.305 0.736 0.645 2e-95
308799537349 26S proteasome subunit P45 family protei 0.352 0.719 0.478 1e-71
383850981434 PREDICTED: 26S protease regulatory subun 0.176 0.290 0.883 1e-58
350419438434 PREDICTED: 26S protease regulatory subun 0.176 0.290 0.883 2e-58
328792984409 PREDICTED: 26S protease regulatory subun 0.176 0.308 0.883 2e-58
332019605434 26S protease regulatory subunit 7 [Acrom 0.176 0.290 0.875 2e-58
322799608434 hypothetical protein SINV_01171 [Solenop 0.176 0.290 0.875 2e-58
307172188434 26S protease regulatory subunit 7 [Campo 0.176 0.290 0.875 2e-58
242023637426 26S protease regulatory subunit, putativ 0.197 0.330 0.790 2e-58
307197198434 26S protease regulatory subunit 7 [Harpe 0.176 0.290 0.875 2e-58
>gi|349802805|gb|AEQ16875.1| putative proteasome ( macropain) 26s atpase [Pipa carvalhoi] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 193/299 (64%), Positives = 206/299 (68%), Gaps = 81/299 (27%)

Query: 407 DDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQ-----------------NEQP 449
           DDIQ ++K++NELTGIKESDTGLAPPALWDL ADKQTLQ                 +E P
Sbjct: 1   DDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDP 60

Query: 450 -------------------------------------LQIHIPLPPKIDPTVTMMQVEEK 472
                                                 QIHIPLPPKIDPTVTMMQVEEK
Sbjct: 61  KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEK 120

Query: 473 PDVTYSDIGGCKEQIEKLREVVETPLLH-----------------------LDGFDPRGN 509
           PDVTYSD+GGCKEQIEKLREVVETPLLH                       LDGFDPRGN
Sbjct: 121 PDVTYSDVGGCKEQIEKLREVVETPLLHPERFNLGIEPPKGVLLGPPGINQLDGFDPRGN 180

Query: 510 IKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLA 569
           IKVLMATNRPDTLDPALMRPGRLD ++EF LPDLEGRTHIFKIHARSMSVERDIRFELLA
Sbjct: 181 IKVLMATNRPDTLDPALMRPGRLD-EIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLA 239

Query: 570 RLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKIINADSENPKYI 628
           RLCPNSTGAEIRSVCTEAGMFAIRARRKVA+EKDFLEAVNKV +     +A    P+Y+
Sbjct: 240 RLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIKSYAKFSA---TPRYM 295

Source: Pipa carvalhoi

Species: Pipa carvalhoi

Genus: Pipa

Family: Pipidae

Order: Anura

Class: Amphibia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|308799537|ref|XP_003074549.1| 26S proteasome subunit P45 family protein (IC) [Ostreococcus tauri] gi|116000720|emb|CAL50400.1| 26S proteasome subunit P45 family protein (IC), partial [Ostreococcus tauri] Back     alignment and taxonomy information
>gi|383850981|ref|XP_003701042.1| PREDICTED: 26S protease regulatory subunit 7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350419438|ref|XP_003492182.1| PREDICTED: 26S protease regulatory subunit 7-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328792984|ref|XP_623743.2| PREDICTED: 26S protease regulatory subunit 7 [Apis mellifera] gi|340712375|ref|XP_003394737.1| PREDICTED: 26S protease regulatory subunit 7-like [Bombus terrestris] gi|380022505|ref|XP_003695084.1| PREDICTED: 26S protease regulatory subunit 7-like [Apis florea] Back     alignment and taxonomy information
>gi|332019605|gb|EGI60083.1| 26S protease regulatory subunit 7 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322799608|gb|EFZ20880.1| hypothetical protein SINV_01171 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307172188|gb|EFN63713.1| 26S protease regulatory subunit 7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242023637|ref|XP_002432238.1| 26S protease regulatory subunit, putative [Pediculus humanus corporis] gi|212517640|gb|EEB19500.1| 26S protease regulatory subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307197198|gb|EFN78520.1| 26S protease regulatory subunit 7 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
UNIPROTKB|F1NFL8432 PSMC2 "Uncharacterized protein 0.204 0.337 0.75 3.5e-84
UNIPROTKB|F1SB53475 PSMC2 "Uncharacterized protein 0.204 0.307 0.75 4.5e-84
UNIPROTKB|Q5E9F9433 PSMC2 "26S protease regulatory 0.204 0.337 0.75 4.5e-84
UNIPROTKB|F1PPH7433 PSMC2 "Uncharacterized protein 0.204 0.337 0.75 4.5e-84
UNIPROTKB|P35998433 PSMC2 "26S protease regulatory 0.204 0.337 0.75 4.5e-84
UNIPROTKB|Q4R4R0433 PSMC2 "26S protease regulatory 0.204 0.337 0.75 4.5e-84
RGD|3428433 Psmc2 "proteasome (prosome, ma 0.204 0.337 0.75 4.5e-84
UNIPROTKB|Q63347433 Psmc2 "26S protease regulatory 0.204 0.337 0.75 4.5e-84
UNIPROTKB|P46472433 psmc2 "26S protease regulatory 0.204 0.337 0.756 5.7e-84
MGI|MGI:109555433 Psmc2 "proteasome (prosome, ma 0.204 0.337 0.75 5.7e-84
UNIPROTKB|F1NFL8 PSMC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 562 (202.9 bits), Expect = 3.5e-84, Sum P(2) = 3.5e-84
 Identities = 114/152 (75%), Positives = 128/152 (84%)

Query:   477 YSDIGGCKEQIEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKV 536
             + D  G   +++  R ++E  +  LDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRK+
Sbjct:   284 FDDGAGGDNEVQ--RTMLEL-INQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKI 340

Query:   537 EFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARR 596
             EF LPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARR
Sbjct:   341 EFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARR 400

Query:   597 KVASEKDFLEAVNKVARCTKIINADSENPKYI 628
             K+A+EKDFLEAVNKV +     +A    P+Y+
Sbjct:   401 KIATEKDFLEAVNKVIKSYAKFSA---TPRYM 429
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0022624 "proteasome accessory complex" evidence=IEA
UNIPROTKB|F1SB53 PSMC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9F9 PSMC2 "26S protease regulatory subunit 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPH7 PSMC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P35998 PSMC2 "26S protease regulatory subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R4R0 PSMC2 "26S protease regulatory subunit 7" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
RGD|3428 Psmc2 "proteasome (prosome, macropain) 26S subunit, ATPase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63347 Psmc2 "26S protease regulatory subunit 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46472 psmc2 "26S protease regulatory subunit 7" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:109555 Psmc2 "proteasome (prosome, macropain) 26S subunit, ATPase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 4e-65
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-62
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 3e-62
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-49
pfam00089218 pfam00089, Trypsin, Trypsin 5e-43
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 4e-41
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 9e-35
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-31
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-31
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 4e-31
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 6e-30
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-28
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 1e-27
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 4e-26
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-25
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-25
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-25
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-24
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 4e-24
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-23
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 5e-23
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-21
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-21
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-20
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-20
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-19
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 6e-19
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 7e-18
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-17
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 6e-17
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-16
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-16
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 6e-16
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-15
CHL00176638 CHL00176, ftsH, cell division protein; Validated 1e-14
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-14
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 5e-14
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-13
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-12
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-12
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-12
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-12
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-11
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 6e-11
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-10
COG5640413 COG5640, COG5640, Secreted trypsin-like serine pro 1e-10
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 5e-09
pfam00004131 pfam00004, AAA, ATPase family associated with vari 7e-09
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-08
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-08
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-07
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 2e-07
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 3e-07
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 4e-07
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 5e-07
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-06
COG3591251 COG3591, COG3591, V8-like Glu-specific endopeptida 6e-06
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-05
PRK13342413 PRK13342, PRK13342, recombination factor protein R 7e-05
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 8e-05
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 6e-04
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 7e-04
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.001
smart00382148 smart00382, AAA, ATPases associated with a variety 0.001
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
pfam03761280 pfam03761, DUF316, Domain of unknown function (DUF 0.003
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 0.003
pfam07726131 pfam07726, AAA_3, ATPase family associated with va 0.003
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information 
 Score =  215 bits (549), Expect = 4e-65
 Identities = 81/188 (43%), Positives = 112/188 (59%), Gaps = 7/188 (3%)

Query: 194 IVGGWTTEVNEYPWVVALE-QAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEH 252
           IVGG   ++  +PW V+L+   G+ FCGG+LIS R+VLTAAHCV SS    +  V +  H
Sbjct: 1   IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAP-SNYTVRLGSH 59

Query: 253 NRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLG 312
           +  +  E   +  +V KV+ HP YN     ++D+DIALLKL  P+     V P+CLP  G
Sbjct: 60  DL-SSNEGGGQVIKVKKVIVHPNYNPS---TYDNDIALLKLKRPVTLSDNVRPICLPSSG 115

Query: 313 EKFTQ-RTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYV 371
                  T TV GWGR  E G +   L+   VP++SN EC++   +   +T NM+CAG +
Sbjct: 116 YNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRAYSYGGTITDNMLCAGGL 175

Query: 372 EGGKDSCQ 379
           EGGKD+CQ
Sbjct: 176 EGGKDACQ 183

Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|226119 COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217716 pfam03761, DUF316, Domain of unknown function (DUF316) Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 713
KOG0733|consensus 802 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730|consensus693 100.0
KOG0733|consensus802 100.0
KOG0734|consensus 752 100.0
KOG0736|consensus953 100.0
KOG0738|consensus491 100.0
KOG0731|consensus 774 100.0
KOG0727|consensus408 100.0
KOG0729|consensus435 100.0
KOG0728|consensus404 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
KOG0726|consensus440 100.0
KOG0652|consensus424 100.0
KOG0739|consensus439 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0735|consensus952 100.0
KOG0737|consensus386 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
KOG0651|consensus388 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
KOG0741|consensus 744 100.0
KOG0730|consensus 693 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
KOG0740|consensus428 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
KOG0732|consensus 1080 100.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
KOG0736|consensus 953 99.94
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.93
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.91
KOG0743|consensus457 99.86
KOG0735|consensus 952 99.85
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.79
KOG3627|consensus256 99.78
KOG0742|consensus630 99.75
KOG0729|consensus 435 99.74
KOG0744|consensus423 99.74
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.73
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.66
PF00004132 AAA: ATPase family associated with various cellula 99.63
CHL00181287 cbbX CbbX; Provisional 99.63
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.55
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.53
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.49
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.45
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.41
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.39
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.33
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.29
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.28
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.19
PRK10865857 protein disaggregation chaperone; Provisional 99.16
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.15
PRK04195 482 replication factor C large subunit; Provisional 99.11
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK07940394 DNA polymerase III subunit delta'; Validated 99.07
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK13342413 recombination factor protein RarA; Reviewed 99.06
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.05
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.05
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.04
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.03
PRK00149450 dnaA chromosomal replication initiation protein; R 99.02
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.01
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.98
CHL00095821 clpC Clp protease ATP binding subunit 98.98
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.97
COG5640413 Secreted trypsin-like serine protease [Posttransla 98.96
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.96
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.96
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.95
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.95
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.94
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.94
PRK12402337 replication factor C small subunit 2; Reviewed 98.93
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.93
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.92
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.92
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.9
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.89
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 98.89
PRK06893229 DNA replication initiation factor; Validated 98.89
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.88
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.86
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.86
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.84
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.83
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.83
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.83
PHA02544316 44 clamp loader, small subunit; Provisional 98.83
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.82
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.82
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.81
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.81
PRK13341725 recombination factor protein RarA/unknown domain f 98.81
PLN03025319 replication factor C subunit; Provisional 98.8
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.8
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.8
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.78
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.78
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.78
PRK14088440 dnaA chromosomal replication initiation protein; P 98.77
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.77
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.76
KOG2004|consensus906 98.76
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.75
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.75
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 98.74
PRK14086617 dnaA chromosomal replication initiation protein; P 98.73
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.73
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.72
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.72
PRK00440319 rfc replication factor C small subunit; Reviewed 98.71
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.68
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 98.67
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.66
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.64
PRK12422445 chromosomal replication initiation protein; Provis 98.64
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.61
COG0714329 MoxR-like ATPases [General function prediction onl 98.6
PRK08084235 DNA replication initiation factor; Provisional 98.58
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.55
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.55
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.54
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.53
PTZ001121164 origin recognition complex 1 protein; Provisional 98.53
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.48
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.47
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.46
PRK08727233 hypothetical protein; Validated 98.43
PRK06620214 hypothetical protein; Validated 98.42
PHA02244383 ATPase-like protein 98.42
PRK05642234 DNA replication initiation factor; Validated 98.41
PRK14087450 dnaA chromosomal replication initiation protein; P 98.41
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.4
KOG0989|consensus346 98.39
KOG1942|consensus456 98.34
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.33
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.32
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.32
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 98.31
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.3
KOG2028|consensus554 98.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.23
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.22
PRK09112351 DNA polymerase III subunit delta'; Validated 98.2
PRK09087226 hypothetical protein; Validated 98.19
PRK13531 498 regulatory ATPase RavA; Provisional 98.19
smart00350509 MCM minichromosome maintenance proteins. 98.17
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.17
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.14
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.12
CHL00095821 clpC Clp protease ATP binding subunit 98.12
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.11
PRK05564313 DNA polymerase III subunit delta'; Validated 98.1
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.1
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.07
PRK07471365 DNA polymerase III subunit delta'; Validated 98.05
KOG0728|consensus 404 98.05
PRK06964342 DNA polymerase III subunit delta'; Validated 98.02
PRK10865857 protein disaggregation chaperone; Provisional 98.0
PRK05707328 DNA polymerase III subunit delta'; Validated 98.0
KOG2680|consensus454 97.97
KOG0726|consensus440 97.95
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.92
KOG1969|consensus 877 97.9
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.9
KOG0727|consensus408 97.86
PRK08058329 DNA polymerase III subunit delta'; Validated 97.86
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 97.82
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.8
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.76
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.71
KOG0652|consensus 424 97.64
PRK07399314 DNA polymerase III subunit delta'; Validated 97.6
CHL00195 489 ycf46 Ycf46; Provisional 97.49
smart00382148 AAA ATPases associated with a variety of cellular 97.45
PRK09862506 putative ATP-dependent protease; Provisional 97.45
PRK04132846 replication factor C small subunit; Provisional 97.44
PRK08939306 primosomal protein DnaI; Reviewed 97.42
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 97.41
KOG0741|consensus744 97.4
PRK08116268 hypothetical protein; Validated 97.37
PRK07952244 DNA replication protein DnaC; Validated 97.36
PRK00131175 aroK shikimate kinase; Reviewed 97.32
COG0593408 DnaA ATPase involved in DNA replication initiation 97.31
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 97.3
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.3
PRK12377248 putative replication protein; Provisional 97.3
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.29
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.29
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.28
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 97.27
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.27
PF07726131 AAA_3: ATPase family associated with various cellu 97.26
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.25
PRK03992 389 proteasome-activating nucleotidase; Provisional 97.19
KOG0739|consensus 439 97.16
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.15
PRK05022509 anaerobic nitric oxide reductase transcription reg 97.13
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.1
PRK08118167 topology modulation protein; Reviewed 97.06
PRK08769319 DNA polymerase III subunit delta'; Validated 97.03
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 96.99
PRK08699325 DNA polymerase III subunit delta'; Validated 96.98
PRK06090319 DNA polymerase III subunit delta'; Validated 96.98
PRK06871325 DNA polymerase III subunit delta'; Validated 96.95
PRK08181269 transposase; Validated 96.94
PRK06835329 DNA replication protein DnaC; Validated 96.93
PRK07993334 DNA polymerase III subunit delta'; Validated 96.93
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 96.91
KOG3347|consensus176 96.91
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 96.91
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.86
PRK13947171 shikimate kinase; Provisional 96.84
PRK03839180 putative kinase; Provisional 96.81
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.8
PRK06921266 hypothetical protein; Provisional 96.8
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.79
PRK00625173 shikimate kinase; Provisional 96.74
PHA02624647 large T antigen; Provisional 96.73
PRK06526254 transposase; Provisional 96.71
PRK14532188 adenylate kinase; Provisional 96.71
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 96.69
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.68
PRK13949169 shikimate kinase; Provisional 96.66
PRK15455644 PrkA family serine protein kinase; Provisional 96.64
PRK14531183 adenylate kinase; Provisional 96.62
PRK13948182 shikimate kinase; Provisional 96.57
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.56
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.53
KOG0745|consensus564 96.53
PRK09183259 transposase/IS protein; Provisional 96.51
PRK07261171 topology modulation protein; Provisional 96.51
PRK06762166 hypothetical protein; Provisional 96.5
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.47
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.47
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.46
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.43
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 96.42
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.42
PRK06547172 hypothetical protein; Provisional 96.41
PRK06217183 hypothetical protein; Validated 96.4
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 96.4
PTZ00088229 adenylate kinase 1; Provisional 96.36
PLN02200234 adenylate kinase family protein 96.35
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.34
PHA00729226 NTP-binding motif containing protein 96.34
PRK14528186 adenylate kinase; Provisional 96.3
PRK13946184 shikimate kinase; Provisional 96.26
PRK14530215 adenylate kinase; Provisional 96.26
PRK02496184 adk adenylate kinase; Provisional 96.22
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.21
PRK05057172 aroK shikimate kinase I; Reviewed 96.21
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.19
PF1324576 AAA_19: Part of AAA domain 96.19
PRK03731171 aroL shikimate kinase II; Reviewed 96.19
PRK04040188 adenylate kinase; Provisional 96.17
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.14
PRK08154309 anaerobic benzoate catabolism transcriptional regu 96.13
PRK14527191 adenylate kinase; Provisional 96.13
PRK00279215 adk adenylate kinase; Reviewed 96.12
KOG0991|consensus333 96.11
KOG0738|consensus 491 96.11
KOG0737|consensus 386 96.09
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.08
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.07
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.06
COG0606490 Predicted ATPase with chaperone activity [Posttran 95.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.87
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 95.87
PLN02674244 adenylate kinase 95.86
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.85
TIGR01817534 nifA Nif-specific regulatory protein. This model r 95.85
PRK14526211 adenylate kinase; Provisional 95.85
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 95.84
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 95.82
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 95.79
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.78
PRK15424538 propionate catabolism operon regulatory protein Pr 95.76
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.74
PRK01184184 hypothetical protein; Provisional 95.7
PRK04182180 cytidylate kinase; Provisional 95.68
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.66
PRK11608326 pspF phage shock protein operon transcriptional ac 95.55
PHA02774613 E1; Provisional 95.54
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.5
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.47
KOG1970|consensus634 95.46
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.45
PRK13765 637 ATP-dependent protease Lon; Provisional 95.45
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.43
PLN02459261 probable adenylate kinase 95.41
PRK05818261 DNA polymerase III subunit delta'; Validated 95.4
PRK12338319 hypothetical protein; Provisional 95.4
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.38
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.37
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.34
PHA02530300 pseT polynucleotide kinase; Provisional 95.32
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.31
PRK12339197 2-phosphoglycerate kinase; Provisional 95.31
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.3
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.3
cd01394218 radB RadB. The archaeal protein radB shares simila 95.27
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 95.25
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.22
PRK05973237 replicative DNA helicase; Provisional 95.22
PRK06067234 flagellar accessory protein FlaH; Validated 95.21
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.21
KOG0651|consensus388 95.2
TIGR02329526 propionate_PrpR propionate catabolism operon regul 95.19
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.18
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 95.18
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.12
PRK15429686 formate hydrogenlyase transcriptional activator Fh 95.11
PRK06696223 uridine kinase; Validated 95.08
PRK14529223 adenylate kinase; Provisional 95.07
PF13173128 AAA_14: AAA domain 95.05
PRK05541176 adenylylsulfate kinase; Provisional 95.05
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 95.05
COG1221403 PspF Transcriptional regulators containing an AAA- 94.98
PRK09361225 radB DNA repair and recombination protein RadB; Pr 94.94
PRK08233182 hypothetical protein; Provisional 94.92
PLN02199303 shikimate kinase 94.88
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.85
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 94.85
COG4619223 ABC-type uncharacterized transport system, ATPase 94.83
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.83
PRK09825176 idnK D-gluconate kinase; Provisional 94.82
PRK13808333 adenylate kinase; Provisional 94.78
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.77
COG3829560 RocR Transcriptional regulator containing PAS, AAA 94.76
PRK10536262 hypothetical protein; Provisional 94.73
PRK11545163 gntK gluconate kinase 1; Provisional 94.72
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 94.7
PRK10365441 transcriptional regulatory protein ZraR; Provision 94.65
KOG1514|consensus767 94.64
KOG3354|consensus191 94.63
PRK14738206 gmk guanylate kinase; Provisional 94.61
TIGR02974329 phageshock_pspF psp operon transcriptional activat 94.6
PRK04328249 hypothetical protein; Provisional 94.57
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 94.57
PF05729166 NACHT: NACHT domain 94.56
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.55
PRK00889175 adenylylsulfate kinase; Provisional 94.51
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 94.47
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 94.44
COG3842352 PotA ABC-type spermidine/putrescine transport syst 94.41
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.38
COG4088261 Predicted nucleotide kinase [Nucleotide transport 94.38
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.35
PF1355562 AAA_29: P-loop containing region of AAA domain 94.34
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.32
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.28
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 94.24
PLN02165334 adenylate isopentenyltransferase 94.23
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.23
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 94.22
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.21
PRK11823446 DNA repair protein RadA; Provisional 94.21
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.21
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.21
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.19
PRK00300205 gmk guanylate kinase; Provisional 94.16
PRK06761282 hypothetical protein; Provisional 94.15
PRK08356195 hypothetical protein; Provisional 94.11
PRK05480209 uridine/cytidine kinase; Provisional 93.95
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 93.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.89
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 93.85
PRK00771437 signal recognition particle protein Srp54; Provisi 93.84
PRK04220301 2-phosphoglycerate kinase; Provisional 93.83
PTZ00202550 tuzin; Provisional 93.83
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.78
COG4525259 TauB ABC-type taurine transport system, ATPase com 93.77
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 93.76
COG4178604 ABC-type uncharacterized transport system, permeas 93.73
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.72
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 93.68
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 93.66
TIGR02236310 recomb_radA DNA repair and recombination protein R 93.64
PF13479213 AAA_24: AAA domain 93.61
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.59
PRK14737186 gmk guanylate kinase; Provisional 93.58
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.57
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 93.49
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.47
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.47
PRK13975196 thymidylate kinase; Provisional 93.44
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.41
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.41
cd01128249 rho_factor Transcription termination factor rho is 93.37
PRK00023225 cmk cytidylate kinase; Provisional 93.36
PRK10646153 ADP-binding protein; Provisional 93.34
PRK03846198 adenylylsulfate kinase; Provisional 93.31
PRK08099399 bifunctional DNA-binding transcriptional repressor 93.31
TIGR00064272 ftsY signal recognition particle-docking protein F 93.3
PRK14730195 coaE dephospho-CoA kinase; Provisional 93.29
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.29
KOG0060|consensus659 93.28
PRK04301317 radA DNA repair and recombination protein RadA; Va 93.24
COG1618179 Predicted nucleotide kinase [Nucleotide transport 93.23
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 93.22
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 93.2
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 93.18
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.12
cd03115173 SRP The signal recognition particle (SRP) mediates 93.1
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 93.1
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 93.07
PLN02840421 tRNA dimethylallyltransferase 93.04
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 93.03
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 93.0
PRK00081194 coaE dephospho-CoA kinase; Reviewed 93.0
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 92.98
PRK12337475 2-phosphoglycerate kinase; Provisional 92.94
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.93
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 92.93
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 92.92
PRK10416318 signal recognition particle-docking protein FtsY; 92.92
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 92.91
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.91
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.89
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 92.87
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.86
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 92.84
PRK09354349 recA recombinase A; Provisional 92.83
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.78
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 92.75
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 92.71
COG1855604 ATPase (PilT family) [General function prediction 92.71
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.7
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.69
PRK13764602 ATPase; Provisional 92.68
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 92.65
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.55
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 92.54
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.53
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 92.48
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 92.43
PRK07276290 DNA polymerase III subunit delta'; Validated 92.41
PRK09376416 rho transcription termination factor Rho; Provisio 92.41
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.36
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 92.28
KOG0990|consensus360 92.27
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 92.27
KOG0740|consensus 428 92.25
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 92.23
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 92.22
cd03269210 ABC_putative_ATPase This subfamily is involved in 92.15
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 92.14
TIGR00152188 dephospho-CoA kinase. This model produces scores i 92.14
PRK13833323 conjugal transfer protein TrbB; Provisional 92.08
COG0645170 Predicted kinase [General function prediction only 92.03
TIGR00376637 DNA helicase, putative. The gene product may repre 92.03
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 92.01
PRK13851344 type IV secretion system protein VirB11; Provision 91.98
PRK12608380 transcription termination factor Rho; Provisional 91.97
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 91.97
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 91.96
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 91.89
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.88
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 91.85
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.82
PRK14733204 coaE dephospho-CoA kinase; Provisional 91.81
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 91.81
KOG2383|consensus467 91.81
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.78
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 91.78
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 91.77
PRK07667193 uridine kinase; Provisional 91.73
TIGR02688449 conserved hypothetical protein TIGR02688. Members 91.72
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 91.7
PRK09302509 circadian clock protein KaiC; Reviewed 91.67
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 91.66
PTZ00035337 Rad51 protein; Provisional 91.65
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.63
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 91.62
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 91.61
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 91.61
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.57
PRK07132299 DNA polymerase III subunit delta'; Validated 91.55
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 91.54
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 91.54
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 91.51
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 91.51
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 91.5
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 91.49
PRK04296190 thymidine kinase; Provisional 91.48
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 91.44
>KOG0733|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.2e-67  Score=559.62  Aligned_cols=331  Identities=28%  Similarity=0.472  Sum_probs=270.9

