Psyllid ID: psy6549
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| 321479332 | 227 | hypothetical protein DAPPUDRAFT_299903 [ | 0.908 | 0.436 | 0.494 | 1e-17 | |
| 405973002 | 181 | Vesicle transport through interaction wi | 0.981 | 0.591 | 0.457 | 4e-17 | |
| 312372523 | 112 | hypothetical protein AND_30241 [Anophele | 0.917 | 0.892 | 0.48 | 3e-16 | |
| 443693796 | 222 | hypothetical protein CAPTEDRAFT_161960 [ | 0.990 | 0.486 | 0.416 | 7e-16 | |
| 346469721 | 227 | hypothetical protein [Amblyomma maculatu | 0.954 | 0.458 | 0.451 | 2e-15 | |
| 41054742 | 225 | vesicle transport through interaction wi | 0.954 | 0.462 | 0.451 | 2e-15 | |
| 383858688 | 113 | PREDICTED: vesicle transport through int | 0.972 | 0.938 | 0.490 | 8e-15 | |
| 348515987 | 226 | PREDICTED: vesicle transport through int | 0.862 | 0.415 | 0.478 | 8e-15 | |
| 410925598 | 224 | PREDICTED: vesicle transport through int | 0.972 | 0.473 | 0.433 | 9e-15 | |
| 118783148 | 111 | AGAP003112-PA [Anopheles gambiae str. PE | 0.935 | 0.918 | 0.460 | 2e-14 |
| >gi|321479332|gb|EFX90288.1| hypothetical protein DAPPUDRAFT_299903 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 93.6 bits (231), Expect = 1e-17, Method: Compositional matrix adjust.
Identities = 49/99 (49%), Positives = 68/99 (68%)
Query: 8 TLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSR 67
T+R+ L RT +S+ R+ Q ALE+E IGTGVI EL QRE LVR RDRL +TD + R
Sbjct: 128 TVRQGTAILERTSQSLYRTTQVALESEDIGTGVIQELSQQREVLVRTRDRLTETDAELGR 187
Query: 68 SRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIF 106
SRR+++++ R NKL LI+II++E L+ ++Y K F
Sbjct: 188 SRRILKSMSRVAMTNKLVLIVIILLEICILTGLVYYKFF 226
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|405973002|gb|EKC37742.1| Vesicle transport through interaction with t-SNAREs-like protein 1B [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|312372523|gb|EFR20467.1| hypothetical protein AND_30241 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|443693796|gb|ELT95070.1| hypothetical protein CAPTEDRAFT_161960 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|346469721|gb|AEO34705.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|41054742|ref|NP_957330.1| vesicle transport through interaction with t-SNAREs homolog 1B [Danio rerio] gi|32766295|gb|AAH55131.1| Vesicle transport through interaction with t-SNAREs homolog 1B (yeast) [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|383858688|ref|XP_003704831.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|348515987|ref|XP_003445521.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|410925598|ref|XP_003976267.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|118783148|ref|XP_312794.3| AGAP003112-PA [Anopheles gambiae str. PEST] gi|116129074|gb|EAA08377.3| AGAP003112-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| ZFIN|ZDB-GENE-040426-1148 | 225 | vti1b "vesicle transport throu | 0.944 | 0.457 | 0.388 | 5.6e-13 | |
| UNIPROTKB|E1BUX5 | 232 | VTI1B "Uncharacterized protein | 0.954 | 0.448 | 0.365 | 3.9e-12 | |
| MGI|MGI:1855688 | 232 | Vti1b "vesicle transport throu | 0.935 | 0.439 | 0.362 | 3.5e-11 | |
| RGD|1560475 | 232 | RGD1560475 "similar to vesicle | 0.935 | 0.439 | 0.362 | 4.5e-11 | |
| UNIPROTKB|P58200 | 232 | Vti1b "Vesicle transport throu | 0.935 | 0.439 | 0.362 | 4.5e-11 | |
| UNIPROTKB|Q9UEU0 | 232 | VTI1B "Vesicle transport throu | 0.935 | 0.439 | 0.352 | 1.2e-10 | |
| UNIPROTKB|F1N1Z0 | 232 | VTI1B "Vesicle transport throu | 0.944 | 0.443 | 0.339 | 1.5e-10 | |
| UNIPROTKB|F1SA25 | 232 | VTI1B "Uncharacterized protein | 0.944 | 0.443 | 0.339 | 2e-10 | |
| UNIPROTKB|Q2KIU0 | 232 | VTI1B "Vesicle transport throu | 0.944 | 0.443 | 0.330 | 7.7e-10 | |
| RGD|2323682 | 231 | LOC100359512 "vesicle transpor | 0.935 | 0.441 | 0.333 | 1.2e-08 |
| ZFIN|ZDB-GENE-040426-1148 vti1b "vesicle transport through interaction with t-SNAREs homolog 1B (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
Identities = 40/103 (38%), Positives = 58/103 (56%)
Query: 6 RETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHV 65
R L + ++L +SI RS++ A E + IGT +I ELG QRE L R RDRLV+T ++
Sbjct: 123 RALLIQGTESLNNASKSIERSQRIAAETDQIGTDIIEELGEQREQLDRTRDRLVNTGENL 182
