Psyllid ID: psy6569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 307189202 | 175 | U1 small nuclear ribonucleoprotein C [Ca | 0.536 | 0.502 | 0.829 | 5e-38 | |
| 332017058 | 175 | U1 small nuclear ribonucleoprotein C [Ac | 0.536 | 0.502 | 0.829 | 9e-38 | |
| 307206317 | 175 | U1 small nuclear ribonucleoprotein C [Ha | 0.542 | 0.508 | 0.820 | 1e-37 | |
| 189234617 | 153 | PREDICTED: similar to CG5454 CG5454-PA [ | 0.512 | 0.549 | 0.847 | 9e-37 | |
| 242010156 | 173 | U1 small nuclear ribonucleoprotein C, pu | 0.487 | 0.462 | 0.901 | 3e-36 | |
| 19577373 | 151 | putative sRNP [Anopheles gambiae] | 0.646 | 0.701 | 0.702 | 4e-36 | |
| 170070053 | 145 | U1 small nuclear ribonucleoprotein C [Cu | 0.652 | 0.737 | 0.682 | 5e-36 | |
| 363805511 | 151 | RecName: Full=U1 small nuclear ribonucle | 0.652 | 0.708 | 0.694 | 5e-36 | |
| 58395833 | 152 | AGAP001584-PA [Anopheles gambiae str. PE | 0.652 | 0.703 | 0.702 | 7e-36 | |
| 357625180 | 167 | hypothetical protein KGM_20795 [Danaus p | 0.512 | 0.502 | 0.845 | 3e-35 |
| >gi|307189202|gb|EFN73650.1| U1 small nuclear ribonucleoprotein C [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 162 bits (410), Expect = 5e-38, Method: Compositional matrix adjust.
Identities = 73/88 (82%), Positives = 79/88 (89%)
Query: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAG 60
MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVK++YQKWMEEQAQ+LIDATTAA+KAG
Sbjct: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKYFYQKWMEEQAQHLIDATTAAFKAG 60
Query: 61 KIANNPFGNKGGAAIPPPSNLSSLMPPR 88
KIA+NPF GAAIPPP NL S + R
Sbjct: 61 KIASNPFAANKGAAIPPPPNLGSSLGSR 88
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332017058|gb|EGI57857.1| U1 small nuclear ribonucleoprotein C [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307206317|gb|EFN84374.1| U1 small nuclear ribonucleoprotein C [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|189234617|ref|XP_975233.2| PREDICTED: similar to CG5454 CG5454-PA [Tribolium castaneum] gi|270001649|gb|EEZ98096.1| hypothetical protein TcasGA2_TC000509 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242010156|ref|XP_002425842.1| U1 small nuclear ribonucleoprotein C, putative [Pediculus humanus corporis] gi|363805525|sp|E0VI98.1|RU1C_PEDHC RecName: Full=U1 small nuclear ribonucleoprotein C; Short=U1 snRNP C; Short=U1-C; Short=U1C gi|212509775|gb|EEB13104.1| U1 small nuclear ribonucleoprotein C, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|19577373|emb|CAD27755.1| putative sRNP [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|170070053|ref|XP_001869448.1| U1 small nuclear ribonucleoprotein C [Culex quinquefasciatus] gi|167865897|gb|EDS29280.1| U1 small nuclear ribonucleoprotein C [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|363805511|sp|E3X5D6.1|RU1C_ANODA RecName: Full=U1 small nuclear ribonucleoprotein C; Short=U1 snRNP C; Short=U1-C; Short=U1C gi|312375503|gb|EFR22865.1| hypothetical protein AND_14095 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|58395833|ref|XP_321527.2| AGAP001584-PA [Anopheles gambiae str. PEST] gi|122064007|sp|Q7PXU6.2|RU1C_ANOGA RecName: Full=U1 small nuclear ribonucleoprotein C; Short=U1 snRNP C; Short=U1-C; Short=U1C gi|55233767|gb|EAA00983.2| AGAP001584-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|357625180|gb|EHJ75707.1| hypothetical protein KGM_20795 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| FB|FBgn0261792 | 145 | snRNP-U1-C "small ribonucleopr | 0.445 | 0.503 | 0.891 | 3.6e-34 | |
| UNIPROTKB|E1C6F0 | 159 | SNRPC "U1 small nuclear ribonu | 0.457 | 0.471 | 0.766 | 5.6e-29 | |
| UNIPROTKB|Q32PA0 | 159 | SNRPC "U1 small nuclear ribonu | 0.408 | 0.421 | 0.820 | 1.9e-28 | |
| UNIPROTKB|E2RGI3 | 159 | SNRPC "U1 small nuclear ribonu | 0.408 | 0.421 | 0.820 | 1.9e-28 | |
| UNIPROTKB|K9J6N9 | 127 | K9J6N9 "Uncharacterized protei | 0.408 | 0.527 | 0.820 | 1.9e-28 | |
| UNIPROTKB|P09234 | 159 | SNRPC "U1 small nuclear ribonu | 0.408 | 0.421 | 0.820 | 1.9e-28 | |
| UNIPROTKB|F1RZ16 | 159 | SNRPC "Uncharacterized protein | 0.408 | 0.421 | 0.820 | 1.9e-28 | |
| MGI|MGI:109489 | 159 | Snrpc "U1 small nuclear ribonu | 0.408 | 0.421 | 0.820 | 3.1e-28 | |
| RGD|1306065 | 159 | Snrpc "small nuclear ribonucle | 0.408 | 0.421 | 0.820 | 3.1e-28 | |
| RGD|1588146 | 159 | LOC682020 "similar to U1 small | 0.408 | 0.421 | 0.820 | 3.1e-28 |
| FB|FBgn0261792 snRNP-U1-C "small ribonucleoprotein particle U1 subunit C" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 371 (135.7 bits), Expect = 3.6e-34, P = 3.6e-34
Identities = 66/74 (89%), Positives = 69/74 (93%)
Query: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAG 60
MPKYYCDYCDTYLTHDSPSVRKTHC GRKH+DNVKFYYQKWMEEQAQ+LIDATTAA+KAG
Sbjct: 1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAG 60
Query: 61 KIANNPF-GNKGGA 73
KI NNPF G GGA
Sbjct: 61 KITNNPFAGGPGGA 74
|
|