Q ss_pred             CccccCCCCCcHHHHH--HHHHHHhCcccccccCCCCCCcEEeeCCCCCchhHHHHHHhhccCceeEEeecccceeeeec
Q psy6523          95 GARFDDGAGGDNEVQR--TMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVG  172 (713)
Q Consensus        95 ~~r~~d~iG~~~~~~~--~i~~~l~~~~~~~~~gi~~p~gvLL~GPpGtGKT~la~alA~e~~~~~~~V~~~~i~s~~~G  172 (713)
                      .+.|.|++|.++.+.+  .+..++++|+.|..+|+.||||||||||||||||+||+|+|+|+++||++|++++++|+++|
T Consensus       186 nv~f~diGG~d~~~~el~~li~~i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGvSG  265 (802)
T KOG0733|consen  186 NVSFSDIGGLDKTLAELCELIIHIKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGVSG  265 (802)
T ss_pred             CcchhhccChHHHHHHHHHHHHHhcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcCCceEeecchhhhcccCc
Confidence            5678899998887663  44555899999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeecccCCCCCCCCCcccccccccccccCcCCchhhhhhccCceeeeeeeechhhHHhhcccccCCCCCCceEEEEccc
Q psy6523         173 ERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEH  252 (713)
Q Consensus       173 es~~~~~~~~~~~~~~~~~~rI~~g~~~~~~~~P~~~~l~e~~~~~cggslI~~r~vltaa~c~~~~~~~~~~vv~ig~~  252 (713)
                      |||                .+|+..|+.+.+..||++||||++.+-..                                
T Consensus       266 ESE----------------kkiRelF~~A~~~aPcivFiDeIDAI~pk--------------------------------  297 (802)
T KOG0733|consen  266 ESE----------------KKIRELFDQAKSNAPCIVFIDEIDAITPK--------------------------------  297 (802)
T ss_pred             ccH----------------HHHHHHHHHHhccCCeEEEeecccccccc--------------------------------
Confidence            998                89999999999999999999998652100                                


Q ss_pred             cCCcccccceEEEEeeEEeeCCCCCcCCCCCCccceEEEecCCCCCCCCCcccccCCCCCCccCCCceEEEeeccccCCC
Q psy6523         253 NRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEESG  332 (713)
Q Consensus       253 ~~~~~~d~~~~~~~v~~ii~h~~~~~~~~~~~~~diall~L~~p~~~~~~i~~icl~~~~~~~~~~~~~v~GwG~~~~~~  332 (713)
                                                                                                      