Query: 66 XXXXXXXXXXXXXVFYNKLFLIMIIVIESMTLSVMLYLKIFKK 108
+ NKL L +II++E L ++YLK F+K
Sbjct: 183 SRSRKILRAMSRRIVTNKLLLSIIIIMEVAILGGVVYLKFFRK 225
|
|
| UNIPROTKB|E1BUX5 VTI1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1855688 Vti1b "vesicle transport through interaction with t-SNAREs 1B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1560475 RGD1560475 "similar to vesicle transport through interaction with t-SNAREs 1B homolog" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P58200 Vti1b "Vesicle transport through interaction with t-SNAREs homolog 1B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UEU0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N1Z0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SA25 VTI1B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KIU0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|2323682 LOC100359512 "vesicle transport through interaction with t-SNAREs 1B-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| pfam12352 | 66 | pfam12352, V-SNARE_C, Snare region anchored in the | 1e-07 |
| >gnl|CDD|152787 pfam12352, V-SNARE_C, Snare region anchored in the vesicle membrane C-terminus | Back alignment and domain information |
|---|
Score = 44.9 bits (107), Expect = 1e-07
Identities = 22/66 (33%), Positives = 38/66 (57%)
Query: 14 QALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQ 73
+ L+R + + S + A E +IG ++ +L QRE L RAR++L +TD + +S ++
Sbjct: 1 ERLLREHDRLKNSHRIADETISIGQAILEDLHSQRETLKRARNKLHNTDNRLGKSNSTLR 60
Query: 74 AIRRRV 79
I RR
Sbjct: 61 LINRRR 66
|
Within the SNARE proteins interactions in the C-terminal half of the SNARE helix are critical to the driving of membrane fusion; whereas interactions in the N-terminal half of the SNARE domain are important for promoting priming or docking of the vesicle pfam05008. Length = 66 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| KOG1666|consensus | 220 | 100.0 | ||
| PF12352 | 66 | V-SNARE_C: Snare region anchored in the vesicle me | 99.7 | |
| PF03908 | 92 | Sec20: Sec20; InterPro: IPR005606 Sec20 is a membr | 99.54 | |
| KOG3251|consensus | 213 | 99.53 | ||
| KOG3208|consensus | 231 | 98.82 | ||
| KOG0812|consensus | 311 | 98.51 | ||
| KOG3065|consensus | 273 | 98.39 | ||
| PF00957 | 89 | Synaptobrevin: Synaptobrevin; InterPro: IPR001388 | 98.32 | |
| smart00397 | 66 | t_SNARE Helical region found in SNAREs. All alpha- | 98.07 | |
| KOG3202|consensus | 235 | 97.87 | ||
| KOG0860|consensus | 116 | 97.81 | ||
| COG5074 | 280 | t-SNARE complex subunit, syntaxin [Intracellular t | 97.53 | |
| KOG0810|consensus | 297 | 97.37 | ||
| PF05739 | 63 | SNARE: SNARE domain; InterPro: IPR000727 The proce | 97.37 | |
| PF09753 | 251 | Use1: Membrane fusion protein Use1; InterPro: IPR0 | 97.29 | |
| KOG0811|consensus | 269 | 97.29 | ||
| COG5325 | 283 | t-SNARE complex subunit, syntaxin [Intracellular t | 97.24 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 97.19 | |
| KOG3385|consensus | 118 | 97.07 | ||
| KOG2678|consensus | 244 | 97.04 | ||
| KOG3894|consensus | 316 | 97.02 | ||
| cd00193 | 60 | t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu | 97.02 | |
| KOG0809|consensus | 305 | 95.43 | ||
| PF00957 | 89 | Synaptobrevin: Synaptobrevin; InterPro: IPR001388 | 95.17 | |
| PRK01026 | 77 | tetrahydromethanopterin S-methyltransferase subuni | 95.11 | |
| PF04210 | 70 | MtrG: Tetrahydromethanopterin S-methyltransferase, | 95.02 | |
| TIGR01149 | 70 | mtrG N5-methyltetrahydromethanopterin:coenzyme M m | 94.02 | |
| PF12911 | 56 | OppC_N: N-terminal TM domain of oligopeptide trans | 93.1 | |
| COG4064 | 75 | MtrG Tetrahydromethanopterin S-methyltransferase, | 92.91 | |
| KOG3065|consensus | 273 | 92.88 | ||
| PF09889 | 59 | DUF2116: Uncharacterized protein containing a Zn-r | 92.28 | |
| KOG0859|consensus | 217 | 90.54 | ||
| PF07423 | 217 | DUF1510: Protein of unknown function (DUF1510); In | 89.65 | |
| PRK10132 | 108 | hypothetical protein; Provisional | 89.47 | |
| PF12669 | 58 | P12: Virus attachment protein p12 family | 88.83 | |
| PHA03240 | 258 | envelope glycoprotein M; Provisional | 87.58 | |