| UNIPROTKB|E1C6F0 SNRPC "U1 small nuclear ribonucleoprotein C" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32PA0 SNRPC "U1 small nuclear ribonucleoprotein C" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGI3 SNRPC "U1 small nuclear ribonucleoprotein C" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K9J6N9 K9J6N9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09234 SNRPC "U1 small nuclear ribonucleoprotein C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZ16 SNRPC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109489 Snrpc "U1 small nuclear ribonucleoprotein C" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306065 Snrpc "small nuclear ribonucleoprotein polypeptide C" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1588146 LOC682020 "similar to U1 small nuclear ribonucleoprotein C (U1 snRNP protein C) (U1C protein) (U1-C)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| pfam06220 | 38 | pfam06220, zf-U1, U1 zinc finger | 5e-22 | |
| COG5136 | 188 | COG5136, COG5136, U1 snRNP-specific protein C [RNA | 6e-14 | |
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 3e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-05 | |
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 3e-04 | |
| pfam12171 | 27 | pfam12171, zf-C2H2_jaz, Zinc-finger double-strande | 4e-04 |
| >gnl|CDD|114912 pfam06220, zf-U1, U1 zinc finger | Back alignment and domain information |
|---|
Score = 82.9 bits (205), Expect = 5e-22
Identities = 33/38 (86%), Positives = 34/38 (89%)
Query: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYY 38
MPKYYCDYCD YLTHDSPSVRK+H GRKHKDNVK YY
Sbjct: 1 MPKYYCDYCDCYLTHDSPSVRKSHNGGRKHKDNVKDYY 38
|
This family consists of several U1 small nuclear ribonucleoprotein C (U1-C) proteins. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site (ss) at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' ss is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' ss. Binding of TIA-1 in the vicinity of a 5' ss helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator. This domain is probably a zinc-binding. It is found in multiple copies in some members of the family. Length = 38 |
| >gnl|CDD|227465 COG5136, COG5136, U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
| >gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| KOG3454|consensus | 165 | 99.96 | ||
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 99.81 | |
| COG5136 | 188 | U1 snRNP-specific protein C [RNA processing and mo | 99.67 | |
| KOG0150|consensus | 336 | 99.15 | ||
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 99.09 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.55 | |
| KOG4727|consensus | 193 | 98.34 | ||
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.1 | |
| KOG0717|consensus | 508 | 97.51 | ||
| KOG1924|consensus | 1102 | 96.95 | ||
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 96.95 | |
| KOG2893|consensus | 341 | 96.68 | ||
| KOG3408|consensus | 129 | 96.65 | ||
| KOG0227|consensus | 222 | 96.62 | ||
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 96.19 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 96.01 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 95.48 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.17 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 94.83 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 94.78 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 94.73 | |
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 94.42 | |
| KOG2384|consensus | 223 | 93.46 | ||
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 93.21 | |
| KOG3032|consensus | 264 | 93.19 | ||
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 93.12 | |
| KOG2785|consensus | 390 | 92.02 | ||
| KOG0796|consensus | 319 | 91.97 | ||
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 91.41 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 91.05 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 88.46 | |
| KOG2837|consensus | 309 | 87.89 | ||
| PTZ00448 | 373 | hypothetical protein; Provisional | 84.16 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 84.07 | |
| COG5200 | 258 | LUC7 U1 snRNP component, mediates U1 snRNP associa | 83.16 | |
| PF02892 | 45 | zf-BED: BED zinc finger; InterPro: IPR003656 Zinc | 83.01 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 80.19 |
| >KOG3454|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=3.2e-29 Score=202.93 Aligned_cols=71 Identities=72% Similarity=1.173 Sum_probs=68.1
Q ss_pred CCcccccCCcceeccCChHHHHhhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCC
Q psy6569 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAGKIANNPFGNKG 71 (164)
Q Consensus 1 MPRYYCDYCdk~fthDS~SvRK~H~~GkKHk~NVkryY~~~~eeqaq~iiD~~tra~~~G~~~~~p~~~~p 71 (164)
|+||||||||+||||||+||||+|+.|+||++||+.||++|.||+||.+||+++++|..+++...+|.+..