T Consensus       298 --------------------------------------------------------------------------------  297 (802)
T KOG0733|consen  298 --------------------------------------------------------------------------------  297 (802)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CcchhcccccccccChhhhhcCCCccccccCcccccCCCCCCCCCccccccHhhHHHHHHhcCCccchhhhhHHHHHHHH
Q psy6523         333 QIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQAV  412 (713)
Q Consensus       333 ~~~~~L~~~~~~~~~~~~c~~~~~~~~~it~~~~cAG~~~~~~d~c~~~l~e~d~~~~~~~~~~~~~~~~~~~~~~~~~~  412 (713)
                                                                                 |                    
T Consensus       298 -----------------------------------------------------------R--------------------  298 (802)
T KOG0733|consen  298 -----------------------------------------------------------R--------------------  298 (802)
T ss_pred             -----------------------------------------------------------h--------------------
Confidence                                                                       0                    


Q ss_pred             HHHhhhccCcccCCCCCCCCCccccccchhhhccCCCceecccCCCCCCccchhcccccCCCcccccccccHHHHHHHHH
Q psy6523         413 IKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLRE  492 (713)
Q Consensus       413 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~s~~~~~~~~~~~~~~~~~gg~~~~~~~~~~  492 (713)
                                                                                            -..+++..+|
T Consensus       299 ----------------------------------------------------------------------e~aqreMErR  308 (802)
T KOG0733|consen  299 ----------------------------------------------------------------------EEAQREMERR  308 (802)
T ss_pred             ----------------------------------------------------------------------hhHHHHHHHH
Confidence                                                                                  0014566789


Q ss_pred             HHHhhhhcccCCCCC----CCeEEEEecCCCCCccccccCCCCCCeEEEecCCCHHHHHHHHHHhhccCCCcccccHHHH
Q psy6523         493 VVETPLLHLDGFDPR----GNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELL  568 (713)
Q Consensus       493 ~v~~lL~~~d~~~~~----~~v~vi~aTN~p~~lD~Al~RpGRfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~l  568 (713)
                      +|.|||+.||++...    +.|+|||||||||.|||||+|+||||++|.+++|++.+|.+||+..++++.++.++|+..|
T Consensus       309 iVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~~ql  388 (802)
T KOG0733|consen  309 IVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDFKQL  388 (802)
T ss_pred             HHHHHHHhhhcccccccCCCCeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCCCcCHHHH
Confidence            999999999999544    5699999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCCCHHHHHHHHHHHHHHHHHHHhhhcCHHHHHHHHhHhhhccc----cccc------CCCCchhhhhHH-HHHHH
Q psy6523         569 ARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTK----IINA------DSENPKYIINVK-QFAKF  637 (713)
Q Consensus       569 a~~t~g~sgadi~~l~~~A~~~a~~~~~~~v~~~d~~~a~~~~~~~~~----~~~~------~~~~~~~~i~~~-~~~~~  637 (713)
                      |+.|+||+||||.+||.+|++.|++|..+..+.     -...+..+..    ..+.      ...+...+.... -..++
T Consensus       389 A~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~-----p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~  463 (802)
T KOG0733|consen  389 AKLTPGFVGADLMALCREAAFVAIKRILDQSSS-----PLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDA  463 (802)
T ss_pred             HhcCCCccchhHHHHHHHHHHHHHHHHhhcccC-----ccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHH
Confidence            999999999999999999999999984332110     0000000000    0000      000111111111 12456


Q ss_pred             HhhcCCCCCcccccccccccccccccccccCCCCCCCCccceeeeeecCCcccccccchHHHHHHHHHHHhcccCC
Q psy6523         638 VVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLREVVETPLLH  713 (713)
Q Consensus       638 ~~~~~~sv~~~d~~~~~~~~~~~~~~~~~~~~p~~~~Ps~~re~~~~~P~v~W~dIGgl~~vk~~L~~av~~Pl~~  713 (713)
                      +.....+.+++.+   ..++|+.+||..|++   .+|||++||+|.+||+|+|+|||||++||.||+++|+||+||
T Consensus       464 i~~~~d~~S~E~~---~~L~i~~eDF~~Al~---~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~  533 (802)
T KOG0733|consen  464 ILNNPDPLSKELL---EGLSIKFEDFEEALS---KIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAPIKR  533 (802)
T ss_pred             HHhCCCCcChHHh---ccceecHHHHHHHHH---hcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhhccC
Confidence            6666666664433   346799999999998   899999999999999999999999999999999999999997