| PF08114 | 43 | PMP1_2: ATPase proteolipid family; InterPro: IPR01 | 87.53 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 87.24 | |
| PF04678 | 180 | DUF607: Protein of unknown function, DUF607; Inter | 87.13 | |
| KOG0862|consensus | 216 | 87.08 | ||
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 86.22 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 85.94 | |
| PF05283 | 186 | MGC-24: Multi-glycosylated core protein 24 (MGC-24 | 85.71 | |
| PF02439 | 38 | Adeno_E3_CR2: Adenovirus E3 region protein CR2; In | 85.59 | |
| PHA02844 | 75 | putative transmembrane protein; Provisional | 84.82 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 84.67 | |
| PHA02650 | 81 | hypothetical protein; Provisional | 84.36 | |
| PF00523 | 490 | Fusion_gly: Fusion glycoprotein F0; InterPro: IPR0 | 84.26 | |
| PF09889 | 59 | DUF2116: Uncharacterized protein containing a Zn-r | 83.66 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 83.61 | |
| PF10151 | 469 | DUF2359: Uncharacterised conserved protein (DUF235 | 82.95 | |
| PF14283 | 218 | DUF4366: Domain of unknown function (DUF4366) | 81.22 | |
| PF12352 | 66 | V-SNARE_C: Snare region anchored in the vesicle me | 80.76 |
| >KOG1666|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-32 Score=198.00 Aligned_cols=105 Identities=33% Similarity=0.539 Sum_probs=103.6
Q ss_pred chHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhhhHhhhHHHHHHHHHHHHHHHHHHHh
Q psy6549 2 EKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFY 81 (109)
Q Consensus 2 ~~~~R~~ll~~~~~l~~t~~~L~~s~~~~~ete~iG~~il~~L~~Qre~L~~~~~~~~~i~~~l~~a~~~l~~m~rr~~~ 81 (109)
+.+||.+||+|++++++++++|.+|+|++.|||+||.+|+++|+.|||+|+++++.+.++|+++++|+++|+.|.||+++
T Consensus 116 ~~dQR~rLl~nTerLeRst~rl~ds~Ria~ETEqIG~~IL~dL~~QRe~L~rar~rL~~td~~lgkS~kiL~tM~RR~~~ 195 (220)
T KOG1666|consen 116 SADQRARLLQNTERLERSTDRLKDSQRIALETEQIGSEILEDLHGQREQLERARERLRETDANLGKSRKILTTMTRRLIR 195 (220)
T ss_pred chhHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHHHHH
Confidence 67999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHh
Q psy6549 82 NKLFLIMIIVIESMTLSVMLYLKIF 106 (109)
Q Consensus 82 ~K~il~~ii~~l~l~i~~viy~k~~ 106 (109)
|||++++||++++++|++++|+||+
T Consensus 196 nk~~~~aii~~l~~~il~ilY~kf~ 220 (220)
T KOG1666|consen 196 NKFTLTAIIALLVLAILLILYSKFT 220 (220)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 9999999999999999999999995
|
|
| >PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C | Back alignment and domain information |
|---|
| >PF03908 Sec20: Sec20; InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway | Back alignment and domain information |
|---|
| >KOG3251|consensus | Back alignment and domain information |
|---|
| >KOG3208|consensus | Back alignment and domain information |
|---|
| >KOG0812|consensus | Back alignment and domain information |
|---|
| >KOG3065|consensus | Back alignment and domain information |
|---|
| >PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis | Back alignment and domain information |
|---|
| >smart00397 t_SNARE Helical region found in SNAREs | Back alignment and domain information |
|---|
| >KOG3202|consensus | Back alignment and domain information |
|---|
| >KOG0860|consensus | Back alignment and domain information |
|---|
| >COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0810|consensus | Back alignment and domain information |
|---|
| >PF05739 SNARE: SNARE domain; InterPro: IPR000727 The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [, ] | Back alignment and domain information |
|---|
| >PF09753 Use1: Membrane fusion protein Use1; InterPro: IPR019150 This entry represents a family of proteins, approximately 300 residues in length, involved in vesicle transport | Back alignment and domain information |
|---|
| >KOG0811|consensus | Back alignment and domain information |
|---|
| >COG5325 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3385|consensus | Back alignment and domain information |
|---|
| >KOG2678|consensus | Back alignment and domain information |
|---|
| >KOG3894|consensus | Back alignment and domain information |
|---|
| >cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent | Back alignment and domain information |