T Consensus 1 MpRYyCDYCdt~LthDslsvRK~H~~GrkH~~nvk~YY~k~~eeqAq~liD~~~~~~~~~~g~~~~~~~~~ 71 (165)
T KOG3454|consen 1 MPRYYCDYCDTYLTHDSLSVRKTHCGGRKHKDNVKDYYQKWMEEQAQKLIDETILRFIGKKGQKVPFSNAR 71 (165)
T ss_pred CCcchhhhhhhhhhcccHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccCCcccccc
Confidence 89999999999999999999999999999999999999999999999999999999999999988888543
|
|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5136 U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0150|consensus | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG4727|consensus | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >KOG1924|consensus | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >KOG3408|consensus | Back alignment and domain information |
|---|
| >KOG0227|consensus | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3032|consensus | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >KOG0796|consensus | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >KOG2837|consensus | Back alignment and domain information |
|---|
| >PTZ00448 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5200 LUC7 U1 snRNP component, mediates U1 snRNP association with cap-binding complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 164 | ||||
| 2vrd_A | 61 | The Structure Of The Zinc Finger From The Human Spl | 1e-26 | ||
| 3cw1_L | 77 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 2e-26 |
| >pdb|2VRD|A Chain A, The Structure Of The Zinc Finger From The Human Spliceosomal Protein U1c Length = 61 | Back alignment and structure |
|
| >pdb|3CW1|L Chain L, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 5e-30 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 2e-08 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 2e-07 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 7e-07 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 1e-06 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 1e-06 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 1e-06 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 2e-06 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-04 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 3e-06 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 4e-06 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 5e-06 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 7e-05 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 4e-04 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 7e-05 |
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Length = 77 | Back alignment and structure |
|---|
Score = 103 bits (259), Expect = 5e-30
Identities = 55/73 (75%), Positives = 60/73 (82%)
Query: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAG 60
MPK+YCDYCDTYLTHDSPSVRKTHC GRKHK+NVK YY KWMEEQAQ+LID TTAA++ G
Sbjct: 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYCKWMEEQAQSLIDKTTAAFQQG 60
Query: 61 KIANNPFGNKGGA 73
KI PF A
Sbjct: 61 KIPPTPFSAPPPA 73
|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Length = 127 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 99.96 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 98.16 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.94 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 97.71 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 95.09 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 93.66 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 93.07 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 92.81 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.75 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 92.74 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 92.73 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.72 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.7 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 92.62 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 92.61 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 92.56 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.55 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 92.43 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 92.38 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.35 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.34 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.8 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 91.02 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.6 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 91.55 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.4 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.29 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.27 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.2 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 90.5 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 91.0 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 91.0 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 90.95 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 90.91 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.89 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 90.21 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 90.8 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.79 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 90.78 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.77 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.72 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.71 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 90.69 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 90.65 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 90.61 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.57 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.54 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.44 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.41 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.39 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.36 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.35 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 90.35 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 90.25 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.24 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.24 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 90.23 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 90.22 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.2 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.18 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 90.18 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.16 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.14 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.13 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.12 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.09 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.09 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 90.06 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.01 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.98 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.94 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.93 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.91 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.9 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.86 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.81 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.74 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.68 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.58 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.54 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.5 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.5 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.43 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.32 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 89.31 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.27 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.26 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.25 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.24 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.24 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.19 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.18 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 89.18 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.18 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.13 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.13 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.11 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 89.09 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 89.08 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.05 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 89.0 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 88.99 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 88.99 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.98 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.98 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.97 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.95 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.95 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.93 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.9 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 88.88 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.86 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.86 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.85 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 88.78 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.75 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.65 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 88.62 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 88.62 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 88.59 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.56 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.49 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.42 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.42 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.25 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.23 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 87.96 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.86 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 87.86 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.77 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.73 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.54 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 87.52 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 87.47 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.23 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 87.2 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 87.18 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 87.06 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 87.03 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 86.98 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 86.8 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 86.62 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 86.6 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 86.57 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 86.47 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 86.47 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 86.38 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 86.27 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 86.27 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 86.09 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 86.03 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 85.92 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 85.72 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 85.67 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 85.59 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 85.59 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 85.1 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 84.96 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 84.95 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 84.4 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 83.86 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 83.67 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 83.42 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 83.42 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 83.28 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 83.19 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 82.81 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 82.73 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 82.05 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.0 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 81.97 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 81.82 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 81.81 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 81.77 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 81.74 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 81.06 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 80.85 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 80.66 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 80.3 |
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
Probab=99.96 E-value=7.5e-30 Score=183.83 Aligned_cols=69 Identities=78% Similarity=1.347 Sum_probs=67.2
Q ss_pred CCcccccCCcceeccCChHHHHhhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCC
Q psy6569 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAGKIANNPFGN 69 (164)
Q Consensus 1 MPRYYCDYCdk~fthDS~SvRK~H~~GkKHk~NVkryY~~~~eeqaq~iiD~~tra~~~G~~~~~p~~~ 69 (164)
||||||||||+||+|||.++||+|++|++|++||++||++|+++++|+++|++++||++|+++.++|++
T Consensus 1 mPkYyCdYCd~~lt~Ds~s~Rk~H~~G~kH~~nv~~yy~~~~~~~~~~~id~~~~a~~~g~~~~~~~~~ 69 (77)
T 3cw1_L 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYCKWMEEQAQSLIDKTTAAFQQGKIPPTPFSA 69 (77)
T ss_pred CCCcccccCCceecCCCHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCC
Confidence 899999999999999999999999999999999999999999999999999999999999999998864
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 164 | ||||
| d2vrda1 | 61 | g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human | 3e-37 | |
| d1zu1a1 | 72 | g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF34 | 8e-06 | |
| d1zr9a1 | 67 | g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 | 4e-04 |
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Spliceosomal protein U1C species: Human (Homo sapiens) [TaxId: 9606]
Score = 120 bits (302), Expect = 3e-37
Identities = 52/61 (85%), Positives = 57/61 (93%)
Query: 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAG 60
MPK+YCDYCDTYLTHDSPSVRKTHC GRKHK+NVK YYQKWMEEQAQ+LID TTAA++ G
Sbjct: 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG 60
Query: 61 K 61
K
Sbjct: 61 K 61
|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 72 | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 99.93 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 98.46 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.95 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.74 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 95.89 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 95.37 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 92.95 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 92.93 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 91.49 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 91.08 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 90.02 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 89.95 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.93 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.92 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.83 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 89.83 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 89.62 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 89.34 | |
| d1m36a_ | 33 | Monocytic leukemia zinc finger protein Moz {Human | 89.29 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.05 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 88.62 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 88.51 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 87.81 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 87.78 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 87.63 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 87.51 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 85.78 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 84.73 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 83.81 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 83.46 | |
| d1pg5b2 | 56 | Aspartate carbamoyltransferase, Regulatory-chain, | 80.66 |
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Spliceosomal protein U1C species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=1.3e-28 Score=169.10 Aligned_cols=61 Identities=85% Similarity=1.449 Sum_probs=59.8
Q ss_pred CCcccccCCcceeccCChHHHHhhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Q psy6569 1 MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWMEEQAQNLIDATTAAYKAGK 61 (164)
Q Consensus 1 MPRYYCDYCdk~fthDS~SvRK~H~~GkKHk~NVkryY~~~~eeqaq~iiD~~tra~~~G~ 61 (164)
||||||||||+||||||+++||+|++|++|++||++||++|.++++|+++|+++++|++|+
T Consensus 1 MpryyCdYC~~~lt~ds~s~RK~H~~G~kH~~n~~~yy~~~~~~~aq~l~d~~~~~~~~~k 61 (61)
T d2vrda1 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK 61 (61)
T ss_dssp CCSCEETTTTEECSCCSHHHHHHHTCCTHHHHHHHHHTSSSSSSCCCSHHHHHHHSSSSCC
T ss_pred CCchhhhhhcchhccCChhHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccC
Confidence 8999999999999999999999999999999999999999999999999999999999986
|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pg5b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|