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 9e-53
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 4e-37
4a3v_B95 Yeast Regulatory Particle Proteasome Assembly Chape 6e-31
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 6e-30
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 1e-29
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 2e-29
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 2e-29
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 4e-29
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 4e-29
1pfx_C235 Porcine Factor Ixa Length = 235 9e-29
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 1e-28
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 1e-28
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-05
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 2e-28
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 2e-28
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 2e-28
3vlf_B88 Crystal Structure Of Yeast Proteasome Interacting P 4e-28
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 5e-28
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 3e-09
2a31_A223 Trypsin In Complex With Borate Length = 223 5e-28
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 7e-28
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 8e-28
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 1e-27
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 1e-27
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 5e-12
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 2e-27
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 1e-26
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 1e-26
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 2e-26
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 2e-05
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 2e-26
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 2e-26
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 2e-26
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 2e-26
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 2e-26
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 3e-26
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 3e-26
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 3e-26
2bok_A241 Factor Xa- Cation Length = 241 3e-26
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 3e-26
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 3e-26
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 3e-26
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 3e-26
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 3e-26
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 3e-26
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 6e-26
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 6e-26
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 6e-26
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 7e-26
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 8e-26
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 8e-26
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 9e-26
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 9e-26
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 9e-26
2any_A241 Expression, Crystallization And The Three-Dimension 1e-25
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 1e-25
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 1e-25
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 2e-08
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 1e-25
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 1e-25
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 1e-25
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 2e-25
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 2e-25
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 2e-25
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 2e-25
1dpo_A223 Structure Of Rat Trypsin Length = 223 2e-25
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 2e-25
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 2e-25
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 2e-25
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 2e-25
1kig_H241 Bovine Factor Xa Length = 241 2e-25
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 2e-25
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 2e-25
2anw_A241 Expression, Crystallization And Three-Dimensional S 2e-25
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 3e-25
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 4e-25
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 5e-25
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 6e-25
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 7e-25
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 7e-25
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 7e-25
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 8e-25
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 8e-25
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 9e-25
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 9e-25
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 9e-25
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 9e-25
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 9e-25
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 1e-24
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 1e-24
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 1e-24
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-24
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 2e-24
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 2e-24
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 2e-24
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 2e-24
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 2e-24
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 2e-24
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 2e-24
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 2e-24
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 2e-24
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 2e-24
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 2e-24
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 3e-24
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 3e-24
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 3e-24
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 4e-24
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 5e-24
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 5e-24
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 6e-24
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 6e-24
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 7e-24
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 7e-24
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 7e-24
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 8e-24
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 8e-24
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 8e-24
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 9e-24
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 1e-23
2ce7_A 476 Edta Treated Length = 476 1e-23
3kds_E465 Apo-ftsh Crystal Structure Length = 465 1e-23
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 1e-23
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 1e-23
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 1e-23
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 1e-23
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 1e-23
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 1e-23
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 1e-23
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 1e-23
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 2e-23
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 2e-23
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 2e-23
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 2e-23
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 2e-23
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 2e-23
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 2e-23
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 2e-23
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 2e-23
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 2e-23
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 3e-23
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 3e-23
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 4e-23
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 5e-23
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 5e-23
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 5e-23
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 5e-23
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 5e-23
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 5e-23
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 5e-23
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 6e-23
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 6e-23
1z8j_B259 Crystal Structure Of The Thrombin Mutant G193p Boun 6e-23
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 6e-23
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 6e-23
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 6e-23
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 7e-23
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 7e-23
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 7e-23
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 7e-23
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 7e-23
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 7e-23
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 7e-23
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 7e-23
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 7e-23
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 7e-23
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 8e-23
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 8e-23
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 8e-23
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 9e-23
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 9e-23
2pgb_B259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 9e-23
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 1e-22
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 1e-22
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 1e-22
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 1e-22
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 1e-22
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 2e-22
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 3e-22
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 3e-22
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 3e-22
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 5e-22
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 5e-22
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 6e-22
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 6e-22
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 7e-22
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 1e-21
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 1e-21
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-21
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-21
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 1e-21
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 1e-21
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 1e-21
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-21
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 1e-21
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-21
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-21
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-21
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 2e-21
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 2e-21
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 3e-21
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 3e-21
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 3e-21
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 4e-21
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 5e-21
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 5e-21
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 8e-21
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 8e-21
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 8e-21
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 9e-21
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 1e-20
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 1e-20
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 2e-20
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 2e-20
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 2e-20
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 3e-20
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 4e-20
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 7e-20
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 1e-19
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 2e-19
1bhx_B147 X-Ray Structure Of The Complex Of Human Alpha Throm 3e-19
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-19
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-19
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 4e-19
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 4e-19
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 4e-19
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 4e-19
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 4e-19
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 4e-19
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 5e-19
1bbr_H150 The Structure Of Residues 7-16 Of The A Alpha Chain 5e-19
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 5e-19
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 5e-19
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 1e-07
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 7e-19
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 8e-19
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-18
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 1e-18
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 1e-18
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 1e-18
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 2e-18
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 2e-18
1md7_A328 Monomeric Structure Of The Zymogen Of Complement Pr 3e-18
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 3e-18
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-18
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 5e-18
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 6e-18
2xrc_A565 Human Complement Factor I Length = 565 7e-18
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 8e-18
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 9e-18
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 9e-18
1aut_C250 Human Activated Protein C Length = 250 1e-17
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 2e-17
2jet_B128 Crystal Structure Of A Trypsin-Like Mutant (S189d, 2e-17
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 3e-17
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 3e-17
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 4e-17
1elt_A236 Structure Of Native Pancreatic Elastase From North 5e-17
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 7e-17
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 8e-17
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 9e-17
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 1e-16
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 1e-16
2fmj_A222 220-Loop Mutant Of Streptomyces Griseus Trypsin Len 1e-16
1kdq_A131 Crystal Structure Analysis Of The Mutant S189d Rat 2e-16
1mtn_B131 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 3e-16
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 5e-16
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 5e-16
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 6e-16
3i77_A230 3599170-Loops Of Fxa In Sgt Length = 230 7e-16
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 7e-16
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 8e-16
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 8e-16
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 9e-16
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 1e-15
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 1e-15
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 1e-15
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 1e-15
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 1e-15
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 2e-15
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 2e-15
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 3e-15
1oss_A223 T190p Streptomyces Griseus Trypsin In Complex With 3e-15
4gso_A232 Structure Of Jararacussin-I Length = 232 4e-15
2zgc_A240 Crystal Structure Of Active Human Granzyme M Length 5e-15
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 5e-15
1aks_A125 Crystal Structure Of The First Active Autolysate Fo 8e-15
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 8e-15
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 9e-15
1lto_A245 Human Alpha1-Tryptase Length = 245 1e-14
3i78_A229 3599170186220-Loops Of Fxa In Sgt Length = 229 1e-14
3beu_A224 Na+-Dependent Allostery Mediates Coagulation Factor 1e-14
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-14
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 1e-14
2zgj_A240 Crystal Structure Of D86n-gzmm Complexed With Its O 2e-14
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 2e-14
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 2e-14
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 2e-14
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 3e-14
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 3e-14
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 3e-14
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 3e-14
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 3e-14
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 4e-14
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 4e-14
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 5e-14
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 5e-14
1fuj_A221 Pr3 (Myeloblastin) Length = 221 8e-14
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 9e-14
1gvz_A237 Prostate Specific Antigen (Psa) From Stallion Semin 1e-13
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 1e-13
1fi8_A228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 1e-13
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 1e-13
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 1e-13
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 1e-13
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 1e-13
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 1e-13
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 2e-13
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 2e-13
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 2e-13
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 4e-13
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 5e-13
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 5e-13
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 6e-13
3fzz_A227 Structure Of Grc Length = 227 8e-13
3g01_A227 Structure Of Grc Mutant E192rE193G Length = 227 8e-13
1klt_A226 Crystal Structure Of Pmsf-Treated Human Chymase At 9e-13
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 1e-12
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 1e-12
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 1e-12
4afq_A226 Human Chymase - Fynomer Complex Length = 226 2e-12
1nn6_A228 Human Pro-Chymase Length = 228 2e-12
3n7o_A226 X-Ray Structure Of Human Chymase In Complex With Sm 2e-12
1pjp_A226 The 2.2 A Crystal Structure Of Human Chymase In Com 4e-12
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 4e-12
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 7e-12
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 1e-11
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 1e-11
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 1e-11
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 1e-11
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 2e-11
2win_I507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 6e-11
1rrk_A497 Crystal Structure Analysis Of The Bb Segment Of Fac 6e-11
2xwb_F732 Crystal Structure Of Complement C3b In Complex With 6e-11
2ok5_A752 Human Complement Factor B Length = 752 7e-11
1kyn_B235 Cathepsin-G Length = 235 7e-11
1a7s_A225 Atomic Resolution Structure Of Hbp Length = 225 8e-11
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 8e-11
3hrz_D741 Cobra Venom Factor (Cvf) In Complex With Human Fact 8e-11
1fy3_A225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 8e-11
1dle_A298 Factor B Serine Protease Domain Length = 298 9e-11
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 1e-10
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 1e-10
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 1e-10
1au8_A224 Human Cathepsin G Length = 224 2e-10
1fq3_A227 Crystal Structure Of Human Granzyme B Length = 227 2e-10
1iau_A227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 3e-10
3h7o_A228 Crystal Structure Of Scabies Mite Inactivated Prote 5e-10
3b9p_A297 Spastin Length = 297 8e-10
4f4o_C347 Structure Of The Haptoglobin-Haemoglobin Complex Le 1e-09
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-09
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-09
1fy1_A225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 2e-09
4gaw_A226 Crystal Structure Of Active Human Granzyme H Length 3e-09
3tju_A226 Crystal Structure Of Human Granzyme H With An Inhib 9e-09
3f1s_B283 Crystal Structure Of Protein Z Complexed With Prote 2e-08
3h7t_A235 Crystal Structure Of Scabies Mite Inactivated Prote 2e-08
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-08
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 9e-05
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 3e-08
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 3e-08
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 4e-04
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 3e-08
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 4e-04
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 3e-08
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 4e-04
2rdl_A226 Hamster Chymase 2 Length = 226 6e-08
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 6e-08
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 1e-07
2i6q_A517 Complement Component C2a Length = 517 1e-07
2odp_A509 Complement Component C2a, The Catalytic Fragment Of 1e-07
1b0f_A218 Crystal Structure Of Human Neutrophil Elastase With 2e-07
1ppf_E218 X-Ray Crystal Structure Of The Complex Of Human Leu 3e-07
1ppg_E218 The Refined 2.3 Angstroms Crystal Structure Of Huma 3e-07
2rg3_A218 Covalent Complex Structure Of Elastase Length = 218 3e-07
2asu_B234 Crystal Structure Of The Beta-Chain Of HgflMSP Leng 3e-07
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 4e-07
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 5e-07
1xwi_A322 Crystal Structure Of Vps4b Length = 322 7e-07
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 9e-07
1hne_E218 Structure Of Human Neutrophil Elastase In Complex W 1e-06
2kai_A80 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 1e-06
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 1e-06
2hnt_E81 Crystallographic Structure Of Human Gamma-Thrombin 2e-06
2hnt_C70 Crystallographic Structure Of Human Gamma-Thrombin 5e-06
1ept_A43 Refined 1.8 Angstroms Resolution Crystal Structure 5e-06
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure 
Iteration: 1

 Score =  204 bits (520), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 114/130 (87%)
Query: 498 LLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSM 557
           +  LDGFDPRGNIKV+ ATNRP+TLDPAL+RPGR+DRKVEF LPDLEGR +IF+IH++SM
Sbjct: 337 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 396
Query: 558 SVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCTKI 617
           SVER IR+EL++RLCPNSTGAE+RSVCTEAGMFAIRARRKVA+EKDFL+AV+KV    K 
Sbjct: 397 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 456
Query: 618 INADSENPKY 627
            ++ S   +Y
Sbjct: 457 FSSTSRYMQY 466
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4A3V|B Chain B, Yeast Regulatory Particle Proteasome Assembly Chaperone Hsm3 In Complex With Rpt1 C-Terminal Fragment Length = 95 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|3VLF|B Chain B, Crystal Structure Of Yeast Proteasome Interacting Protein Length = 88 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 Back     alignment and structure
>pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 Back     alignment and structure
>pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure
>pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>pdb|1RRK|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Length = 497 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|1DLE|A Chain A, Factor B Serine Protease Domain Length = 298 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|3H7O|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-I1 (Smipp-S-I1) Length = 228 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|3F1S|B Chain B, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 283 Back     alignment and structure
>pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|2I6Q|A Chain A, Complement Component C2a Length = 517 Back     alignment and structure
>pdb|2ODP|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5- Convertase Of Human Complement Length = 509 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|2ASU|B Chain B, Crystal Structure Of The Beta-Chain Of HgflMSP Length = 234 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|2HNT|E Chain E, Crystallographic Structure Of Human Gamma-Thrombin Length = 81 Back     alignment and structure
>pdb|2HNT|C Chain C, Crystallographic Structure Of Human Gamma-Thrombin Length = 70 Back     alignment and structure
>pdb|1EPT|A Chain A, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 43 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 6e-74
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 3e-73
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 2e-72
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 2e-72
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 1e-71
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 2e-71
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 2e-70
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 2e-70
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 6e-70
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 7e-70
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 1e-69
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 3e-69
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 3e-69
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 3e-69
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 8e-69
1md8_A329 C1R complement serine protease; innate immunity, a 1e-68
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 1e-68
1elv_A333 Complement C1S component; trypsin-like serin prote 1e-68
2qy0_B242 Complement C1R subcomponent; serine protease, beta 2e-68
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 2e-68
2xxl_A408 GRAM-positive specific serine protease, isoform B; 5e-68
2jde_A276 Urokinase-type plasminogen activator; plasminogen 5e-68
1gpz_A399 Complement C1R component; hydrolase, activation, i 8e-68
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 1e-67
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 2e-67
1aut_C250 Activated protein C; serine proteinase, plasma cal 6e-67
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 7e-67
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 9e-67
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 1e-66
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 2e-66
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 3e-66
2r0l_A248 Hepatocyte growth factor activator; serine proteas 4e-66
3bg8_A238 Coagulation factor XIA light chain; protease inhib 4e-66
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 1e-65
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 1e-65
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 3e-65
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 3e-65
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 3e-65
2aiq_A231 Protein C activator; snake venom serine proteinase 4e-65
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 4e-65
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 4e-65
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 7e-65
2xw9_A228 Complement factor D; immune system, hydrolase, ser 7e-65
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 3e-64
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 4e-64
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 6e-64
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 6e-64
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 1e-63
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 1e-63
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 3e-63
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 5e-63
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 6e-63
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 8e-63
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 1e-62
1a7s_A225 Heparin binding protein; serine protease homolog, 2e-62
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 2e-62
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 2e-62
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 2e-62
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 2e-62
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 4e-62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 5e-34
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 7e-26
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 6e-15
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-14
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 8e-62
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-61
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 1e-61
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 2e-61
1azz_A226 Collagenase; complex (serine protease/inhibitor), 3e-61
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 4e-61
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 5e-61
2xrc_A565 Human complement factor I; immune system, hydrolas 6e-61
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 7e-61
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 8e-61
1euf_A227 Duodenase; serine protease, dual specificity, hydr 1e-60
1ao5_A237 Glandular kallikrein-13; serine protease, protein 2e-60
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-60
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 1e-59
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 3e-59
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 3e-59
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 9e-59
2z7f_E218 Leukocyte elastase; serine protease, serine protea 2e-58
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 3e-58
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 8e-58
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 9e-58
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 2e-57
2asu_B234 Hepatocyte growth factor-like protein; serine prot 1e-55
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 2e-54
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 2e-53
2odp_A509 Complement C2; C3/C5 convertase, complement serin 6e-52
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 9e-51
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 1e-49
3hrz_D741 Complement factor B; serine protease, glycosilated 2e-44
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 1e-42
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-36
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-24
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-04
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-04
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-04
2krk_A86 26S protease regulatory subunit 8; structural geno 3e-36
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 6e-36
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-22
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-08
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 9e-08
3kw6_A78 26S protease regulatory subunit 8; structural geno 4e-34
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-34
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 5e-16
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-33
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-30
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-21
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-17
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-06
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-05
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-05
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-04
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 7e-33
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-32
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 4e-24
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-04
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 8e-04
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-32
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-16
2r62_A268 Cell division protease FTSH homolog; ATPase domain 4e-32
2r62_A268 Cell division protease FTSH homolog; ATPase domain 1e-16
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-31
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 4e-17
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-31
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-18
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 6e-31
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 2e-15
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 6e-31
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-30
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-16
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-29
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 8e-26
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-23
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-11
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 1e-25
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 1e-22
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 2e-21
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 2e-20
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 2e-04
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-21
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-16
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 5e-21
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 5e-18
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 4e-20
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 6e-19
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 6e-04
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 5e-20
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 8e-15
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 4e-05
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-19
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-19
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 6e-04
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-18
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-18
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 6e-17
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-17
2wg5_A109 General control protein GCN4, proteasome-activatin 7e-16
2wg5_A109 General control protein GCN4, proteasome-activatin 5e-04
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 4e-15
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 4e-11
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 1e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-09
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 2e-08
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 9e-07
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 5e-05
3pvs_A447 Replication-associated recombination protein A; ma 6e-05
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 6e-05
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 7e-05
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 3e-04
3h43_A85 Proteasome-activating nucleotidase; regulatory par 3e-04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 5e-04
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
 Score =  237 bits (608), Expect = 6e-74
 Identities = 68/189 (35%), Positives = 107/189 (56%), Gaps = 10/189 (5%)