|---|
| >KOG0809|consensus | Back alignment and domain information |
|---|
| >PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis | Back alignment and domain information |
|---|
| >PRK01026 tetrahydromethanopterin S-methyltransferase subunit G; Provisional | Back alignment and domain information |
|---|
| >PF04210 MtrG: Tetrahydromethanopterin S-methyltransferase, subunit G ; InterPro: IPR005866 This model describes the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea | Back alignment and domain information |
|---|
| >TIGR01149 mtrG N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G | Back alignment and domain information |
|---|
| >PF12911 OppC_N: N-terminal TM domain of oligopeptide transport permease C | Back alignment and domain information |
|---|
| >COG4064 MtrG Tetrahydromethanopterin S-methyltransferase, subunit G [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG3065|consensus | Back alignment and domain information |
|---|
| >PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown | Back alignment and domain information |
|---|
| >KOG0859|consensus | Back alignment and domain information |
|---|
| >PF07423 DUF1510: Protein of unknown function (DUF1510); InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length | Back alignment and domain information |
|---|
| >PRK10132 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12669 P12: Virus attachment protein p12 family | Back alignment and domain information |
|---|
| >PHA03240 envelope glycoprotein M; Provisional | Back alignment and domain information |
|---|
| >PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >PF04678 DUF607: Protein of unknown function, DUF607; InterPro: IPR006769 This entry represents the C-terminal domain of coiled-coil domain containing protein 109 | Back alignment and domain information |
|---|
| >KOG0862|consensus | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor | Back alignment and domain information |
|---|
| >PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] | Back alignment and domain information |
|---|
| >PHA02844 putative transmembrane protein; Provisional | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >PHA02650 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00523 Fusion_gly: Fusion glycoprotein F0; InterPro: IPR000776 The fusion glycoproteins from this family are found in ssRNA negative-strand viruses | Back alignment and domain information |
|---|
| >PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10151 DUF2359: Uncharacterised conserved protein (DUF2359); InterPro: IPR019308 This is a 450 amino acid region of a family of proteins conserved from insects to humans | Back alignment and domain information |
|---|
| >PF14283 DUF4366: Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 109 | ||||
| 1gl2_C | 65 | Crystal Structure Of An Endosomal Snare Core Comple | 4e-05 |
| >pdb|1GL2|C Chain C, Crystal Structure Of An Endosomal Snare Core Complex Length = 65 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| 2nps_C | 81 | Vesicle transport through interaction with T- snar | 2e-15 | |
| 1gl2_C | 65 | VTI1B, vesicle transport V-snare protein VTI1-like | 4e-13 |
| >2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Length = 81 | Back alignment and structure |
|---|
Score = 64.4 bits (157), Expect = 2e-15
Identities = 25/79 (31%), Positives = 43/79 (54%)
Query: 5 HRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLH 64
R L + + L R+ + Q A+E E IG ++ L RE + RAR+RL +TD +
Sbjct: 3 MRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDAN 62
Query: 65 VSRSRRMIQAIRRRVFYNK 83
+ +S R++ + RR+ N+
Sbjct: 63 LGKSSRILTGMLRRIIQNR 81
|
| >1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| 2nps_C | 81 | Vesicle transport through interaction with T- snar | 99.93 | |
| 1gl2_C | 65 | VTI1B, vesicle transport V-snare protein VTI1-like | 99.81 | |
| 1n7s_C | 79 | SNAP-25A; neuronal snare protein complex, four hel | 99.69 | |
| 1nhl_A | 54 | Synaptosomal-associated protein 23; snare, coiled- | 99.49 | |
| 3b5n_C | 70 | Protein transport protein SEC9; snare complex, syn | 99.23 | |