Query: 194 IVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISEHN 253
           +VGG   +  ++PW V L      FCGG+++++++++TAAHCV +  +   + VV  EHN
Sbjct: 1   VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVK---ITVVAGEHN 57

Query: 254 RATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGE 313
                E   + R V++++ H  +NA    +++HDIALL+LD PL     V+P+C+     
Sbjct: 58  I-EETEHTEQKRNVIRIIPHHNFNA-AINTYNHDIALLELDEPLVLNSYVTPICIADKEY 115

Query: 314 K---FTQRTGTVVGWGRVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGY 370
                   +G V GWGRV   G+ A  L+  +VP++    C +   F   +T NM CAG+
Sbjct: 116 TNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKF--TITNNMFCAGF 173

Query: 371 VEGGKDSCQ 379
            EGG+DSCQ
Sbjct: 174 HEGGRDSCQ 182
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Length = 109 Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Length = 109 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Length = 268 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Length = 85 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.98
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.97
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.97
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.97
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.96
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.96
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.95
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.95
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.94
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.93
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.93
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.92
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.92
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.92
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.92
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.92
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.92
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.92
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.92
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.91
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.91
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.91
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.91
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.91
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.91
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.91
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.91
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.91
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.91
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.91
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.91
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.91
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.91
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.91
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.91
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.91
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.91
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.91
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.91
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.91
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.91
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.91
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.91
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.91
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.91
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.91
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.9
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.9
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.9
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.9
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.9
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.9
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.9
1md8_A329 C1R complement serine protease; innate immunity, a 99.9
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.9
1elv_A333 Complement C1S component; trypsin-like serin prote 99.9
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.9
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.9
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.9
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.9
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.9
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.9
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.9
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.9
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.9
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.9
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.9
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.9
2aiq_A231 Protein C activator; snake venom serine proteinase 99.9
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.9
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.9
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.89
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.89
1a7s_A225 Heparin binding protein; serine protease homolog, 99.89
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.89
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.89
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.89
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.89
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.89
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.89
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.89
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.89
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.89
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.89
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.89
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.88
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.88
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.88
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.88
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.88
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.87
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.87
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.87
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 99.86
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.86
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.86
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.86
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.85
2xrc_A565 Human complement factor I; immune system, hydrolas 99.84
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.84
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.83
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.82
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.81
3hrz_D741 Complement factor B; serine protease, glycosilated 99.78
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.73
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.63
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.63
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.6
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.59
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.56
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.55
2krk_A86 26S protease regulatory subunit 8; structural geno 99.54
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.53
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.52
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.51
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.5
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.49
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.46
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.46
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.45
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.42
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.4
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.38
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.38
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.37
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.37
3bos_A242 Putative DNA replication factor; P-loop containing 99.37
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.35
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.34
3pvs_A 447 Replication-associated recombination protein A; ma 99.34
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.34
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.33
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.3
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.3
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.26
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.23
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.23
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.23
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.21
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.21
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.21
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.21
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.2
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.18
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.18
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.16
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.15
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.14
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.12
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.11
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.1
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.09
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.08
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.07
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.02
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.01
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.96
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.93
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.93
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.91
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.91
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 98.86
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 98.85
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 98.85
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.79
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.78
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.77
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.72
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.64
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.62
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 98.6
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 98.55
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.52
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.49
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.43
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 98.41
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 98.35
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.24
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.23
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.96
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.94
3co5_A143 Putative two-component system transcriptional RES 97.93
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.88
3k6y_A237 Serine protease, possible membrane-associated seri 97.73
1tue_A212 Replication protein E1; helicase, replication, E1E 97.49
2qgz_A308 Helicase loader, putative primosome component; str 97.47
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.46
3f8t_A506 Predicted ATPase involved in replication control, 97.45
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.4
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 97.4
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.31
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.28
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 97.27
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 97.24
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.15
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.13
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.09
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.05
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.02
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 96.99
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.95
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.9
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 96.88
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.78
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.78
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.76
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.73
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.68
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.64
1via_A175 Shikimate kinase; structural genomics, transferase 96.63
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.61
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.55
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.54
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.52
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.52
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.49
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.49
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 96.46
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.43
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.42
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.39
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.38
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.37
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.36
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.35
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.35
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.35
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.34
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.33
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.32
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.28
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.27
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.25
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.25
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.21
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.19
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.19
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.18
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.15
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.14
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.12
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.11
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.11
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.1
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.07
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.06
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.05
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.98
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.94
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.89
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.73
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.68
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.67
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.64
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.62
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.62
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.6
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.58
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 95.57
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.55
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.52
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.51
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.48
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.48
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 95.46
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.46
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.41
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.38
2fna_A357 Conserved hypothetical protein; structural genomic 95.37
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.33
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.32
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.28
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.17
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.16
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.15
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.13
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.04
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.98
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.97
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.89
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.88
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.87
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.87
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.86
2z43_A324 DNA repair and recombination protein RADA; archaea 94.85
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 94.85
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 94.84
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 94.83
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.78
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.75
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.73
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 94.65
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.65
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.62
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 94.62
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 94.58
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.57
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.51
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.49
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.47
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.44
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.43
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 94.37
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.36
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.35
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 94.28
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 94.17
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.14
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 94.14
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.09
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.02
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.93
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.93
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.88
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.79
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 93.76
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.73
3io5_A333 Recombination and repair protein; storage dimer, i 93.71
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.7
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.56
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.55
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.53
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.47
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.45
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.37
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 93.35
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.32
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.25
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 93.24
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.23
2og2_A359 Putative signal recognition particle receptor; nuc 93.2
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 93.16
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.13
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.06
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.99
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 92.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.84
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.83
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.78
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.75
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.69
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.49
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 92.39
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 92.35
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.31
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.27
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.19
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.15
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 92.15
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.15
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.07
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 91.84
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.72
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.67
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.66
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.65
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.52
3kta_A182 Chromosome segregation protein SMC; structural mai 91.51
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.49
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.44
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.4
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.4
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 91.33
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 91.28
1b0u_A262 Histidine permease; ABC transporter, transport pro 91.25
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.17
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 91.12
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 91.12
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 91.09
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.08
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 91.05
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 91.02
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 90.96
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.91
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.89
1g6h_A257 High-affinity branched-chain amino acid transport 90.88
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 90.86
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.8
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 90.77
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.74
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 90.69
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.64
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 90.64
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 90.57
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 90.57
2ghi_A260 Transport protein; multidrug resistance protein, M 90.55
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.53
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.53
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.51
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.51
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 90.5
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 90.49
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.43
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 90.42
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.38
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 90.34
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.34
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.3
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 90.3
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.24
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.17
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 90.17
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.1
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.09
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.08
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 89.99
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.93
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 89.88
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 89.88
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 89.88
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 89.87
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.86
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 89.84
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 89.75
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 89.74
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.71
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 89.64
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 89.54
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 89.47
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 89.43
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 89.37
2oap_1511 GSPE-2, type II secretion system protein; hexameri 89.32
2ged_A193 SR-beta, signal recognition particle receptor beta 89.09
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 89.08
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 89.07
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 88.83
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 88.67
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 88.67
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 88.56
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 88.39
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 88.3
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 88.29
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 88.21
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 88.2
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.05
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.03
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 87.91
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 87.85
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 87.72
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.66
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 87.28
2xxa_A433 Signal recognition particle protein; protein trans 87.22
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 87.17
1nrj_B218 SR-beta, signal recognition particle receptor beta 87.05
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 86.93
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 86.83
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 86.78
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 86.63
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 86.58
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 86.58
1p9r_A418 General secretion pathway protein E; bacterial typ 86.53
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 86.49
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 86.45
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 86.13
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 86.01
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 85.98
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 85.88
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 85.7
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 85.69
2wji_A165 Ferrous iron transport protein B homolog; membrane 85.67
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 85.66
3ice_A422 Transcription termination factor RHO; transcriptio 85.58
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 85.45
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 85.38
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 85.27
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 85.18
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 85.08
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 85.04
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 85.0
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 84.93
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 84.88
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 84.77
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 84.71
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 84.66
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 84.59
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 84.55
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 84.24
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 84.16
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 84.15
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.3e-51  Score=444.58  Aligned_cols=252  Identities=40%  Similarity=0.681  Sum_probs=222.8