| 1l4a_C | 83 | S-SNAP25 fusion protein; snare, snare complex, mem | 99.21 | |
| 3hd7_B | 109 | Syntaxin-1A; membrane protein, coiled-coil, 4-heli | 98.41 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 98.2 | |
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 97.3 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 97.27 | |
| 3b5n_D | 64 | Protein transport protein SEC9; snare complex, syn | 96.76 | |
| 2nps_D | 82 | Syntaxin-6; vesicle fusion, snare complex, early e | 96.65 | |
| 1sfc_D | 87 | Protein (SNAP-25B), protein (synaptobrevin 2); mem | 96.62 | |
| 1gl2_D | 65 | Syntaxin 8, vesicle transport V-snare protein VTI1 | 96.62 | |
| 1n7s_D | 66 | SNAP-25A; neuronal snare protein complex, four hel | 96.42 | |
| 1l4a_D | 87 | S-SNAP25 fusion protein; snare, snare complex, mem | 96.16 | |
| 1jth_B | 77 | Syntaxin 1A; coiled-coil, polar layer, endocytosis | 93.27 | |
| 2nps_B | 71 | Syntaxin 13, vesicle-associated membrane protein 4 | 90.18 | |
| 1gl2_B | 65 | Syntaxin 7; membrane protein, membrane fusion prot | 89.94 | |
| 3b5n_B | 69 | Protein SSO1; snare complex, syntaxin, synaptobrev | 89.22 | |
| 1n7s_B | 68 | Syntaxin 1A; neuronal snare protein complex, four | 88.01 | |
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 86.83 | |
| 3ljc_A | 252 | ATP-dependent protease LA; LON N-domain, allosteri | 83.72 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 82.8 | |
| 1sfc_B | 83 | Protein (syntaxin 1A), protein (synaptobrevin 2); | 82.45 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 80.4 | |
| 1sfc_A | 96 | VAMP 2, protein (synaptobrevin 2); membrane fusion | 80.2 |
| >2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.93 E-value=4.3e-26 Score=143.28 Aligned_cols=80 Identities=31% Similarity=0.514 Sum_probs=77.1
Q ss_pred HHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhhhHhhhHHHHHHHHHHHHHHHHHHHhhH
Q psy6549 4 IHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNK 83 (109)
Q Consensus 4 ~~R~~ll~~~~~l~~t~~~L~~s~~~~~ete~iG~~il~~L~~Qre~L~~~~~~~~~i~~~l~~a~~~l~~m~rr~~~~K 83 (109)
+||++||++++++++++++|.+|++++.|||++|.+|+++|+.|||+|.+++++++++|+++++|+++|+.|.||+++||
T Consensus 2 ~qR~~Ll~~t~~L~rt~~~L~~s~r~~~ETE~iG~~il~~L~~QRE~l~~~~~~l~~~d~~l~~s~k~l~~M~rr~~~nK 81 (81)
T 2nps_C 2 SMRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDANLGKSSRILTGMLRRIIQNR 81 (81)
T ss_dssp TTTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred cHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhHHhHHHHHHHHHHHHHHHHHhCC
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999987
|
| >1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A | Back alignment and structure |
|---|
| >1nhl_A Synaptosomal-associated protein 23; snare, coiled-coil, protein transport; 2.30A {Homo sapiens} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >3b5n_C Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >3hd7_B Syntaxin-1A; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_B 3ipd_B | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A | Back alignment and structure |
|---|
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A | Back alignment and structure |
|---|
| >3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nps_D Syntaxin-6; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1gl2_D Syntaxin 8, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B | Back alignment and structure |
|---|
| >1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1jth_B Syntaxin 1A; coiled-coil, polar layer, endocytosis-exocytosis complex; 2.00A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1hvv_A* 1urq_B | Back alignment and structure |
|---|
| >2nps_B Syntaxin 13, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1gl2_B Syntaxin 7; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >3b5n_B Protein SSO1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1n7s_B Syntaxin 1A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_B 3rk3_B 3rl0_B 1kil_B | Back alignment and structure |
|---|
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sfc_B Protein (syntaxin 1A), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1l4a_B | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00