Q ss_pred             hhhcCCccccCCCCCcHHHH---HHHHHHHhCcccccccCCCCCCcEEeeCCCCCchhHHHHHHhhccCceeEEeecccc
Q psy6523          90 IDAIGGARFDDGAGGDNEVQ---RTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSEL  166 (713)
Q Consensus        90 id~i~~~r~~d~iG~~~~~~---~~i~~~l~~~~~~~~~gi~~p~gvLL~GPpGtGKT~la~alA~e~~~~~~~V~~~~i  166 (713)
                      ++..|.++|+|++|.++.++   +.+..++.+|+.|.++|++||+|||||||||||||++|+|+|++++++|+.|+++++
T Consensus       139 ~~~~p~v~~~dIgGl~~~k~~l~e~v~~Pl~~pe~f~~~gi~~prGvLL~GPPGTGKTllAkAiA~e~~~~f~~v~~s~l  218 (405)
T 4b4t_J          139 VEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAEL  218 (405)
T ss_dssp             EECSCSCCGGGSCSCHHHHHHHHHHTHHHHHCHHHHHHHTCCCCCCEEEESCSSSSHHHHHHHHHHHHTCEEEEEEGGGG
T ss_pred             ccCCCCCCHHHhCCHHHHHHHHHHHHHHHHhCHHHHHhCCCCCCCceEEeCCCCCCHHHHHHHHHHhhCCCceEEEhHHh
Confidence            45668899999988876443   455556899999999999999999999999999999999999999999999999999


Q ss_pred             eeeeecceeecccCCCCCCCCCcccccccccccccCcCCchhhhhhccCceeeeeeeechhhHHhhcccccCCCCCCceE
Q psy6523         167 VQKYVGERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLI  246 (713)
Q Consensus       167 ~s~~~Ges~~~~~~~~~~~~~~~~~~rI~~g~~~~~~~~P~~~~l~e~~~~~cggslI~~r~vltaa~c~~~~~~~~~~v  246 (713)
                      +++|+||++                .+|+..|..+...+||++||||++.+...++                        
T Consensus       219 ~sk~vGese----------------~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~------------------------  258 (405)
T 4b4t_J          219 VQKYIGEGS----------------RMVRELFVMAREHAPSIIFMDEIDSIGSTRV------------------------  258 (405)
T ss_dssp             SCSSTTHHH----------------HHHHHHHHHHHHTCSEEEEEESSSCCTTSCS------------------------
T ss_pred             hccccchHH----------------HHHHHHHHHHHHhCCceEeeecchhhccCCC------------------------
Confidence            999999987                6788889999999999999999866221000                        


Q ss_pred             EEEccccCCcccccceEEEEeeEEeeCCCCCcCCCCCCccceEEEecCCCCCCCCCcccccCCCCCCccCCCceEEEeec
Q psy6523         247 VVISEHNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWG  326 (713)
Q Consensus       247 v~ig~~~~~~~~d~~~~~~~v~~ii~h~~~~~~~~~~~~~diall~L~~p~~~~~~i~~icl~~~~~~~~~~~~~v~GwG  326 (713)
                                                                                                      
T Consensus       259 --------------------------------------------------------------------------------  258 (405)
T 4b4t_J          259 --------------------------------------------------------------------------------  258 (405)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccCCCCcchhcccccccccChhhhhcCCCccccccCcccccCCCCCCCCCccccccHhhHHHHHHhcCCccchhhhhHH
Q psy6523         327 RVEESGQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVE  406 (713)
Q Consensus       327 ~~~~~~~~~~~L~~~~~~~~~~~~c~~~~~~~~~it~~~~cAG~~~~~~d~c~~~l~e~d~~~~~~~~~~~~~~~~~~~~  406 (713)
                                                                                          .           
T Consensus       259 --------------------------------------------------------------------~-----------  259 (405)
T 4b4t_J          259 --------------------------------------------------------------------E-----------  259 (405)
T ss_dssp             --------------------------------------------------------------------C-----------
T ss_pred             --------------------------------------------------------------------C-----------
Confidence                                                                                0           


Q ss_pred             HHHHHHHHHhhhccCcccCCCCCCCCCccccccchhhhccCCCceecccCCCCCCccchhcccccCCCcccccccccHHH
Q psy6523         407 DDIQAVIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQ  486 (713)
Q Consensus       407 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~s~~~~~~~~~~~~~~~~~gg~~~~  486 (713)
                                                                                              ..++   .
T Consensus       260 ------------------------------------------------------------------------~~~~---~  264 (405)
T 4b4t_J          260 ------------------------------------------------------------------------GSGG---G  264 (405)
T ss_dssp             ------------------------------------------------------------------------SSSG---G
T ss_pred             ------------------------------------------------------------------------CCCC---C
Confidence                                                                                    0000   0


Q ss_pred             HHHHHHHHHhhhhcccCCCCCCCeEEEEecCCCCCccccccCCCCCCeEEEecCCCHHHHHHHHHHhhccCCCcccccHH
Q psy6523         487 IEKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFE  566 (713)
Q Consensus       487 ~~~~~~~v~~lL~~~d~~~~~~~v~vi~aTN~p~~lD~Al~RpGRfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~  566 (713)
                      ....++++++||++|||+....+|+||+|||+|+.|||||+||||||++|+|++||.++|.+||+.+++++++..++|++
T Consensus       265 ~~~~~~~l~~lL~~lDg~~~~~~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~  344 (405)
T 4b4t_J          265 DSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLR  344 (405)
T ss_dssp             GGHHHHHHHHHHHHHHTTTCCCCEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHH
T ss_pred             cHHHHHHHHHHHHhhhccCCCCCeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHH
Confidence            12345899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCCHHHHHHHHHHHHHHHHHHHhhhcCHHHHHHHHhHhhhcc
Q psy6523         567 LLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARCT  615 (713)
Q Consensus       567 ~la~~t~g~sgadi~~l~~~A~~~a~~~~~~~v~~~d~~~a~~~~~~~~  615 (713)
                      .||+.|+|||||||+++|++|++.|+++++..|+++||+.|++++.+..
T Consensus       345 ~lA~~t~G~SGADi~~l~~eA~~~Air~~~~~vt~~Df~~Al~~v~~~~  393 (405)
T 4b4t_J          345 KVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKN  393 (405)
T ss_dssp             HHHHHCCSCCHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHHHHhCcc
Confidence            9999999999999999999999999999999999999999999886653
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 713
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-41
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-20
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-09
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-05
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 3e-05
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 5e-41
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 6e-41
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-39
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 9e-20
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-09
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-05
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 5e-05
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 2e-39
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 6e-38
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 3e-36
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 8e-36
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 4e-35
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 5e-35
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 6e-35
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 7e-35
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 1e-34
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 2e-33
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 3e-33
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 1e-32
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 1e-32
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 6e-32
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 1e-31
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 3e-31
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 1e-30
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 1e-30
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 4e-30
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 3e-29
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 3e-29
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 3e-29
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 4e-29
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 5e-29
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 6e-29
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 9e-29
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 1e-28
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-28
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 2e-28
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 3e-28
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 3e-28
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 3e-28
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 2e-27
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 4e-27
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 1e-26
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-26
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 2e-26
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 1e-25
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 1e-25
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-25
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 5e-15
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 7e-06
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-05
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 4e-04
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 3e-25
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 3e-25
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 6e-25
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 3e-24
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 5e-24
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 1e-23
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-23
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 6e-23
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 1e-22
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 1e-22
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 4e-22
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 6e-22
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 6e-21
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 5e-19
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 9e-19
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 2e-18
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 1e-17
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-16
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 6e-15
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 8e-06
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 6e-05
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 4e-16
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 8e-11
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 0.004
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-12
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-10
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-11
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 9e-08
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 6e-10
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 9e-10
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-09
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 2e-08
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-07
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-04
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 3e-06
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-06
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-06
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 5e-06
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 5e-05
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 6e-05
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-04
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.003
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 8e-04
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.001
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.003
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.003
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  149 bits (378), Expect = 2e-41
 Identities = 51/124 (41%), Positives = 79/124 (63%)

Query: 488 EKLREVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRT 547
           ++  + +   L+ +DGF+    I V+ ATNRPD LDPAL+RPGR DR+V  GLPD+ GR 
Sbjct: 129 DEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGRE 188

Query: 548 HIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEA 607
            I K+H R + +  DI   ++AR  P  +GA++ ++  EA +FA R  ++V S  +F +A
Sbjct: 189 QILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKA 248

Query: 608 VNKV 611
            +K+
Sbjct: 249 KDKI 252
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.92
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.86
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.81
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.79
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.78
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.78
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.78
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.77
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.77
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.77
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.77
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.76
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.76
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.76
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.75
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.75
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.75
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.74
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.74
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.74
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.73
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.73
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.73
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.72
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.72
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.72
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.72
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.71
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.71
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.7
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.7
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.7
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.69
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.69
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.69
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.69
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.69
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.69
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.69
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.69
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.69
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.68
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.68
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.67
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.67
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.67
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.66
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.65
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.63
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.62
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.59
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.56
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.35
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.32
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.3
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.24
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.22
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.2
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.2
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.17
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.86
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.77
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.73
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.58
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 98.52
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.44
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.43
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.43
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 98.42
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.26
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.93
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.76
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 97.71
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.63
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 97.63
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.61
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.61
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.59
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.45
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.41
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.4
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.38
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.26
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.23
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.22
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.19
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.14
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.1
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 97.06
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.05
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.95
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.95
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.9
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.83
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.8
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.78
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.77
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.77
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.75
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.75
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.72
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.64
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.62
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.58
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.54
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.49
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.47
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.29
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 95.88
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.7
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.66
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.65
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.65
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.6
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.42
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.18
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.16
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.14
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.69
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.45
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.08
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.95
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.84
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.8
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.69
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.4
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.13
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.06
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.94
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.88
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.29
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.08
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.07
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.77
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.37
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 90.99
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.99
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.88
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.79
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.7
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.66
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 90.07
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.91
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.86
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.84
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.75
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 89.62
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.58
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.53
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 89.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.42
d1okkd2207 GTPase domain of the signal recognition particle r 89.41
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.2
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.05
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.04
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.04
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.99
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.87
d1vmaa2213 GTPase domain of the signal recognition particle r 88.7
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.65
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.59
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.52
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 88.3
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.29
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 88.26
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.03
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.93
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.79
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.77
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 87.64
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.57
d2qy9a2211 GTPase domain of the signal recognition particle r 87.5
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.46
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.4
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.38
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 87.33
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.29
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 87.26
d1ls1a2207 GTPase domain of the signal sequence recognition p 87.26
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.85
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 86.73
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.65
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.65
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 86.55
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 86.53
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.49
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.35
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.22
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 86.21
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.09
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.09
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 85.51
d2hyda1255 Putative multidrug export ATP-binding/permease pro 85.33
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.3
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.16
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 85.14
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 84.86
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 84.84
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 84.74
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.73
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 84.4
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 84.02
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 83.66
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 83.48
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.47
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.98
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.89
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 82.83
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 82.79
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 82.74
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 82.74
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.66
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 82.63
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.54
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.46
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 82.39
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 82.3
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.29
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 82.26
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 82.24
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.22
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 81.59
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 81.49
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 81.38
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.25
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.09
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.06
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 80.75
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 80.63
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.58
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 80.51
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 80.14
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 80.01
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=3.4e-45  Score=374.23  Aligned_cols=247  Identities=36%  Similarity=0.618  Sum_probs=210.9

Q ss_pred             CCccccCCCCCcHHHH--HHHHHHHhCcccccccCCCCCCcEEeeCCCCCchhHHHHHHhhccCceeEEeecccceeeee
Q psy6523          94 GGARFDDGAGGDNEVQ--RTMLELINQPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYV  171 (713)
Q Consensus        94 ~~~r~~d~iG~~~~~~--~~i~~~l~~~~~~~~~gi~~p~gvLL~GPpGtGKT~la~alA~e~~~~~~~V~~~~i~s~~~  171 (713)
                      ..++|+|++|.++..+  +.+..++.+|+.|.++|+++|+|+|||||||||||++|+++|++++.+++.|+.+++.++|.
T Consensus         7 ~~~t~~Di~Gl~~~k~~l~e~v~~~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~~~~   86 (256)
T d1lv7a_           7 IKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFV   86 (256)
T ss_dssp             SCCCGGGSCSCHHHHHHTHHHHHHHHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTTSCC
T ss_pred             CCCCHHHHhchHHHHHHHHHHHHHHHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhhcch
Confidence            4679999988887654  34456789999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeecccCCCCCCCCCcccccccccccccCcCCchhhhhhccCceeeeeeeechhhHHhhcccccCCCCCCceEEEEcc
Q psy6523         172 GERVLMEGCNNEGCGVPNRMDRIVGGWTTEVNEYPWVVALEQAGKFFCGGTLISDRYVLTAAHCVRSSKRQKDLIVVISE  251 (713)
Q Consensus       172 Ges~~~~~~~~~~~~~~~~~~rI~~g~~~~~~~~P~~~~l~e~~~~~cggslI~~r~vltaa~c~~~~~~~~~~vv~ig~  251 (713)
                      |+++                .+|...|+.+...+|+++++|+++.++..++                             
T Consensus        87 g~~~----------------~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~-----------------------------  121 (256)
T d1lv7a_          87 GVGA----------------SRVRDMFEQAKKAAPCIIFIDEIDAVGRQRG-----------------------------  121 (256)
T ss_dssp             CCCH----------------HHHHHHHHHHHTTCSEEEEETTHHHHTCCCS-----------------------------
T ss_pred             hHHH----------------HHHHHHHHHHHHcCCEEEEEEChhhhCccCC-----------------------------
Confidence            9987                5677778888889999999998755221000                             


Q ss_pred             ccCCcccccceEEEEeeEEeeCCCCCcCCCCCCccceEEEecCCCCCCCCCcccccCCCCCCccCCCceEEEeeccccCC
Q psy6523         252 HNRATVYETQIETRRVVKVLTHPKYNAQGAKSHDHDIALLKLDTPLEFKPTVSPVCLPQLGEKFTQRTGTVVGWGRVEES  331 (713)
Q Consensus       252 ~~~~~~~d~~~~~~~v~~ii~h~~~~~~~~~~~~~diall~L~~p~~~~~~i~~icl~~~~~~~~~~~~~v~GwG~~~~~  331 (713)
                          .                                                                           
T Consensus       122 ----~---------------------------------------------------------------------------  122 (256)
T d1lv7a_         122 ----A---------------------------------------------------------------------------  122 (256)
T ss_dssp             ----T---------------------------------------------------------------------------
T ss_pred             ----C---------------------------------------------------------------------------
Confidence                0                                                                           


Q ss_pred             CCcchhcccccccccChhhhhcCCCccccccCcccccCCCCCCCCCccccccHhhHHHHHHhcCCccchhhhhHHHHHHH
Q psy6523         332 GQIASDLRATQVPVMSNQECRQFPGFEAKLTGNMMCAGYVEGGKDSCQVTLDEADIALLKSYGQGQYTKSIKAVEDDIQA  411 (713)
Q Consensus       332 ~~~~~~L~~~~~~~~~~~~c~~~~~~~~~it~~~~cAG~~~~~~d~c~~~l~e~d~~~~~~~~~~~~~~~~~~~~~~~~~  411 (713)
                                                                                    +                 
T Consensus       123 --------------------------------------------------------------~-----------------  123 (256)
T d1lv7a_         123 --------------------------------------------------------------G-----------------  123 (256)
T ss_dssp             --------------------------------------------------------------T-----------------
T ss_pred             --------------------------------------------------------------C-----------------
Confidence                                                                          0                 


Q ss_pred             HHHHhhhccCcccCCCCCCCCCccccccchhhhccCCCceecccCCCCCCccchhcccccCCCcccccccccHHHHHHHH
Q psy6523         412 VIKRVNELTGIKESDTGLAPPALWDLTADKQTLQNEQPLQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIEKLR  491 (713)
Q Consensus       412 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~s~~~~~~~~~~~~~~~~~gg~~~~~~~~~  491 (713)
                                                                                         ..+    .+...+
T Consensus       124 -------------------------------------------------------------------~~~----~~~~~~  132 (256)
T d1lv7a_         124 -------------------------------------------------------------------LGG----GHDERE  132 (256)
T ss_dssp             -------------------------------------------------------------------SCC----TTCHHH
T ss_pred             -------------------------------------------------------------------CCC----CcHHHH
Confidence                                                                               000    001224


Q ss_pred             HHHHhhhhcccCCCCCCCeEEEEecCCCCCccccccCCCCCCeEEEecCCCHHHHHHHHHHhhccCCCcccccHHHHHHh
Q psy6523         492 EVVETPLLHLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARL  571 (713)
Q Consensus       492 ~~v~~lL~~~d~~~~~~~v~vi~aTN~p~~lD~Al~RpGRfd~~i~i~~P~~~~R~~il~~~~~~~~~~~~~~~~~la~~  571 (713)
                      +++++||++||++...++|+||+|||+|+.||||++||||||++|+|++|+.++|.+||+.+++++++..++++..||+.
T Consensus       133 ~~~~~ll~~~d~~~~~~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~  212 (256)
T d1lv7a_         133 QTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARG  212 (256)
T ss_dssp             HHHHHHHHHHHTCCSSSCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHT
T ss_pred             HHHHHHHHHhhCCCCCCCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHHHHh
Confidence            78999999999999888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHhhhcCHHHHHHHHhHhhhc
Q psy6523         572 CPNSTGAEIRSVCTEAGMFAIRARRKVASEKDFLEAVNKVARC  614 (713)
Q Consensus       572 t~g~sgadi~~l~~~A~~~a~~~~~~~v~~~d~~~a~~~~~~~  614 (713)
                      |+||||+||.++|++|++.|+++++..++.+||+.|++++..+
T Consensus       213 t~G~s~adi~~l~~~A~~~a~~~~~~~i~~~d~~~Al~rv~~g  255 (256)
T d1lv7a_         213 TPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG  255 (256)
T ss_dssp             CTTCCHHHHHHHHHHHHHHHHHTTCSSBCHHHHHHHHHHHTTC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHcCCCccCHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999987543
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure