Psyllid ID: psy6572

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL
cccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccEEEccccEEccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccccccccccEEccccccEEccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccEEEccccEEcccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEccccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEEEccEEEEEEccccEEEEEEccccccEEccccccccEEEEEEcccccEEEEEcccccccEEEccccccccEEEEccccccEEEEccccEEEEEEccccccEEEEccccccccEEEEccccccEEEEccccccEEEEEcccccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEcccccccccccccEEEEEEccEEEEEcccccEEEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEccccEEccccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccccEEEccccEEcccccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccccccEEEcccccccccEEEEEccccEEEcccccccEEEcccccEEEEEEccEEEEEccccccccccccccccccccEEEEEEEEccccccEEEEEEccccEEEEEEccccccEEEEEcccc
ccccccEEEccccccccccccccccccccccccccEEcccccEccccEEccccccccccccccccccccccccEcccccEccccEEccccccccccccccccccccccccccccccccEccccccEccccEEEcccccccccccccccccccccccccccccccEEcccccEccccEEEccccccccccccccccccccccccccccccccEEcccccEEEcccEEEcccccccccccccccccccccccccccEcccccEEccccEEEccccccccccccccccccccccccccccEEcccccEEEHHHcccccccccccHHHcccccccccEEcccccEccccEEcccccccccccccccccccccccccccEEccccccccccEEccccccccccccccccccccccccccccccccccccccEEccccEEcccccccccccccccccccccccccccccccccccccccccEEEcccccEccccccccccccccccccccccEEEcccccEEEEcccccEEcccccccccccccccEEEEEcccEEEEEccccccEEEccccccEEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccccEEEEcccccccEEEEEcccccccEEEEEccccEEEEEEccccEEEEEEcccccEEEEEEccccccccccccEEEEEEccEEEEEEccccEEEEEEcccccccEEEEEccccccccEEEEcccccccccccccccccccccEEEEcccccEEEccccccEEcccccccccccccccEEEccccEEEccEEEccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccEccccEEcccccccccccccccccccccccccEEcccccccccEEEcccccccccccccccccccccccccEEcccccEccccEEccccccccccccccccccccccccccccccEcccccEEcccEEEcccccccccccccccccccccccccEcccccEccccEEEccccccccccccccccccccccccEcccccEEccccEEcccccccccccccccccccccccccEcccccEcccccEccccccccccccccccccccccccccccEcccccEccccEEcccccccccccccccccccccccccccEccccccccccEEcccccccccccccccccccccccccccccEcccEEEcccccEEEEccccEEEcccccccccccccccccEEEEEcccEEEEEEccccccccEEEEEEccccEEEEEEEEEEccccEEEEEEccccEEEEEEEccccEEEEEEEEcc
mcipfnqtcdrvynchdksdegilycamrdcrpgyfkcdnnkcilsshtcnnindcgdgsdeadcstcgndtfhcdmgmcihkalrcdvdpdcpdasdemhcpmtnctekyplmtnpihcnftsacieesyicdgqndcfdmsdeqncdqikdvspkmncsgdkflcrngncilsrwrcdgdndcndgndglssdemncdtestckannnvfqcdnnktciskswvcdgtydctdrsdenstycahsecnlfefrcnstgqcipitwvcdgvtdcidksdehhsqdclnVETCMEGYFKclngrcllenyycdgendcgdnsdepIVSMWKLVWKCLngrcllenyycdgendcgdnsdeppscpktdcdnsthfecqngncipsvllcngvndcddnsdedmnhAECRSLkdlckhpshflcsnglcinetltcndindcgdnsdefSCFVnecnvshggqlcahecidlkigykcacrkgyqvhpedkhlcvdtnecldrpcshycrntlgsyscscapgyallsdkhgckatsdvppnllftnkYYIREVTQAGVMTIRIHnqtnavgldfdwvdnclywsdvtmhgssirrscnnsqpellfpatspdgltvdwvgrnlywcdkglDTIEVAKLDGRFRKVLINkglqeprgialnpaygymywtdwgqnahigkakmdgsnpkviisknlswpnaltisyetnelfwgdaheDYIAVSDLNGENIKIIVSrrmdptinLHHVFALAVFEDHLFWTDWEMKSIERcdkytgkncTSVVKNlvhkpmdlrvyhpyrqtplkdnpcennggcqglcllkpnghrqcacpdnfilesdgktcrhncsagqflcektmkcipfwwkcdtqddcgdksdehdqcpqfhclpgqfqcnntkclhpnticdgvnncgdmsdelhcvdytclntqfkckrdpaqgtgdhcisllnrcdghpdcplgedehdcmpknctanefqcdvkCISLALVCDKvfdcldrsdepadctsqtcgpdyircdtgrcipktwqcdgdvdcpnredeppscadpnlytcdptyfkcnnykcipgswhcdydddcgdgsdeknctprncsesefrcangkcirphyvcngendcadhsdeincniscsknefkcshpahcissdlvcdgdtdcwdgsdeancttkckpnmftcanhqcislnwrcdgepdcsdnsdEIESICAglacepnrfkcknnkcihryamcdgidncgdnsdeshcpsiklcseanfkcangncikkelecdqyndcgdnsdeegcdsplckfrtcSQICIEKKisntertfschcaegyhmvhgknktsscvaNGKSALLLIAHTTLkvldpyasrakseisplnldatkiySVDLLYEDRNNIMVYWVDRHAKVIKMASIssgnvtrvKREMNL
mcipfnqtcdrvynchdksdeGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELlfpatspdgltvDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLinkglqeprgiaLNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRsdepadctsqtcgpdyirCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASrakseisplnldatkiYSVDLLYEDRNNIMVYWVDRHAKVIKmasissgnvtrvkremnl
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRcdgdndcndgndgLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHcdydddcgdgsdEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL
**IPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDC******************TCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGE*********************THFECQNGNCIPSVLLCNGVNDCD*********AECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSC*****ELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGD****HDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDC*********CADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGD***********CSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASI**************
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASI**************
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQ**********DQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSDEADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNSQPELLFPATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDVKCISLALVCDKVFDCLDRSDEPADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESHCPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIEKKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEISPLNLDATKIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1416 2.2.26 [Sep-21-2011]
Q91ZX7 4545 Prolow-density lipoprotei yes N/A 0.877 0.273 0.442 0.0
Q07954 4544 Prolow-density lipoprotei yes N/A 0.879 0.273 0.443 0.0
P98157 4543 Low-density lipoprotein r yes N/A 0.875 0.272 0.428 0.0
Q9NZR2 4599 Low-density lipoprotein r no N/A 0.914 0.281 0.389 0.0
Q9JI18 4599 Low-density lipoprotein r no N/A 0.851 0.262 0.411 0.0
P98158 4660 Low-density lipoprotein r no N/A 0.839 0.255 0.389 0.0
A2ARV4 4660 Low-density lipoprotein r no N/A 0.839 0.255 0.391 0.0
P98164 4655 Low-density lipoprotein r no N/A 0.858 0.261 0.402 0.0
Q04833 4753 Low-density lipoprotein r yes N/A 0.944 0.281 0.355 0.0
O75096 1905 Low-density lipoprotein r no N/A 0.473 0.351 0.413 1e-122
>sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus GN=Lrp1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1365 (44%), Positives = 793/1365 (58%), Gaps = 122/1365 (8%)

Query: 2    CIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSD 61
            CI F+ TCD V +C DKSDE   YC  R C+  + +C+N +C+ +   CN ++DCGDGSD
Sbjct: 2538 CISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVSNMLWCNGVDDCGDGSD 2597

Query: 62   EADC--STCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPI- 118
            E  C  + CG   F C  G CI  + RC+   DC DASDEM+C  T+C+  + L    + 
Sbjct: 2598 EIPCNKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVL 2657

Query: 119  --HCNFTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSR 176
               C  TS C   S++CDG NDC D SDE++C  +K    +  C  + F C +G CI   
Sbjct: 2658 FQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVK----RPRCPLNYFACPSGRCIPMS 2713

Query: 177  WRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDR 236
            W CD ++DC +G D    ++   + +         F+C N++ CISK W+CDG+ DC D 
Sbjct: 2714 WTCDKEDDCENGEDETHCNKFCSEAQ---------FECQNHR-CISKQWLCDGSDDCGDG 2763

Query: 237  SDENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEG 296
            SDE + +C    C    F C  T  C+P  W+CDG  DC D +DE  +  CL   TC + 
Sbjct: 2764 SDE-AAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCTDGADESVTAGCLYNSTCDDR 2822

Query: 297  YFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKL----VWKCLNGRCLLENYY-CDGE 351
             F C N  C+ +++ CD + DC D SDE     +       ++C NGRCL    + CDGE
Sbjct: 2823 EFMCQNRLCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECDGE 2882

Query: 352  NDCGDNSDEPP-----SCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHA 406
            NDC D+SDE P     + P+  C+ S+ F C +G C+   LLCNG +DC D SDE     
Sbjct: 2883 NDCHDHSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDER---- 2938

Query: 407  ECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAH 466
                                                       C VNEC +S     C+ 
Sbjct: 2939 ------------------------------------------GCHVNEC-LSRKLSGCSQ 2955

Query: 467  ECIDLKIGYKCACRKGYQVHPEDKHLCVDTNEC-LDRPCSHYCRNTLGSYSCSCAPGYAL 525
            +C DLKIG+KC CR G+++  +D   C D +EC    PCS  C NT GSY C C  GYA 
Sbjct: 2956 DCEDLKIGFKCRCRPGFRLK-DDGRTCADLDECSTTFPCSQLCINTHGSYKCLCVEGYAP 3014

Query: 526  L-SDKHGCKATSDVPPNLLFTNKYYIREVTQAGV-MTIRIHNQTNAVGLDFDWVDNCLYW 583
               D H CKA +D  P L+F N+YY+R++   G   T+      NAV LDFD+ +  +YW
Sbjct: 3015 RGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYW 3074

Query: 584  SDVTMHGSSIRRS-CNNSQPELLFPA--TSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDG 640
            +DVT  GS IRR   N S  ++L     ++PDGL VDWVG NLYWCDKG DTIEV+KL+G
Sbjct: 3075 TDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNG 3134

Query: 641  RFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNA 700
             +R VL++ GL+EPR + ++   GY+YWTDWG ++ IG+  MDGS   +I+   ++WPN 
Sbjct: 3135 AYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSIIVDTKITWPNG 3194

Query: 701  LTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWT 760
            LT+ Y T  ++W DA EDYI  + L+G N  +++S+      ++ H+FAL +FED+++WT
Sbjct: 3195 LTVDYVTERIYWADAREDYIEFASLDGSNRHVVLSQ------DIPHIFALTLFEDYVYWT 3248

Query: 761  DWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCE-NNGGCQGLCL 819
            DWE KSI R  K TG N T ++  L H+PMDL V+H  RQ  + ++PC+ NNGGC  LCL
Sbjct: 3249 DWETKSINRAHKTTGANKTLLISTL-HRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCL 3307

Query: 820  LKPNGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDE 879
            L P G  +CACP NF L  DG+TC  NC+A QF+C K  KCIPFWWKCDT+DDCGD SDE
Sbjct: 3308 LSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVC-KNDKCIPFWWKCDTEDDCGDHSDE 3366

Query: 880  HDQCPQFHCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPA 939
               CP+F C PGQFQC+   C +P  ICDG N+C D SDE +C  + CL +QFKC     
Sbjct: 3367 PPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNT-- 3424

Query: 940  QGTGDHCISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQCDV--KCISLALVCDKVFDC 997
                + CI  + RC+G  +C  GEDE DC    C  N+FQC +  +CI    VCD+  DC
Sbjct: 3425 ----NRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDC 3480

Query: 998  LDRSDEPADCTSQTCGPDYIRC-DTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCD 1056
            +D SDEPA+CT  TCG D  RC D+GRCIP  W+CDG+ DC +  DEP    D    TC+
Sbjct: 3481 VDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDER--TCE 3538

Query: 1057 PTYFKCNNYKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGE 1116
            P  F+C N +C+PG W CDYD+DCGD SDE++CTPR CSESEF CANG+CI   + C+G+
Sbjct: 3539 PYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGD 3598

Query: 1117 NDCADHSDEINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTT---KCKP 1173
            +DCAD SDE +C   C  ++F+C    HCI     CD D DC DGSDE  C T    C  
Sbjct: 3599 HDCADGSDEKDCTPRCDMDQFQCKS-GHCIPLRWRCDADADCMDGSDEEACGTGVRTCPL 3657

Query: 1174 NMFTCANHQCISLNWRCDGEPDCSDNSDEIESICAGLACEPNR-FKCKNNK-CIHRYAMC 1231
            + F C N  C  L W+CDGE DC DNSDE    CA   C PNR F+CKN++ C+     C
Sbjct: 3658 DEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFRCKNDRVCLWIGRQC 3717

Query: 1232 DGIDNCGDNSDESHC-------PSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEE 1284
            DG+DNCGD +DE  C       P  K   +  F C N  C+   L C+ ++DCGD SDEE
Sbjct: 3718 DGVDNCGDGTDEEDCEPPTAQNPHCK--DKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEE 3775

Query: 1285 GC--DSPLCKFRTCSQICI-EKKISNTERTFSCHCAEGYHMVHGK 1326
             C  D  L    T + +C  E +   TE+   C C  G+H V G+
Sbjct: 3776 DCSIDPKLTSCATNASMCGDEARCVRTEKAAYCACRSGFHTVPGQ 3820
Functions as a receptor for Vibrio cholerae cholix toxin and for Pseudomonas aeruginosa exotoxin A.
Mus musculus (taxid: 10090)
>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NZR2|LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens GN=LRP1B PE=1 SV=2 Back     alignment and function description
>sp|Q9JI18|LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus GN=Lrp1b PE=2 SV=1 Back     alignment and function description
>sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus GN=Lrp2 PE=1 SV=1 Back     alignment and function description
>sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus GN=Lrp2 PE=1 SV=1 Back     alignment and function description
>sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens GN=LRP2 PE=1 SV=3 Back     alignment and function description
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans GN=lrp-1 PE=1 SV=1 Back     alignment and function description
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1416
270010181 4576 hypothetical protein TcasGA2_TC009548 [T 0.954 0.295 0.504 0.0
321462894 4592 hypothetical protein DAPPUDRAFT_307561 [ 0.945 0.291 0.502 0.0
158300186 4718 AGAP012372-PA [Anopheles gambiae str. PE 0.943 0.283 0.492 0.0
195123466 4639 GI18681 [Drosophila mojavensis] gi|19391 0.942 0.287 0.467 0.0
195381779 4618 GJ21697 [Drosophila virilis] gi|19414441 0.941 0.288 0.464 0.0
195431345 4637 GK15819 [Drosophila willistoni] gi|19415 0.937 0.286 0.469 0.0
242018517 4603 low-density lipoprotein receptor, putati 0.942 0.290 0.474 0.0
170035892 4695 very low-density lipoprotein receptor [C 0.930 0.280 0.472 0.0
427796811 4696 Putative prolow-density lipoprotein rece 0.943 0.284 0.469 0.0
427795113 3609 Putative prolow-density lipoprotein rece 0.943 0.370 0.469 0.0
>gi|270010181|gb|EFA06629.1| hypothetical protein TcasGA2_TC009548 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 1333 bits (3450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1437 (50%), Positives = 919/1437 (63%), Gaps = 86/1437 (5%)

Query: 2    CIPFNQTCDRVYNCHDKSDEGILYCAMRDCRPGYFKCDNNKCILSSHTCNNINDCGDGSD 61
            C+PF  TCD + +C DKSDE   YC  R C  G+F C+N +C+     CN ++DCGD SD
Sbjct: 2509 CVPFKLTCDGIAHCSDKSDEEPGYCGHRTCLQGWFHCNNKRCVERKDKCNGVDDCGDASD 2568

Query: 62   EADCSTCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMHCPMTNCTEKYPLMTNPIHCN 121
            E +CS   ++ F C  G CI K LRCD DPDC DASDEM C + NCT  +    N I+C 
Sbjct: 2569 EENCSCSEDEYFRCSSGECIQKVLRCDNDPDCDDASDEMGCEVRNCTLDFH-DGNMINCE 2627

Query: 122  FTSACIEESYICDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDG 181
             T+ACI + + CDG+NDC+D +DE+NC        +  C   +F C NG CI    RCDG
Sbjct: 2628 NTTACIHKDWFCDGENDCWDWADEKNC-----TGREKRCDIFQFQCSNGTCISLEARCDG 2682

Query: 182  DNDCNDGND--GLSSDEMNCDT-ESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSD 238
             +DC+D     GLSSDE NC   E  C+  N+ F C +++ CI  SW C+G  DC D SD
Sbjct: 2683 KDDCHDAKSTRGLSSDEENCRVMEGHCQ--NDQFMCGDSR-CIPLSWHCNGNPDCLDNSD 2739

Query: 239  ENSTYCAHSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYF 298
            E   Y  H +C   +F+C+++ +CIP++W CDG  DC+D+SDE  S+ C  +  C  G F
Sbjct: 2740 E---YDCHHQCRSDQFKCDNS-ECIPLSWQCDGHPDCMDQSDE--SKHC-ELRECENGDF 2792

Query: 299  KC-LNGRCLLENYYCDGENDCGDNSDEPIVSMWKLV----WKCLNGRCLLENYYCDGEND 353
            +C   GRC+   + CDGE DC D +DE       +     ++C+NG C+ + YYCDG+ D
Sbjct: 2793 RCNSTGRCISRLWLCDGEADCLDGADEHKDQGCGVCTSEHFQCVNGVCINKMYYCDGDKD 2852

Query: 354  CGDNSDEPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKD 413
            C D SDEPP C KT C  S  F C NG CI  +L C+G +DC D SDE     +C +  D
Sbjct: 2853 CNDGSDEPPECHKT-C-TSDEFACNNGKCIMDLLKCDGNDDCGDGSDEG---KDCHNEGD 2907

Query: 414  LCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKI 473
             CK    F C NG+CIN+TL CN  N+CGD SDE  C +NEC        C+ +C+D  I
Sbjct: 2908 YCKGKGWFHCGNGVCINDTLLCNGENNCGDFSDETKCRINECTAQ--PPPCSQKCVDKPI 2965

Query: 474  GYKCACRKGYQVHPEDKHLCVDTNECLDRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCK 533
            GY+C C  GYQ   +DKHLC D NECL RPCS  CRNT GS+ CSCAPGY L  D   C 
Sbjct: 2966 GYECQCHTGYQTSAKDKHLCEDINECLARPCSQLCRNTRGSFHCSCAPGYILHPDGRTCG 3025

Query: 534  ATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSI 593
            + S VP  L+  N+YYIRE+   G  T+  HN TNAV LD+DW   C+YWSDVT  GSSI
Sbjct: 3026 SNSIVPVTLILANRYYIREIDMTGQSTLLAHNLTNAVALDYDWSSKCIYWSDVTQLGSSI 3085

Query: 594  RRSCN----NSQPELLFPAT--SPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLI 647
            +R CN    +S+ E+L   T  +PDGL VDWVGRNLYWCDKGLDT+EV+ LDGRFR+VLI
Sbjct: 3086 KRLCNYKNSSSEIEVLHSPTLQNPDGLAVDWVGRNLYWCDKGLDTLEVSSLDGRFRRVLI 3145

Query: 648  NKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYET 707
            +KGL+EPR +AL+P  GY+YWTDWG +AHIGKA MDGSN ++I++ +L WPNALTISYET
Sbjct: 3146 SKGLEEPRAVALDPLRGYLYWTDWGTHAHIGKAGMDGSNQQIIVNSSLGWPNALTISYET 3205

Query: 708  NELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSI 767
             ELFW DA EDYIAVSDL+G NI  I+SR  +  + LHHVFA+ ++ED+++WTDWE KS+
Sbjct: 3206 KELFWADAREDYIAVSDLDGHNIHRIMSREKNHYLQLHHVFAIDIWEDYIYWTDWETKSV 3265

Query: 768  ERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCENNGGCQGLCLLKPN-GHR 826
            ERC KYTG NCT ++   VH+PMD+RV HP +Q  +K NPCE    C  LCLL P     
Sbjct: 3266 ERCHKYTGNNCTKIMTT-VHRPMDIRVVHPLKQPKIK-NPCEK-ANCSALCLLTPQEPFY 3322

Query: 827  QCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQF 886
            +C CP+N++L+ DGK+C  NC++  F C+K+ KCIPFWWKCDTQDDCGD SDE   C  F
Sbjct: 3323 KCVCPENYVLKEDGKSCEANCTSAHFECKKSYKCIPFWWKCDTQDDCGDGSDEPSDCRPF 3382

Query: 887  HCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGT-GDH 945
             C+PGQ+QC+N  C HP+ +C+G ++CGD SDE  C  YTCLNTQF+C   P  GT    
Sbjct: 3383 KCMPGQYQCDNGHCTHPSDLCNGNDDCGDQSDEKDCEHYTCLNTQFRC---PGNGTIAPR 3439

Query: 946  CISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQC-DVKCISLALVCDKVFDCLDRSDEP 1004
            CI    RC+ HPDCPLGEDE  C P  C  N+F+C + KCI    VCD   DC D SDE 
Sbjct: 3440 CIPSKFRCNKHPDCPLGEDESSCPPATCPPNQFKCANDKCIPAVWVCDTDNDCGDNSDEQ 3499

Query: 1005 ADCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNN 1064
             DC S+TC P + RC +GRCIP +W+CDGD DC N EDEPPSC+ P  +TC+PTYFKC N
Sbjct: 3500 QDCQSRTCSPQHYRCSSGRCIPMSWRCDGDPDCANNEDEPPSCSQPEFHTCEPTYFKCKN 3559

Query: 1065 YKCIPGSWHCDYDDDCGDGSDEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSD 1124
             KCIPG W CDYD+DCGD SDE +C PRNCSESEFRC +G+CIR    C+GE  C D SD
Sbjct: 3560 NKCIPGRWRCDYDNDCGDSSDEVDCVPRNCSESEFRCGDGRCIRGAQKCDGEFQCEDRSD 3619

Query: 1125 EINCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCI 1184
            E NC+  C KNEF+C++P  CI  +  CDG+ DC DGSDEANC+  C  N F C N  CI
Sbjct: 3620 EANCHTHCKKNEFQCANPQVCIYLEWKCDGEADCSDGSDEANCSDTCPDNGFKCHNGLCI 3679

Query: 1185 SLNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDES 1244
            + +WRCDG+ DC D SDE+   C+ + C P RF+CKN+ C+    +CDG D C D SDE 
Sbjct: 3680 NEDWRCDGQKDCEDGSDEM--FCSLVGCLPGRFRCKNHTCVPVSFLCDGHDQCEDGSDED 3737

Query: 1245 H--CPSIKLCSEANFKCANGNCIKKELECDQYNDCGDNSDEEGCDSPLCKFRTCSQICIE 1302
               C    +C    F C NG+CIK  L CD  NDC DNSDEE C++  CK+ TCSQICIE
Sbjct: 3738 PHICHRFNICPPDQFTCKNGHCIKNSLRCDGRNDCSDNSDEENCNNSTCKWNTCSQICIE 3797

Query: 1303 KKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIAHTTLKVLDPYASRAKSEI 1362
             K                H V                +LL++   L+++ PY     +++
Sbjct: 3798 AK----------------HNV---------------PVLLVSEAELRLMSPYKPGDSNKL 3826

Query: 1363 SPLNLDAT---KIYSVDLLYEDRNNIMVYWVDRHAKVIKMASISSGNVTRVKREMNL 1416
                L      K+ +VD+LY  R   + +W D   K I+ + +   N +R +R+ ++
Sbjct: 3827 RSKTLATAPGYKVDAVDILY-GRTESVAFWTDHQNKRIQ-SVVLRLNESRARRDSDV 3881

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321462894|gb|EFX73914.1| hypothetical protein DAPPUDRAFT_307561 [Daphnia pulex] Back     alignment and taxonomy information
>gi|158300186|ref|XP_320185.4| AGAP012372-PA [Anopheles gambiae str. PEST] gi|157013036|gb|EAA00393.5| AGAP012372-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195123466|ref|XP_002006227.1| GI18681 [Drosophila mojavensis] gi|193911295|gb|EDW10162.1| GI18681 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195381779|ref|XP_002049622.1| GJ21697 [Drosophila virilis] gi|194144419|gb|EDW60815.1| GJ21697 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195431345|ref|XP_002063703.1| GK15819 [Drosophila willistoni] gi|194159788|gb|EDW74689.1| GK15819 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|242018517|ref|XP_002429721.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212514727|gb|EEB16983.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170035892|ref|XP_001845800.1| very low-density lipoprotein receptor [Culex quinquefasciatus] gi|167878399|gb|EDS41782.1| very low-density lipoprotein receptor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|427796811|gb|JAA63857.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427795113|gb|JAA63008.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1416
FB|FBgn0053087 4699 LRP1 "LDL receptor protein 1" 0.944 0.284 0.452 0.0
UNIPROTKB|P98157 4543 LRP1 "Low-density lipoprotein 0.892 0.278 0.432 0.0
UNIPROTKB|Q07954 4544 LRP1 "Prolow-density lipoprote 0.886 0.276 0.435 0.0
UNIPROTKB|E1BGJ0 4544 LRP1 "Uncharacterized protein" 0.886 0.276 0.434 0.0
UNIPROTKB|J9P315 4544 LRP1 "Uncharacterized protein" 0.886 0.276 0.433 0.0
UNIPROTKB|E2R4Q1 4528 LRP1 "Uncharacterized protein" 0.886 0.277 0.433 0.0
MGI|MGI:96828 4545 Lrp1 "low density lipoprotein 0.886 0.276 0.432 0.0
UNIPROTKB|G3V928 4545 Lrp1 "Protein Lrp1" [Rattus no 0.886 0.276 0.432 0.0
ZFIN|ZDB-GENE-030131-7126 4549 lrp1b "low density lipoprotein 0.880 0.274 0.428 1.09999999981e-314
UNIPROTKB|P98164 4655 LRP2 "Low-density lipoprotein 0.872 0.265 0.407 1.6e-295
FB|FBgn0053087 LRP1 "LDL receptor protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 3324 (1175.2 bits), Expect = 0., Sum P(3) = 0.
 Identities = 650/1437 (45%), Positives = 849/1437 (59%)

Query:    31 CRPGYFKCDNNKCILSSHTCNNINDCGDGSDE--ADC--STCGNDTFHCDMGMCIHKALR 86
             C    + C + +CI    TC+N+  C DGSDE  + C    C    F C    CI K  +
Sbjct:  2577 CGLSQYNCHSGECIPLELTCDNVTHCADGSDEFRSYCIFRQCPETHFMCQNHRCIPKEHK 2636

Query:    87 CDVDPDCPDASDE-------------MHCPMTNCTEKYPLMTNPIHCNFTSACIEESYIC 133
             CD +  C D SDE             MH P  N T++ P M     C  +  CI   ++C
Sbjct:  2637 CDGEQQCGDGSDETPLLCKCQSEDIDMH-PSNNNTKEMPDM---FRCG-SGECIPRKFLC 2691

Query:   134 DGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFL-CRNGN-CILSRWRXXXXXXXXXXXXX 191
             D   DC D SDE+ C  I      M      F+ C N   CI+ RWR             
Sbjct:  2692 DSLKDCRDFSDEKMCAPIPCEKNDMT-----FVHCGNSTICIMPRWRCDGDPDCPD---- 2742

Query:   192 LSSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNL 251
               +DE++C   ++   +   F+C +   CI+ SW CDG  DC D SDE +  C  +EC  
Sbjct:  2743 -GTDELDCANHTSLSCDPGQFRCASGN-CIAGSWHCDGEKDCPDGSDEIN--C-RTECRH 2797

Query:   252 FEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYY 311
              +F C+ T  CIP +W CDG +DC D SDE     C N       +    +GRC+ + + 
Sbjct:  2798 NQFACDKT--CIPASWQCDGKSDCEDGSDE--GPQCPNRPCRPHLFQCKSSGRCIPQKWV 2853

Query:   312 CDGENDC----GDNSDE---P-------IVSMWKLVWKCLNGRCLLENYYCDGENDCGDN 357
             CDGE DC    GD   E   P       I         C +G C+  +Y CDG+ DC   
Sbjct:  2854 CDGEKDCPSGLGDEGSEDEGPQCGGVAHIPDCPPPAHLCTSGLCIDSHYVCDGDEDCPGG 2913

Query:   358 SDEPPSC-----PKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLK 412
              DE   C     P +    S   +CQ+G CI     C+G  DC D SDE    + C   +
Sbjct:  2914 DDEYEGCVPAFQPHSCPGGSLMHQCQDGLCIFKNQTCDGKPDCGDGSDE--TSSLCAHTR 2971

Query:   413 DLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLK 472
               C     F C NG CI+  L C+  NDC D SDE  C VNEC +     +C HEC D  
Sbjct:  2972 G-CNGTDDFRCKNGACIHADLLCDRRNDCADFSDEELCNVNECLIP---DICEHECEDKV 3027

Query:   473 IGYKCACRKGYQVHPEDKHLCVDTNECLDR-PCSHYCRNTLGSYSCSCAPGYALLSDKHG 531
             +GY+C CR GY+V P+  HLC D +EC ++ PCS  C NT GSY C CA GYAL+ D H 
Sbjct:  3028 VGYQCHCRPGYKVLPKSPHLCTDIDECDEQQPCSQTCINTYGSYKCLCAKGYALV-DHHT 3086

Query:   532 CKATSDVPPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGS 591
             CKATS+V   L+F+N+YYIR+V   G  +I I+  +NAV LD+DW   CLYWSDVT    
Sbjct:  3087 CKATSNVSMELIFSNRYYIRQVDMTGNGSILINELSNAVALDYDWDSQCLYWSDVTSTVG 3146

Query:   592 SIRRSC-NNSQPELLFPAT--SPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLIN 648
             +I+R C   ++ + L  A   +PDGL VDWV +NLYWCDKGLDTIEV++LDG++RKVLIN
Sbjct:  3147 TIKRYCPKENKTQTLHQAMLKNPDGLAVDWVAKNLYWCDKGLDTIEVSQLDGKYRKVLIN 3206

Query:   649 KGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETN 708
             + L+EPRGIAL+P   +++W+DWG + HIGKA MDGSNPK+II   L WPNALTIS+ET 
Sbjct:  3207 EYLREPRGIALHPYQQHIFWSDWGDSPHIGKAGMDGSNPKMIIRDGLGWPNALTISFETQ 3266

Query:   709 ELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIE 768
             +LFWGDA ED I+VSDL+G + +++++R ++P +NLHH+FA+AV+E H++W+DWE KSIE
Sbjct:  3267 QLFWGDAREDTISVSDLDGNHTRLLLARSINPLLNLHHIFAIAVWEGHIYWSDWETKSIE 3326

Query:   769 RCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQT-PLKDNPCENNGGCQGLCLLKPNG-HR 826
              C  + G+NCT+++   +H+PMDLRV+HPYRQ  P+  NPC     C  LC+L P   + 
Sbjct:  3327 YCSIFNGQNCTTLITT-IHRPMDLRVFHPYRQQQPMSGNPCLA-ANCSTLCVLSPEEPYY 3384

Query:   827 QCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPFWWKCDTQDDCGDKSDEHDQCPQF 886
             +C CP NFIL  DG+TCR NC+A  F C  T KCIPF+W+CDTQDDCGD SDE + CP F
Sbjct:  3385 KCMCPTNFILADDGRTCRANCTAAHFECVNTYKCIPFYWRCDTQDDCGDGSDEPETCPPF 3444

Query:   887 HCLPGQFQCNNTKCLHPNTICDGVNNCGDMSDELHCVDYTCLNTQFKCKRDPAQGTGDHC 946
             HC PGQ+QC N KC HP+ +CDG+N CGD SDEL+C  +TC +   KC       +   C
Sbjct:  3445 HCEPGQYQCANKKCTHPSNLCDGINQCGDGSDELNCDKFTCFDNHMKC--GATANSSAFC 3502

Query:   947 ISLLNRCDGHPDCPLGEDEHDCMPKNCTANEFQC-DVKCISLALVCDKVFDCLDRSDEPA 1005
             +  + RCDG  DCP GEDE  C P  C  ++FQC + +C+    VCD   DC D+SDE A
Sbjct:  3503 VDNVKRCDGVKDCPGGEDESACTPLVCKKDQFQCGNNRCMPFVWVCDGDIDCPDKSDE-A 3561

Query:  1006 DCTSQTCGPDYIRCDTGRCIPKTWQCDGDVDCPNREDEPPSCADPNLYTCDPTYFKCNNY 1065
             +C + +CGP+  +CD+GRCIP  W+CD D DCPN EDEP SC      TCDPTYFKCNN 
Sbjct:  3562 NCDNVSCGPNDFQCDSGRCIPLAWRCDDDHDCPNGEDEPASCFSSKA-TCDPTYFKCNNS 3620

Query:  1066 KCIPGSWHXXXXXXXXXXXXEKNCTPRNCSESEFRCANGKCIRPHYVCNGENDCADHSDE 1125
             KCIPG W             E NC  RNCSESEFRC  GKCI+ +Y C+GE  C D+SDE
Sbjct:  3621 KCIPGRWRCDYENDCGDGSDELNCQMRNCSESEFRCGTGKCIKHNYRCDGEIHCDDNSDE 3680

Query:  1126 INCNISCSKNEFKCSHPAHCISSDLVCDGDTDCWDGSDEANCTTKCKPNMFTCANHQCIS 1185
             INCNI+C +N+FKC+    CI+    CDGD DC DGSDE NCT  C  + F+C N +CI 
Sbjct:  3681 INCNITCKENQFKCAAFNTCINKQYKCDGDDDCPDGSDEVNCT--CHSDHFSCGNGKCIM 3738

Query:  1186 LNWRCDGEPDCSDNSDEIESICAGLACEPNRFKCKNNKCIHRYAMCDGIDNCGDNSDESH 1245
               W+CDG  DC D SDE    CA   C  N FKC+N  C+   A+CDGI++CG+N DES 
Sbjct:  3739 SRWKCDGWDDCLDGSDESLETCAKTHCHANAFKCRNQLCVRNSALCDGINDCGENEDESD 3798

Query:  1246 --CPSIKLCSEANFKCANGNCIKKELECD-QYNDCGDNSDEEGCDSPLCKFRTCSQICIE 1302
               C ++  C    F+C N +CI K   CD QYN C D SDE  C  P+C F +CSQICIE
Sbjct:  3799 AVCAALPKCRHDQFQCENDDCISKAFRCDGQYN-CVDGSDEMNCQPPVCGFGSCSQICIE 3857

Query:  1303 KKISNTERTFSCHCAEGYHMVHGKNKTSSCVANGKSALLLIA-HTTLKVLDPYASRAKSE 1361
             KK  +    ++C CA+GYH   G  K ++C+A+G   +LL+A     + + P      + 
Sbjct:  3858 KKAGH----YNCKCADGYHK--GPEKNATCLASGPDQILLLASEQEFRFILPAKQEGTTV 3911

Query:  1362 ISPLNLDATKIYSVDLLYEDRNNIMVYWVD-RHAKV--IKMASIS-SGNVTRVKREM 1414
             +     D+ KI   D+L   ++ ++ +W+D  H KV  +K+A+    G   RV+R++
Sbjct:  3912 VGFFQTDSLKIDVFDILIRPKDTLL-FWIDSHHGKVHTMKIATPHVEGTGVRVRRDL 3967
GO:0005041 "low-density lipoprotein receptor activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|P98157 LRP1 "Low-density lipoprotein receptor-related protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q07954 LRP1 "Prolow-density lipoprotein receptor-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGJ0 LRP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P315 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4Q1 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:96828 Lrp1 "low density lipoprotein receptor-related protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V928 Lrp1 "Protein Lrp1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7126 lrp1b "low density lipoprotein receptor-related protein 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P98164 LRP2 "Low-density lipoprotein receptor-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1416
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 1e-11
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-10
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 6e-10
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 6e-10
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 5e-09
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-08
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-08
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 7e-08
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 8e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 1e-07
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-07
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 2e-07
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 2e-07
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 3e-07
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 3e-07
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-06
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-06
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 4e-06
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 4e-06
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 5e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 5e-06
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 7e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 9e-06
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 9e-06
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 1e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 2e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 2e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 2e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 2e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 2e-05
COG3391381 COG3391, COG3391, Uncharacterized conserved protei 2e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 4e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 5e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 6e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 7e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 7e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 8e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-04
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-04
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-04
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 5e-04
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 6e-04
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 0.001
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 0.001
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 0.002
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 0.002
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 0.002
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 0.002
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 0.003
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information 
 Score = 60.3 bits (147), Expect = 1e-11
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 664 GYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTI 703
           G +YWTD    A I  A ++GS+ + + S++L WPN + +
Sbjct: 1   GRLYWTDSSLRASISVADLNGSDRRTLFSEDLQWPNGIAV 40

This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure. Length = 42
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|225926 COG3391, COG3391, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1416
KOG1215|consensus877 100.0
KOG1214|consensus1289 100.0
KOG1215|consensus877 100.0
KOG1214|consensus1289 99.97
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.64
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.64
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.62
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.48
KOG4659|consensus 1899 99.33
KOG4659|consensus 1899 99.28
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.11
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.08
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.07
PRK11028330 6-phosphogluconolactonase; Provisional 99.07
PRK11028330 6-phosphogluconolactonase; Provisional 99.05
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.92
COG3391381 Uncharacterized conserved protein [Function unknow 98.85
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.84
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.78
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.78
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.76
COG3391381 Uncharacterized conserved protein [Function unknow 98.75
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.74
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.67
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.67
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.64
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.62
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.57
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.57
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.56
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.56
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.49
KOG1520|consensus376 98.48
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.44
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.42
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.36
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.3
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.27
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.23
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.18
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.18
KOG1520|consensus376 98.14
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.13
KOG4499|consensus310 98.12
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.08
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.08
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.06
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.06
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.03
PRK04792448 tolB translocation protein TolB; Provisional 98.02
PRK05137435 tolB translocation protein TolB; Provisional 98.02
PRK04922433 tolB translocation protein TolB; Provisional 97.93
PRK03629429 tolB translocation protein TolB; Provisional 97.91
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.91
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 97.89
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 97.86
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.84
PRK02889427 tolB translocation protein TolB; Provisional 97.79
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.78
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.78
PRK00178430 tolB translocation protein TolB; Provisional 97.77
PRK04043419 tolB translocation protein TolB; Provisional 97.77
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.69
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.68
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 97.67
PF1266224 cEGF: Complement Clr-like EGF-like 97.64
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.64
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.56
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.54
PRK01742429 tolB translocation protein TolB; Provisional 97.53
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.52
PRK01029428 tolB translocation protein TolB; Provisional 97.52
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.47
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.46
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.36
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 97.32
KOG4499|consensus310 97.31
PRK04792448 tolB translocation protein TolB; Provisional 97.28
PRK04922433 tolB translocation protein TolB; Provisional 97.26
PRK04043419 tolB translocation protein TolB; Provisional 97.24
PRK05137435 tolB translocation protein TolB; Provisional 97.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.06
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.01
KOG1219|consensus4289 97.01
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.01
PRK02889427 tolB translocation protein TolB; Provisional 96.96
PRK00178430 tolB translocation protein TolB; Provisional 96.92
PRK03629429 tolB translocation protein TolB; Provisional 96.77
PF1266224 cEGF: Complement Clr-like EGF-like 96.68
PRK01029428 tolB translocation protein TolB; Provisional 96.64
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.41
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 96.23
COG5276370 Uncharacterized conserved protein [Function unknow 96.2
COG5276370 Uncharacterized conserved protein [Function unknow 96.08
KOG3509|consensus964 96.05
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 96.03
PRK01742429 tolB translocation protein TolB; Provisional 96.02
KOG3509|consensus964 95.95
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.67
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.61
KOG4260|consensus350 95.58
COG4946668 Uncharacterized protein related to the periplasmic 95.43
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.41
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.39
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.2
KOG1446|consensus311 95.19
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 95.18
KOG2397|consensus480 95.05
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 95.04
PRK02888635 nitrous-oxide reductase; Validated 94.92
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 94.87
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.76
PF13449326 Phytase-like: Esterase-like activity of phytase 94.7
KOG0315|consensus311 94.7
KOG4260|consensus350 94.53
KOG2397|consensus 480 94.52
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.51
KOG0273|consensus524 94.09
KOG1219|consensus4289 93.92
COG4946668 Uncharacterized protein related to the periplasmic 93.88
PRK02888635 nitrous-oxide reductase; Validated 93.85
KOG0285|consensus460 93.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.93
KOG4289|consensus 2531 92.38
PF13449326 Phytase-like: Esterase-like activity of phytase 92.38
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 92.38
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 92.06
KOG0291|consensus893 91.76
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 91.76
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.44
KOG0315|consensus311 91.12
smart0017939 EGF_CA Calcium-binding EGF-like domain. 91.04
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 91.03
KOG0285|consensus460 91.03
smart0018135 EGF Epidermal growth factor-like domain. 91.0
KOG4289|consensus 2531 90.76
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 90.27
KOG0291|consensus893 90.08
KOG1446|consensus311 90.06
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 90.04
PTZ00421493 coronin; Provisional 89.83
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 89.83
KOG2106|consensus626 89.74
PLN00181793 protein SPA1-RELATED; Provisional 89.44
KOG0268|consensus433 89.27
PF05787524 DUF839: Bacterial protein of unknown function (DUF 89.2
COG3823262 Glutamine cyclotransferase [Posttranslational modi 89.18
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 88.62
PRK13616591 lipoprotein LpqB; Provisional 88.54
smart0018135 EGF Epidermal growth factor-like domain. 88.19
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 88.01
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 87.87
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 86.47
PF05787524 DUF839: Bacterial protein of unknown function (DUF 86.17
smart00284255 OLF Olfactomedin-like domains. 86.13
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 86.03
COG0823425 TolB Periplasmic component of the Tol biopolymer t 85.93
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 85.3
KOG0268|consensus433 85.18
KOG4649|consensus354 85.16
KOG1407|consensus313 85.05
PF0000832 EGF: EGF-like domain This is a sub-family of the P 84.7
PTZ00421493 coronin; Provisional 84.6
KOG0318|consensus603 83.85
KOG2048|consensus691 83.73
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 83.72
KOG4328|consensus498 82.99
cd0005336 EGF Epidermal growth factor domain, found in epide 82.54
KOG0266|consensus456 82.07
cd0005336 EGF Epidermal growth factor domain, found in epide 81.63
KOG4328|consensus498 81.56
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 81.27
KOG0650|consensus733 81.15
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 81.0
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 80.91
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 80.76
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 80.56
COG3823262 Glutamine cyclotransferase [Posttranslational modi 80.01
>KOG1215|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.1e-57  Score=595.66  Aligned_cols=586  Identities=39%  Similarity=0.766  Sum_probs=480.4

Q ss_pred             eecCCcccCCCCCCCCCCCcc-ccccccCCCCCcCCCCCCcccC--CCceecCceeecCCCCCCCCCCCCCCCCCCCCCC
Q psy6572         126 CIEESYICDGQNDCFDMSDEQ-NCDQIKDVSPKMNCSGDKFLCR--NGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTE  202 (1416)
Q Consensus       126 CI~~~~~CDg~~DC~D~sDE~-~C~~~~~~~~~~~C~~~~f~C~--~g~CI~~~~~CDg~~DC~Dg~d~~~sDE~~C~~~  202 (1416)
                      .+...|...+...+.+.+++. +++       ...|...+|+|.  +++|||..|+|||..||.||     +||.+|.. 
T Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~c~~~~~~Cip~~~~cd~~~~C~dg-----~de~~~~~-  176 (877)
T KOG1215|consen  110 LDIHAYHPSSQPLAPDPCAESGNGP-------CSHCCLDKFSCRTGSCKCIPGDWLCDGEADCPDG-----SDELNCAV-  176 (877)
T ss_pred             cceeEEecCCCCCCCCcccccCCCC-------CccccCCCCCCcCccccCCCCceeCCCCCccccc-----hhhhcccc-
Confidence            344899999999999999986 222       245778999999  89999999999999999999     99999962 


Q ss_pred             CccCCCCCceecCCCCceecCcccccCCCCCCCCCCCCCCcccCCCCC---CCceeeCCCCCeEcCcccccCCCCCCCCC
Q psy6572         203 STCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECN---LFEFRCNSTGQCIPITWVCDGVTDCIDKS  279 (1416)
Q Consensus       203 ~~C~~~~~~F~C~~~~~CI~~~w~CDg~~DC~D~sDE~~~~c~~~~C~---~~~F~C~~~~~CI~~~w~CDG~~DC~Dgs  279 (1416)
                      ..+......|+|      |...|+||+..+|++++||.+.  ....+.   ...|+|.+..+||...|+|||..||.+++
T Consensus       177 ~~~~~~~~~~~~------~~~~~~~d~~~~~~~~~d~~~~--~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~  248 (877)
T KOG1215|consen  177 RRCEPRGASLDC------IVAIKVCDIQHDCADDYDESEG--RIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGP  248 (877)
T ss_pred             cccCcccccccc------ceeeeecCcccccccccccccC--cccccCCcceeEEEecCCCcEEeehhccCCCcccccCC
Confidence            334332244554      9999999999999999999873  222333   57899965579999999999999999999


Q ss_pred             CCccccCCcccccccCCeeecCCCceeccccccCCCCCCCCCCCcccccccccceeeCCCccccccccccCCCCCCCCCC
Q psy6572         280 DEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSD  359 (1416)
Q Consensus       280 DE~~~~~C~~~~~C~~~~f~C~~g~CI~~~~~CDg~~DC~DgSDE~~c~~~~~~f~C~~g~Ci~~~~~Cdg~~dC~d~~~  359 (1416)
                      ||.- ..|. ..+|...+|.|+++.|++..+.|||..||+||+||..                                 
T Consensus       249 de~~-~~~~-~~~~~~~e~~~~~~~~~~~~~~~~g~~d~pdg~de~~---------------------------------  293 (877)
T KOG1215|consen  249 DEGV-MNCS-DATCEAPEIECADGDCSDRQKLCDGDLDCPDGLDEDY---------------------------------  293 (877)
T ss_pred             cCce-eEee-ccccCCcceeecCCCCccceEEecCccCCCCcccccc---------------------------------
Confidence            9931 2343 3577778999999999999999999999999999962                                 


Q ss_pred             CCCCCCCCCCCCCCceeecCCcEeCCceeeCCcCCCCCCCCccccccccCCCCCCCCCCCceeeCCCeeecCCcccCCCC
Q psy6572         360 EPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDIN  439 (1416)
Q Consensus       360 e~~~C~~~~c~~~~~f~C~~g~CI~~~~~CDg~~DC~DgSDE~~~~~~C~~~~~~C~~~~~f~C~~g~Ci~~~~~Cdg~~  439 (1416)
                          |+...+- +..|.|.+++ |....+|++                                                
T Consensus       294 ----~~~~~~~-~~~~d~~~~~-i~~~~~~~~------------------------------------------------  319 (877)
T KOG1215|consen  294 ----CKKKLYW-SMNVDGSGRR-ILLSKLCHG------------------------------------------------  319 (877)
T ss_pred             ----cccceee-eeecccCCce-eeecccCcc------------------------------------------------
Confidence                2100000 2334444444 544444333                                                


Q ss_pred             CCCCCCCCCCcccccccCCCCCCcccccceecCCceEEeeCCCceecCCCCCccccCCcCC--CCCccceee-ecCCeee
Q psy6572         440 DCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECL--DRPCSHYCR-NTLGSYS  516 (1416)
Q Consensus       440 dC~dgsDe~~C~i~eC~~~~~~~~Cs~~C~nt~~gy~C~C~~Gy~L~p~d~~tC~didEC~--~~~Csq~C~-nt~gsy~  516 (1416)
                         .    ..+.++++......  +++.+.+++.+.+|.|..++.+. ..+.+  +.+.|.  ++.|+|+|+ +.+++|+
T Consensus       320 ---~----~~~~~~~~~~~~~~--~~~~~~~~~v~~~~~~~~~~~~~-~~~~~--~~~~~~~~~g~Csq~C~~~~p~~~~  387 (877)
T KOG1215|consen  320 ---Y----WTDGLNECAERVLK--CSHKCPDVSVGPRCDCMGAKVLP-LGART--DSNPCESDNGGCSQLCVPNSPGTFK  387 (877)
T ss_pred             ---c----cccccccchhhccc--ccCCCCccccCCcccCCccceec-ccccc--cCCcccccCCccceeccCCCCCcee
Confidence               0    11122333222333  77888889999999999999986 44443  333443  799999999 5688999


Q ss_pred             ecCCCCcEEecCCCceEecCCCCCeEEEEecEEEEEEecCCcc-eEEecccccceeeeeecCCCeEEEeeccCCCccEEE
Q psy6572         517 CSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVTQAGVM-TIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRR  595 (1416)
Q Consensus       517 C~C~~Gy~L~~dg~sC~a~~~~~~~li~s~~~~I~~i~l~g~~-~~~~~~l~~~~~l~~D~~~~~LYwtD~~~~~~~I~r  595 (1416)
                      |.|..||.|..++  |.+....+++|++++++.|+++.++... ..++.++.+++++++|..++.+||+|....  .|.+
T Consensus       388 c~c~~g~~~~~~~--c~~~~~~~~~l~~s~~~~ir~~~~~~~~~~~p~~~~~~~~~~d~d~~~~~i~~~d~~~~--~i~~  463 (877)
T KOG1215|consen  388 CACSPGYELRLDK--CEASDQPEAFLLFSNRHDIRRISLDCSDVSRPLEGIKNAVALDFDVLNNRIYWADLSDE--KICR  463 (877)
T ss_pred             EecCCCcEeccCC--ceecCCCCcEEEEecCccceecccCCCcceEEccCCccceEEEEEecCCEEEEEeccCC--eEee
Confidence            9999999999887  8887777999999999999999998875 566666689999999999999999999965  8999


Q ss_pred             EecC-CCC-eEEee-cCCCceEEEEccCCcEEEeeCCCCeEEEeecCCCceEEEEcCCCCCcceeeecCCcceEEEeeCC
Q psy6572         596 SCNN-SQP-ELLFP-ATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWG  672 (1416)
Q Consensus       596 ~~l~-s~~-~~l~~-l~~p~gLAvD~~~~~LYwtD~~~~~I~v~~ldG~~~~vLi~~~l~~P~gIavDp~~g~LYWtD~g  672 (1416)
                      .... ... .++.. +-.|.+||+||+.+++||+|.+...|++..++|..+++|+...+..|++|+|+|.+|+|||+||+
T Consensus       464 ~~~~~~~~~~~~~~g~~~~~~lavD~~~~~~y~tDe~~~~i~v~~~~g~~~~vl~~~~l~~~r~~~v~p~~g~~~wtd~~  543 (877)
T KOG1215|consen  464 ASQDGSSECELCGDGLCIPEGLAVDWIGDNIYWTDEGNCLIEVADLDGSSRKVLVSKDLDLPRSIAVDPEKGLMFWTDWG  543 (877)
T ss_pred             eccCCCccceEeccCccccCcEEEEeccCCceecccCCceeEEEEccCCceeEEEecCCCCccceeeccccCeeEEecCC
Confidence            8888 333 32333 88999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEEEecCCCCCEEEeecCCCCCeeEEeecCCCeEEEecCCCC-eEEEEeCCCCceEEEEeccCCCCcccccceeEE
Q psy6572         673 QNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWGDAHED-YIAVSDLNGENIKIIVSRRMDPTINLHHVFALA  751 (1416)
Q Consensus       673 ~~~~I~ra~mDGs~r~vlv~~~l~~P~gLaiD~~~~rLYWtD~~~~-~I~~~~ldG~~r~~v~~~~~~p~~~l~~P~~la  751 (1416)
                      ..++|+|+.|||+.+.+++..++.||+||++|+..++|||+|..+. .|++++++|++|+++....      ++||++|+
T Consensus       544 ~~~~i~ra~~dg~~~~~l~~~~~~~p~glt~d~~~~~~yw~d~~~~~~i~~~~~~g~~r~~~~~~~------~~~p~~~~  617 (877)
T KOG1215|consen  544 QPPRIERASLDGSERAVLVTNGILWPNGLTIDYETDRLYWADAKLDYTIESANMDGQNRRVVDSED------LPHPFGLS  617 (877)
T ss_pred             CCchhhhhcCCCCCceEEEeCCccCCCcceEEeecceeEEEcccCCcceeeeecCCCceEEecccc------CCCceEEE
Confidence            8779999999999999999999999999999999999999999998 8999999999999444433      99999999


Q ss_pred             EecCcEEEeecCCCeeEEecccCCCceEEEEeCCCCCCeeeeeecccCCCCCCCCCCC-CCCCCccceeecCCCCccccC
Q psy6572         752 VFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCE-NNGGCQGLCLLKPNGHRQCAC  830 (1416)
Q Consensus       752 v~~d~LYwtD~~~~~I~~~nk~tG~~~~~l~~~~~~~p~~I~v~h~~~q~p~~~npC~-~NggCshlCl~~p~~~~~C~C  830 (1416)
                      +++++|||++|....+.++++..+.. .+.+......|+.++++|...+.|.+.|+|. +|++|+||||+.|.+. +|+|
T Consensus       618 ~~~~~iyw~d~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~n~C~~~n~~c~~KOG~~p~~~-~c~c  695 (877)
T KOG1215|consen  618 VFEDYIYWTDWSNRAISRAEKHKGSD-SRTSRSNLAQPLDIILVHHSSSRPTGVNPCESSNGGCSQLCLPRPQGS-TCAC  695 (877)
T ss_pred             EecceeEEeeccccceEeeecccCCc-ceeeecccCcccceEEEeccccCCCCCCcccccCCCCCeeeecCCCCC-eeeC
Confidence            99999999999999999999998877 3333367778888888844433388999999 7899999999999877 9999


Q ss_pred             CCCeeecCCCceecc
Q psy6572         831 PDNFILESDGKTCRH  845 (1416)
Q Consensus       831 p~g~~L~~d~~tC~~  845 (1416)
                      |.|+.|..++++|.+
T Consensus       696 ~~~~~l~~~~~~C~~  710 (877)
T KOG1215|consen  696 PEGYRLSPDGKSCSS  710 (877)
T ss_pred             CCCCeecCCCCeecC
Confidence            999999999999986

>KOG1214|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1416
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-101
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-47
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-07
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-101
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-47
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 9e-08
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 3e-77
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 8e-72
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 2e-69
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 2e-65
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 2e-61
4dg6_A616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 3e-61
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 9e-60
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 1e-59
3s2k_A629 Structural Basis Of Wnt Signaling Inhibition By Dic 4e-55
4a0p_A628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 4e-55
3s8v_A623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 5e-55
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 7e-49
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 3e-33
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 3e-12
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 3e-07
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 2e-11
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 3e-10
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 5e-10
2xrc_A565 Human Complement Factor I Length = 565 6e-10
2xrc_A 565 Human Complement Factor I Length = 565 6e-07
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 1e-09
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 2e-06
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 4e-09
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 1e-08
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 9e-06
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 4e-08
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 1e-07
1xfe_A83 Solution Structure Of The La7-Egfa Pair From The Ld 1e-07
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 2e-07
3bps_E83 Pcsk9:egf-a Complex Length = 83 2e-07
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 4e-07
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 8e-07
1d2l_A45 Nmr Solution Structure Of Complement-Like Repeat Cr 4e-05
1j8e_A44 Crystal Structure Of Ligand-Binding Repeat Cr7 From 2e-04
1nzi_A159 Crystal Structure Of The Cub1-Egf Interaction Domai 4e-04
1apq_A53 Structure Of The Egf-Like Module Of Human C1r, Nmr, 9e-04
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure 
Iteration: 1

 Score =  367 bits (942), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 249/709 (35%), Positives = 355/709 (50%), Gaps = 80/709 (11%)
Query: 206 KANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLFEFRCNS-TGQCIP 264
           +   N FQC + K CIS  WVCDG+ +C D SDE+   C    C   +F C     +CIP
Sbjct: 5   RCERNEFQCQDGK-CISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIP 63
Query: 265 ITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYCDGENDCGDNSDE 324
             W CDG  DC + SDE   Q C   +TC +  F+C +G+C+   + CD + DC D SDE
Sbjct: 64  QFWRCDGQVDCDNGSDE---QGC-PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDE 119
Query: 325 ---PIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPS------CPKTDCDNSTHF 375
              P+++     ++C +  C+ + + CD + DC D SDE P         + D    + F
Sbjct: 120 ASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAF 179
Query: 376 E--CQNGNCIPSVLLCNGVNDCDDNSDEDM--------------------------NHAE 407
           E  C +G CI S   C+G  DC D SDE+                              +
Sbjct: 180 EFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYD 239
Query: 408 CRSLKD--------LCKHPSHFLCSNGLCINETLTCNDINDCGDNSDE--FSCFVNECNV 457
           C+ + D        LC+ P+ F C +G CI     CN   DC D SDE    C  NEC  
Sbjct: 240 CKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLD 299
Query: 458 SHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECLDR-PCSHYCRNTLGSYS 516
           ++GG  C+H C DLKIGY+C C  G+Q+  + +  C D +EC D   CS  C N  G Y 
Sbjct: 300 NNGG--CSHVCNDLKIGYECLCPDGFQLVAQRR--CEDIDECQDPDTCSQLCVNLEGGYK 355
Query: 517 CSCAPGYALLSDKHGCKATSDVPPNLLFTNKYYIREVT-QAGVMTIRIHNQTNAVGLDFD 575
           C C  G+ L      CKA   +   L FTN++ +R++T      T  I N  N V LD +
Sbjct: 356 CQCEEGFQLDPHTKACKAVGSIA-YLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTE 414
Query: 576 WVDNCLYWSDVTMH---GSSIRRSCNNSQPELLFP--ATSPDGLTVDWVGRNLYWCDKGL 630
              N +YWSD++      + + R+   S  + +      +PDGL VDW+  N+YW D  L
Sbjct: 415 VASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVL 474
Query: 631 DTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVI 690
            T+ VA   G  RK L  +   +PR I ++P +G+MYWTDWG  A I K  ++G +   +
Sbjct: 475 GTVSVADTKGVKRKTLFREQGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSL 534
Query: 691 ISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFAL 750
           +++N+ WPN +T+   +  L+W D+    I+  D+NG N K I    ++    L H F+L
Sbjct: 535 VTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTI----LEDEKRLAHPFSL 590
Query: 751 AVFEDHLFWTDWEMKSIERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCE- 809
           AVFED +FWTD   ++I   ++ TG +   + +NL+  P D+ ++H   Q P   N CE 
Sbjct: 591 AVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLL-SPEDMVLFHQLTQ-PRGVNWCER 648
Query: 810 ---NNGGCQGLCLLKP--NGHR---QCACPDNFILESDGKTCRHNCSAG 850
              +NGGCQ LCL  P  N H     CACPD  +L  D ++C     A 
Sbjct: 649 TTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAA 697
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|1XFE|A Chain A, Solution Structure Of The La7-Egfa Pair From The Ldl Receptor Length = 83 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 Back     alignment and structure
>pdb|1J8E|A Chain A, Crystal Structure Of Ligand-Binding Repeat Cr7 From Lrp Length = 44 Back     alignment and structure
>pdb|1NZI|A Chain A, Crystal Structure Of The Cub1-Egf Interaction Domain Of Complement Protease C1s Length = 159 Back     alignment and structure
>pdb|1APQ|A Chain A, Structure Of The Egf-Like Module Of Human C1r, Nmr, 19 Structures Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1416
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 1e-135
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-67
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-67
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 8e-66
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-50
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-33
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-28
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 3e-11
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-131
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-63
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 2e-53
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 5e-52
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-40
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 8e-33
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-94
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-04
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-92
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 6e-91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 6e-89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 7e-05
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-81
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 1e-79
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-78
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 2e-70
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-29
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 3e-04
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-26
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 8e-23
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-22
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-22
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-21
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 4e-20
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 5e-20
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 4e-19
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 9e-19
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-18
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-18
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 8e-17
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-16
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 7e-16
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-15
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-14
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 4e-14
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-13
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 9e-06
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-04
2xrc_A 565 Human complement factor I; immune system, hydrolas 2e-25
2xrc_A 565 Human complement factor I; immune system, hydrolas 1e-23
2xrc_A565 Human complement factor I; immune system, hydrolas 6e-19
2xrc_A565 Human complement factor I; immune system, hydrolas 2e-18
2xrc_A565 Human complement factor I; immune system, hydrolas 3e-17
2xrc_A565 Human complement factor I; immune system, hydrolas 4e-16
2xrc_A565 Human complement factor I; immune system, hydrolas 9e-16
2xrc_A565 Human complement factor I; immune system, hydrolas 1e-15
2xrc_A565 Human complement factor I; immune system, hydrolas 3e-15
2xrc_A 565 Human complement factor I; immune system, hydrolas 7e-15
2xrc_A565 Human complement factor I; immune system, hydrolas 9e-14
2xrc_A565 Human complement factor I; immune system, hydrolas 4e-06
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-25
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-24
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-22
2fyj_A82 Low-density lipoprotein receptor-related protein 1 5e-22
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-20
2fyj_A82 Low-density lipoprotein receptor-related protein 1 9e-20
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-19
2fyj_A82 Low-density lipoprotein receptor-related protein 1 7e-19
2fyj_A82 Low-density lipoprotein receptor-related protein 1 9e-19
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 3e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-17
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-16
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-16
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-16
2fyj_A82 Low-density lipoprotein receptor-related protein 1 7e-16
2fyj_A82 Low-density lipoprotein receptor-related protein 1 3e-14
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-13
2fyj_A82 Low-density lipoprotein receptor-related protein 1 8e-12
2fyj_A82 Low-density lipoprotein receptor-related protein 1 7e-07
2fyj_A82 Low-density lipoprotein receptor-related protein 1 8e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-18
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-17
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-14
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 7e-13
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 4e-08
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 1e-07
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 1e-07
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 2e-07
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 4e-06
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 4e-06
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 4e-06
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 5e-12
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 2e-09
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 3e-08
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 8e-07
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 3e-06
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 5e-06
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 5e-06
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 1e-05
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 1e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-11
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-11
3a7q_B44 Low-density lipoprotein receptor-related protein; 1e-10
3a7q_B44 Low-density lipoprotein receptor-related protein; 7e-09
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 4e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 8e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 4e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 6e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 8e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 9e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-06
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-06
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-05
3a7q_B44 Low-density lipoprotein receptor-related protein; 7e-05
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-04
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-04
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 3e-11
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-10
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-09
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 5e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 9e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 1e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 4e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 5e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 3e-06
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 4e-06
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 5e-06
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 1e-05
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-05
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 4e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 8e-11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 8e-11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-09
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 4e-04
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 9e-11
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 8e-09
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-08
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 4e-07
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 4e-07
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-05
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 7e-05
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-10
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 2e-10
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 4e-10
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 7e-10
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 9e-08
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 2e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 2e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 4e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 7e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 2e-06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 4e-06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 8e-06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 9e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 4e-10
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-09
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-09
2i1p_A48 Low-density lipoprotein receptor-related protein 2 6e-08
2i1p_A48 Low-density lipoprotein receptor-related protein 2 7e-08
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 6e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 7e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 8e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 8e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 9e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 5e-10
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-10
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 8e-10
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 3e-09
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 7e-09
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-08
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 6e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 9e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 1e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 8e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 9e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 3e-05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 3e-05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 6e-05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 9e-05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 8e-04
1j8e_A44 Low-density lipoprotein receptor-related protein 1 9e-10
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-09
1j8e_A44 Low-density lipoprotein receptor-related protein 1 7e-09
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 8e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 8e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 3e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 6e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 8e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 9e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 3e-05
1j8e_A44 Low-density lipoprotein receptor-related protein 1 5e-05
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 1e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 3e-09
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 8e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 7e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 8e-09
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-08
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-08
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-08
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 1e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 5e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 1e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 9e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 1e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 5e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 9e-09
2knx_A50 Prolow-density lipoprotein receptor-related prote; 4e-08
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 4e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 8e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 5e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 6e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 3e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 4e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 5e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-08
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-07
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 1e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 3e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 6e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 7e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 3e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 5e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 7e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 9e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 1e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 7e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 7e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-08
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-04
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 8e-08
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 5e-07
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 3e-06
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 7e-06
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 2e-05
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 3e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 9e-08
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 9e-07
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-06
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-06
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 6e-06
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 9e-06
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 3e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 3e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 6e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 1e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 1e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 3e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 6e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 9e-08
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 4e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 6e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 7e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-04
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-04
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 9e-04
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-07
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 7e-06
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 8e-06
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 1e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 1e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 3e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 6e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 8e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 4e-04
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 7e-07
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 3e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 8e-07
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 3e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 4e-04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-06
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 3e-06
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 8e-05
2wph_E59 Coagulation factor IXA light chain; serine proteas 5e-06
2wph_E59 Coagulation factor IXA light chain; serine proteas 8e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 7e-06
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 8e-06
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 9e-05
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 1e-05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 2e-05
2vh0_B134 Activated factor XA light chain; serine protease, 5e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-05
1szb_A170 Mannose binding lectin-associated serine protease- 5e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 8e-05
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 9e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-04
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 4e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-04
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 6e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 6e-04
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 8e-04
2p4o_A306 Hypothetical protein; putative lactonase, structur 8e-04
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
 Score =  435 bits (1119), Expect = e-135
 Identities = 242/761 (31%), Positives = 335/761 (44%), Gaps = 69/761 (9%)

Query: 133 CDGQNDCFDMSDEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGL 192
                                      C  ++F C++G CI  +W CDG  +C DG    
Sbjct: 7   WTVALLLAAAGTAVGD----------RCERNEFQCQDGKCISYKWVCDGSAECQDG---- 52

Query: 193 SSDEMNCDTESTCKANNNVFQCDNNKTCISKSWVCDGTYDCTDRSDENSTYCAHSECNLF 252
            SDE      S    + +         CI + W CDG  DC + SDE    C    C+  
Sbjct: 53  -SDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE--QGCPPKTCSQD 109

Query: 253 EFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCMEGYFKCLNGRCLLENYYC 312
           EFRC+  G+CI   +VCD   DC+D SDE          TC    F+C +  C+ + + C
Sbjct: 110 EFRCHD-GKCISRQFVCDSDRDCLDGSDEASCPVL----TCGPASFQCNSSTCIPQLWAC 164

Query: 313 DGENDCGDNSDE-------------PIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSD 359
           D + DC D SDE                      + CL+G C+  ++ CDG  DC D SD
Sbjct: 165 DNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSD 224

Query: 360 EPPSCPKTDCDNSTHFECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPS 419
           E   C    C     F+C +GNCI     C+   DC D SDE             C+ P+
Sbjct: 225 EEN-CAVATC-RPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTL-----CEGPN 277

Query: 420 HFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNECNVSHGGQLCAHECIDLKIGYKCAC 479
            F C +G CI     CN   DC D SDE                C+H C DLKIGY+C C
Sbjct: 278 KFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLC 337

Query: 480 RKGYQVHPEDKHLCVDTNECLDRP-CSHYCRNTLGSYSCSCAPGYALLSDKHGCKATSDV 538
             G+Q+    +  C D +EC D   CS  C N  G Y C C  G+ L      CKA   +
Sbjct: 338 PDGFQLV--AQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSI 395

Query: 539 PPNLLFTNKYYIREVTQAGVMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCN 598
                       +        T  I N  N V LD +   N +YWSD++     I  +  
Sbjct: 396 AYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQR--MICSTQL 453

Query: 599 NSQPELLFPAT-------SPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGL 651
           +    +    T       +PDGL VDW+  N+YW D  L T+ VA   G  RK L  +  
Sbjct: 454 DRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENG 513

Query: 652 QEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELF 711
            +PR I ++P +G+MYWTDWG  A I K  ++G +   ++++N+ WPN +T+   +  L+
Sbjct: 514 SKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLY 573

Query: 712 WGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCD 771
           W D+    I+  D+NG N K I+         L H F+LAVFED +FWTD   ++I   +
Sbjct: 574 WVDSKLHSISSIDVNGGNRKTILEDEK----RLAHPFSLAVFEDKVFWTDIINEAIFSAN 629

Query: 772 KYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCE----NNGGCQGLCLLKP----- 822
           + TG +   + +NL   P D+ ++H   Q P   N CE    +NGGCQ LCL  P     
Sbjct: 630 RLTGSDVNLLAENL-LSPEDMVLFHNLTQ-PRGVNWCERTTLSNGGCQYLCLPAPQINPH 687

Query: 823 NGHRQCACPDNFILESDGKTCRHNCSAGQFLCEKTMKCIPF 863
           +    CACPD  +L  D ++C     A     E +   +  
Sbjct: 688 SPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKV 728
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1416
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.97
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.94
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.92
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.9
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.87
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.8
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.79
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.77
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.76
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.76
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.75
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.74
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.71
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.69
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.67
3kya_A496 Putative phosphatase; structural genomics, joint c 99.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.66
3kya_A496 Putative phosphatase; structural genomics, joint c 99.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.62
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.6
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.59
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.57
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.55
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.51
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.51
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.49
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.48
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.47
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.47
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.45
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.4
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.39
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.38
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.37
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.37
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.34
2xrc_A565 Human complement factor I; immune system, hydrolas 99.29
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.28
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.28
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.25
2xrc_A565 Human complement factor I; immune system, hydrolas 99.24
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.23
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.22
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.22
2qe8_A343 Uncharacterized protein; structural genomics, join 99.21
2qe8_A343 Uncharacterized protein; structural genomics, join 99.21
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.2
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.2
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.19
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.18
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.16
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.16
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.13
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.13
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.13
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.12
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.12
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.1
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.09
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.05
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.04
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.02
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.0
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.98
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.97
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.96
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.95
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.95
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.94
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.9
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.89
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.89
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.89
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.88
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.88
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.88
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.86
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.86
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.86
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.84
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.84
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.83
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.83
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.82
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.81
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.81
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.8
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.8
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.79
2bou_A143 EGF-like module containing mucin-like hormone rece 98.76
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.76
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.75
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.75
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.75
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.74
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.74
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.74
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.73
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.73
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.73
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.72
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.71
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.68
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.68
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.66
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.66
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.63
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.62
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.6
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.59
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.58
2vh0_B134 Activated factor XA light chain; serine protease, 98.58
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.58
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.57
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.57
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.57
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.56
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.56
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.55
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.51
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.46
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.46
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.45
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.45
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.44
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.44
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.43
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.43
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.42
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.42
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.42
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.41
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.39
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.38
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.38
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.38
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.37
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.36
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.36
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.34
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.34
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.31
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.25
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.23
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.23
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.22
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.22
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.21
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.19
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.18
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 98.18
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.18
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.17
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.17
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.15
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.13
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.13
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.13
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.11
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 98.1
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.08
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.07
2ece_A462 462AA long hypothetical selenium-binding protein; 98.04
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 98.04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.03
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.03
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.0
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.0
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.97
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.97
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.95
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.93
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.92
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.92
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.92
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 97.91
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.89
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 97.89
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.88
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.88
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.82
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.77
2ece_A462 462AA long hypothetical selenium-binding protein; 97.74
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.73
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.72
2bou_A143 EGF-like module containing mucin-like hormone rece 97.69
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.65
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.59
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.43
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.25
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.21
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.2
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.15
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.15
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.13
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.12
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.1
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.09
1szb_A170 Mannose binding lectin-associated serine protease- 97.08
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.08
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.07
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.06
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.06
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.05
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.05
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.0
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.92
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.92
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 96.89
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.88
2vh0_B134 Activated factor XA light chain; serine protease, 96.87
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.85
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.84
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.83
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.82
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.82
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.8
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.8
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.79
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.77
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.76
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.74
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.74
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.71
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.7
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.62
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.61
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.61
1nzi_A159 Complement C1S component; calcium, innate immunity 96.6
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.59
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.58
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 96.58
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.57
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.54
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.53
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.45
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.44
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.44
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 96.41
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.4
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.38
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.36
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.31
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.26
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.26
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.25
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.24
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.24
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 96.19
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.18
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.16
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.15
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.1
3jrp_A379 Fusion protein of protein transport protein SEC13 96.08
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.05
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.03
3jrp_A379 Fusion protein of protein transport protein SEC13 96.02
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.02
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.0
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 95.96
1k32_A1045 Tricorn protease; protein degradation, substrate g 95.96
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.91
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 95.89
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.87
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 95.85
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.83
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.83
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 95.79
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.78
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.77
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.77
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.67
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.63
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 95.62
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.62
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.59
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.57
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.53
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.5
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.38
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 95.35
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.31
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.21
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.21
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.12
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.11
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 94.93
1szb_A170 Mannose binding lectin-associated serine protease- 94.89
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.88
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.88
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.87
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.8
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.76
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.74
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.66
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.59
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.59
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.58
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.57
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.56
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 94.53
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.4
1nzi_A159 Complement C1S component; calcium, innate immunity 94.31
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.24
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.16
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.12
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 94.12
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 93.8
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 93.76
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.71
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.69
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.67
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 93.55
3jro_A753 Fusion protein of protein transport protein SEC13 93.54
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 93.48
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.47
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.41
2k2s_B61 Micronemal protein 6; microneme protein complex, c 93.32
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 93.31
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 93.28
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.2
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 93.11
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 92.98
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 92.98
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 92.89
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.85
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 92.84
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 92.75
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.72
2pm7_B297 Protein transport protein SEC13, protein transport 92.71
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.68
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 92.59
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 92.55
3jro_A753 Fusion protein of protein transport protein SEC13 92.37
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 92.06
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 92.05
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.02
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 91.93
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 91.92
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 91.77
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.74
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 91.5
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.45
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 91.35
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.3
2k2s_B61 Micronemal protein 6; microneme protein complex, c 91.08
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 91.07
4a2l_A795 BT_4663, two-component system sensor histidine kin 90.74
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 90.22
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.11
3v9f_A781 Two-component system sensor histidine kinase/RESP 90.09
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.83
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 89.7
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 89.27
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 88.38
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 87.87
2zuy_A620 YESX protein; beta-propeller, lyase; 1.65A {Bacill 87.75
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.2
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 87.19
3v9f_A781 Two-component system sensor histidine kinase/RESP 87.09
2zux_A591 YESW protein; beta-propeller, lyase, rhamnose comp 86.63
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.24
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 86.1
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 85.63
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 84.69
1sqj_A789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 84.5
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 84.36
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 84.28
1a3p_A45 Epidermal growth factor; disulfide connectivities, 84.26
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 83.84
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 83.71
2pm7_B297 Protein transport protein SEC13, protein transport 83.31
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 82.88
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 82.57
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 82.54
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 82.49
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 81.96
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 81.82
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 80.73
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 80.58
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.7e-119  Score=1164.53  Aligned_cols=661  Identities=40%  Similarity=0.814  Sum_probs=378.2

Q ss_pred             CCCCCceeecCCceeCCCcccCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCceecCC-CCceecCCcccCCCCCCCCCC
Q psy6572          67 TCGNDTFHCDMGMCIHKALRCDVDPDCPDASDEMH--CPMTNCTEKYPLMTNPIHCNF-TSACIEESYICDGQNDCFDMS  143 (1416)
Q Consensus        67 ~C~~~~f~C~~g~Ci~~~~~Cdg~~dC~d~sDE~~--C~~~~C~~~~~~~~~~f~C~~-~~~CI~~~~~CDg~~DC~D~s  143 (1416)
                      .|+..+|+|.+|+||+..|+|||..||.|+|||.+  |...+|++.+      |+|.+ .++|||..|+|||++||.|||
T Consensus        23 ~C~~~~f~C~~g~Ci~~~~~CDg~~dC~D~sDE~~~~C~~~~C~~~~------f~C~~~~~~Ci~~~~~CDg~~dC~dgs   96 (791)
T 3m0c_C           23 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGD------FSCGGRVNRCIPQFWRCDGQVDCDNGS   96 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CcCcCccCCCCCCEEehhhcCCCCccCCCCCcccccccccCccCcCc------cccCCCCCCEeeccccCCCCcCcCCCc
Confidence            67888888888888888888888888888888886  7778898887      99987 369999999999999999999


Q ss_pred             CccccccccCCCCCcCCCCCCcccCCCceecCceeecCCCCCCCCCCCCCCCCCCCCCCCccCCCCCceecCCCCceecC
Q psy6572         144 DEQNCDQIKDVSPKMNCSGDKFLCRNGNCILSRWRCDGDNDCNDGNDGLSSDEMNCDTESTCKANNNVFQCDNNKTCISK  223 (1416)
Q Consensus       144 DE~~C~~~~~~~~~~~C~~~~f~C~~g~CI~~~~~CDg~~DC~Dg~d~~~sDE~~C~~~~~C~~~~~~F~C~~~~~CI~~  223 (1416)
                      ||.+|.       ..+|++.+|+|.+|+|||..|+|||+.||.||     |||.+|+. .+|.+  ++|+| .+++|||.
T Consensus        97 DE~~C~-------~~~C~~~~f~C~~g~Ci~~~~~CDg~~dC~dg-----sDE~~C~~-~~C~~--~~f~C-~~~~Ci~~  160 (791)
T 3m0c_C           97 DEQGCP-------PKTCSQDEFRCHDGKCISRQFVCDSDRDCLDG-----SDEASCPV-LTCGP--ASFQC-NSSTCIPQ  160 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccCCcc-------CccccCCeEECCCCCEECHHHcCCCcccCCCC-----cccccccc-ccccc--ceecc-CCCccccc
Confidence            999997       35799999999999999999999999999999     99999974 68998  99999 88999999


Q ss_pred             cccccCCCCCCCCCCCCCCccc--------CCCCCCCceeeCCCCCeEcCcccccCCCCCCCCCCCccccCCcccccccC
Q psy6572         224 SWVCDGTYDCTDRSDENSTYCA--------HSECNLFEFRCNSTGQCIPITWVCDGVTDCIDKSDEHHSQDCLNVETCME  295 (1416)
Q Consensus       224 ~w~CDg~~DC~D~sDE~~~~c~--------~~~C~~~~F~C~~~~~CI~~~w~CDG~~DC~DgsDE~~~~~C~~~~~C~~  295 (1416)
                      .|+|||+.||.|||||..+.|.        ...|.+.+|+| .+|+||+..|+|||+.||.|||||   .+|.. .+|.+
T Consensus       161 ~~~Cdg~~dC~dgsDE~~~~C~~~~~~~~~~~~C~~~~f~C-~~g~Ci~~~~~CDg~~dC~dgsDE---~~C~~-~~C~~  235 (791)
T 3m0c_C          161 LWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHC-LSGECIHSSWRCDGGPDCKDKSDE---ENCAV-ATCRP  235 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccCCCCCcCCCCCCcccccCCCccccCCCCCCCCCCcccc-cCCceeccccccCCCCCCCCCCCC---CCccc-cccCC
Confidence            9999999999999999755563        35799999999 589999999999999999999999   57853 67999


Q ss_pred             CeeecCCCceeccccccCCCCCCCCCCCcccccccccceeeCCCccccccccccCCCCCCCCCCCCCCCCCCCCCCCCce
Q psy6572         296 GYFKCLNGRCLLENYYCDGENDCGDNSDEPIVSMWKLVWKCLNGRCLLENYYCDGENDCGDNSDEPPSCPKTDCDNSTHF  375 (1416)
Q Consensus       296 ~~f~C~~g~CI~~~~~CDg~~DC~DgSDE~~c~~~~~~f~C~~g~Ci~~~~~Cdg~~dC~d~~~e~~~C~~~~c~~~~~f  375 (1416)
                      .+|+|.+|.||+.+|+|||..||.|||||.+|                           ...    ..|.     .+.+|
T Consensus       236 ~~f~C~~g~Ci~~~~~Cdg~~dC~dgsDE~~C---------------------------~~~----~~C~-----~~~~~  279 (791)
T 3m0c_C          236 DEFQCSDGNCIHGSRQCDREYDCKDMSDEVGC---------------------------VNV----TLCE-----GPNKF  279 (791)
T ss_dssp             --------------------------------------------------------------------CC-----STTCC
T ss_pred             CcceecCCceEecceecCChhccccccccCcc---------------------------ccc----cccc-----CCCcc
Confidence            99999999999999999999999999999732                           110    1232     26778


Q ss_pred             eecCCcEeCCceeeCCcCCCCCCCCccccccccCCCCCCCCCCCceeeCCCeeecCCcccCCCCCCCCCCCCCCcccccc
Q psy6572         376 ECQNGNCIPSVLLCNGVNDCDDNSDEDMNHAECRSLKDLCKHPSHFLCSNGLCINETLTCNDINDCGDNSDEFSCFVNEC  455 (1416)
Q Consensus       376 ~C~~g~CI~~~~~CDg~~DC~DgSDE~~~~~~C~~~~~~C~~~~~f~C~~g~Ci~~~~~Cdg~~dC~dgsDe~~C~i~eC  455 (1416)
                      +|.+|.||+..++|++..||.|||||...                                            .|.++||
T Consensus       280 ~C~~G~Ci~~~~~Cd~~~dC~dgsDe~~~--------------------------------------------~C~~~~C  315 (791)
T 3m0c_C          280 KCHSGECITLDKVCNMARDCRDWSDEPIK--------------------------------------------ECGTNEC  315 (791)
T ss_dssp             CCTTSCCCCSSCCSCSSCCSSSSCSCCCT--------------------------------------------TBSCCST
T ss_pred             ccCCCcccccccccCCccccccccCcccc--------------------------------------------ccccccc
Confidence            88888899888889998889888888311                                            1234556


Q ss_pred             cCCCCCCcccccceecCCceEEeeCCCceecCCCCCccccCCcCC-CCCccceeeecCCeeeecCCCCcEEecCCCceEe
Q psy6572         456 NVSHGGQLCAHECIDLKIGYKCACRKGYQVHPEDKHLCVDTNECL-DRPCSHYCRNTLGSYSCSCAPGYALLSDKHGCKA  534 (1416)
Q Consensus       456 ~~~~~~~~Cs~~C~nt~~gy~C~C~~Gy~L~p~d~~tC~didEC~-~~~Csq~C~nt~gsy~C~C~~Gy~L~~dg~sC~a  534 (1416)
                      ...+++  |+|.|++++++|+|.|++||+|  .++++|++||||+ +++|+|+|+|++|+|+|.|++||+|.+++++|++
T Consensus       316 ~~~~~~--C~~~C~~~~~~y~C~C~~Gy~l--~~g~~C~dideC~~~~~C~~~C~n~~gsy~C~C~~Gy~l~~~~~~C~~  391 (791)
T 3m0c_C          316 LDNNGG--CSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKA  391 (791)
T ss_dssp             TTGGGG--CSSEEEECSBSEEEECCTTCEE--ETTTEEECCCCCSSSSSCTTTCCBCSSCBCCCCCSSEECCSSCCCCEE
T ss_pred             cccccC--ccccccCCCCCcccCCCCCCcc--CCCCccccCcccCCCCCCCCeeecCCCCceeecCCCCEeCCCCceeee
Confidence            544445  9999999999999999999999  4788999999998 7899999999999999999999999999999999


Q ss_pred             cCCCCCeEEEEecEEEEEEecCCcc-eEEecccccceeeeeecCCCeEEEeeccCCCccEEEEecCC-----CCeEEee-
Q psy6572         535 TSDVPPNLLFTNKYYIREVTQAGVM-TIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNNS-----QPELLFP-  607 (1416)
Q Consensus       535 ~~~~~~~li~s~~~~I~~i~l~g~~-~~~~~~l~~~~~l~~D~~~~~LYwtD~~~~~~~I~r~~l~s-----~~~~l~~-  607 (1416)
                      ++ ..++|||++++.|+++.+++.. +.++.++..++||+||+..++|||+|...+  +|+++.+++     ..++++. 
T Consensus       392 ~~-~~p~Ll~an~~~Ir~i~l~~~~~~~l~~~~~~~~gl~~d~~~~~lY~sD~~~~--~I~~~~l~g~~~~~~~~~vi~~  468 (791)
T 3m0c_C          392 VG-SIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQR--MICSTQLDRAHGVSSYDTVISR  468 (791)
T ss_dssp             TT-SCCEEEEECBSSEEEECTTSCCCEEEECSCSSEEEEEEETTTTEEEEEETTTT--EEEEEEC--------CEEEECS
T ss_pred             cc-cccccccccccceeEeeccCCcceeeecCCCceEEEeecccCCeeEEeeccce--eEEEEeccCCCCCcceeEEEec
Confidence            85 4789999999999999999877 778889999999999999999999999864  899999983     3445554 


Q ss_pred             -cCCCceEEEEccCCcEEEeeCCCCeEEEeecCCCceEEEEcCCCCCcceeeecCCcceEEEeeCCCCceEEEEecCCCC
Q psy6572         608 -ATSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSN  686 (1416)
Q Consensus       608 -l~~p~gLAvD~~~~~LYwtD~~~~~I~v~~ldG~~~~vLi~~~l~~P~gIavDp~~g~LYWtD~g~~~~I~ra~mDGs~  686 (1416)
                       +..|.||||||++++|||+|...++|+|++++|+.+++|+...+..|+||||||.+|+||||||+..++|+|++|+|+.
T Consensus       469 ~l~~P~GLAvD~~~~~LY~tD~~~~~I~v~~ldG~~~~~l~~~~l~~P~gIaVDp~~g~LYwtD~g~~~~I~~~~~dG~~  548 (791)
T 3m0c_C          469 DIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVD  548 (791)
T ss_dssp             SCSCCCEEEEETTTTEEEEEETTTTEEEEEETTSSSEEEEEECTTCCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCC
T ss_pred             CCCCcceeeeeecCCcEEEEecCCCeEEEEeCCCCeEEEEEeCCCCCcceEEEecCCCCEEEecCCCCCeEEEEecCCCc
Confidence             8899999999999999999999999999999999999999999999999999999999999999987899999999999


Q ss_pred             CEEEeecCCCCCeeEEeecCCCeEEEecCCCCeEEEEeCCCCceEEEEeccCCCCcccccceeEEEecCcEEEeecCCCe
Q psy6572         687 PKVIISKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKS  766 (1416)
Q Consensus       687 r~vlv~~~l~~P~gLaiD~~~~rLYWtD~~~~~I~~~~ldG~~r~~v~~~~~~p~~~l~~P~~lav~~d~LYwtD~~~~~  766 (1416)
                      +++|+...|.+|+|||||+.+++|||+|+++++|++++++|+.+++|+...    ..+.+|++|++++++||||||.+++
T Consensus       549 ~~~lv~~~l~~P~GLavD~~~~~LYwaD~~~~~I~~~d~dG~~~~~v~~~~----~~l~~P~glav~~~~lYwtD~~~~~  624 (791)
T 3m0c_C          549 IYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDE----KRLAHPFSLAVFEDKVFWTDIINEA  624 (791)
T ss_dssp             EEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEEECT----TTTSSEEEEEEETTEEEEEETTTTE
T ss_pred             eEEEEeCCCCCceEEEEecCCCeEEEEeCCCCcEEEEecCCCceEEEecCC----CccCCCCEEEEeCCEEEEEECCCCE
Confidence            999999999999999999999999999999999999999999999998753    2489999999999999999999999


Q ss_pred             eEEecccCCCceEEEEeCCCCCCeeeeeecccCCCCCCCCCCC----CCCCCccceeecCC-----CCccccCCCCeeec
Q psy6572         767 IERCDKYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPLKDNPCE----NNGGCQGLCLLKPN-----GHRQCACPDNFILE  837 (1416)
Q Consensus       767 I~~~nk~tG~~~~~l~~~~~~~p~~I~v~h~~~q~p~~~npC~----~NggCshlCl~~p~-----~~~~C~Cp~g~~L~  837 (1416)
                      |++++|++|+.+.+|. ..+..|++|+|||+++| |.+.|||.    +||+||||||++|.     ++|+|+||+||+|+
T Consensus       625 I~~~dk~tG~~~~~l~-~~l~~P~~i~v~h~~~Q-p~~~N~C~~~~~~ng~CshlCl~~p~~~~~~~~~~C~Cp~g~~L~  702 (791)
T 3m0c_C          625 IFSANRLTGSDVNLLA-ENLLSPEDMVLFHNLTQ-PRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLA  702 (791)
T ss_dssp             EEEEETTTCCCCEEEE-CSCSCCCCEEEESGGGS-CCCCCTTTSSSSGGGGCSSEEEECCCCSTTCCSEEEECCTTCEEC
T ss_pred             EEEEeCCCCcceEEee-cCCCCceeEeeeccccC-CCCCCcccccCCCCcCcCeeecCCCCcCCCCCCceeECCCCCEEC
Confidence            9999999999998887 77899999999999999 88999997    58999999999985     27999999999999


Q ss_pred             CCCceecccC
Q psy6572         838 SDGKTCRHNC  847 (1416)
Q Consensus       838 ~d~~tC~~~C  847 (1416)
                      .|+++|++..
T Consensus       703 ~d~~tC~~~~  712 (791)
T 3m0c_C          703 RDMRSCLTEA  712 (791)
T ss_dssp             TTSSCEEC--
T ss_pred             CCCCcCCCCC
Confidence            9999998643
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2zuy_A YESX protein; beta-propeller, lyase; 1.65A {Bacillus subtilis} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zux_A YESW protein; beta-propeller, lyase, rhamnose complex; HET: RAM; 1.32A {Bacillus subtilis} PDB: 2z8s_A* 2z8r_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1416
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-61
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 7e-60
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-10
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-05
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-05
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-05
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-04
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-04
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 0.004
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 1e-09
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 3e-09
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 9e-08
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 9e-08
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 3e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 7e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 8e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 1e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 4e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 4e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 4e-05
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 6e-05
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 6e-05
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 5e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 5e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 0.004
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-09
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-08
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-07
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-05
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-04
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-04
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-09
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-09
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-07
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-06
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-06
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-09
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 4e-07
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 9e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 5e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 7e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 8e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 4e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 7e-09
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 5e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 8e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 5e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 7e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 9e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 4e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 5e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 0.001
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-09
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-08
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-07
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-08
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-08
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 6e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-06
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-06
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-06
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 4e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 7e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 4e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 5e-04
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-04
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-04
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 0.004
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-08
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 7e-07
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-06
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 9e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.002
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.003
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 7e-08
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 3e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 3e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 6e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 8e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 3e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 3e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 0.001
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 0.002
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-07
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 6e-06
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 2e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 4e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 5e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.001
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.002
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.002
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.002
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.003
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 4e-07
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 5e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 6e-07
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 7e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 7e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 3e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 3e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 5e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 7e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.001
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.003
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.004
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 1e-06
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 6e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-06
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 3e-06
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 4e-04
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 3e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.002
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 3e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 8e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 3e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 5e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 3e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 4e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.001
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 5e-06
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 6e-06
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 1e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 6e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 4e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 4e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 8e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 8e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.001
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.001
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.002
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.002
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.004
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.004
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 6e-06
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 3e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 6e-06
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 7e-06
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 1e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 5e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.003
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 4e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 7e-05
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 8e-05
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 8e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 3e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 5e-04
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 5e-04
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 0.003
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.003
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  208 bits (530), Expect = 3e-61
 Identities = 92/267 (34%), Positives = 144/267 (53%), Gaps = 11/267 (4%)

Query: 540 PNLLFTNKYYIREVTQAG-VMTIRIHNQTNAVGLDFDWVDNCLYWSDVTMHG---SSIRR 595
             L FTN++ +R++T      T  I N  N V LD +   N +YWSD++      + + R
Sbjct: 2   AYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDR 61

Query: 596 SCNNSQPELLFPA--TSPDGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQE 653
           +   S  + +      +PDGL VDW+  N+YW D  L T+ VA   G  RK L  +   +
Sbjct: 62  AHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSK 121

Query: 654 PRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVIISKNLSWPNALTISYETNELFWG 713
           PR I ++P +G+MYWTDWG  A I K  ++G +   ++++N+ WPN +T+   +  L+W 
Sbjct: 122 PRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWV 181

Query: 714 DAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCDKY 773
           D+    I+  D+NG N K I+         L H F+LAVFED +FWTD   ++I   ++ 
Sbjct: 182 DSKLHSISSIDVNGGNRKTILE----DEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRL 237

Query: 774 TGKNCTSVVKNLVHKPMDLRVYHPYRQ 800
           TG +   + +NL   P D+ ++H   Q
Sbjct: 238 TGSDVNLLAENL-LSPEDMVLFHNLTQ 263
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1416
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.93
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.79
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.55
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.54
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.52
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.47
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.38
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.26
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.26
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.22
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.07
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.02
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.02
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.0
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.97
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.96
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.93
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.92
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.91
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.9
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.89
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.88
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.87
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.87
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.86
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.86
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.85
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.84
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.84
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.83
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.81
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.81
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.8
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.78
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.76
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.76
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.76
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.73
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.71
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.71
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.7
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.69
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.69
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.68
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.68
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.67
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.64
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.63
d1nt0a345 Mannose-binding protein associated serine protease 98.62
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.6
d1szba245 Mannose-binding protein associated serine protease 98.54
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.52
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.51
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.51
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.51
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1szba245 Mannose-binding protein associated serine protease 98.46
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.45
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.43
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1nt0a345 Mannose-binding protein associated serine protease 98.42
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.4
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.38
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.33
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.2
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.2
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.17
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.16
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.15
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.15
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.11
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.1
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.1
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.08
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.05
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.92
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.86
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.8
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.78
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.77
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.75
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.72
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.67
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.59
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.53
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.49
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.48
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.44
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.31
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.3
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.16
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.12
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.9
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.88
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.82
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.8
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.68
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.61
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.57
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.46
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.44
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.16
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.97
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.9
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.82
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.69
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.45
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.26
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.11
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.06
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.04
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.8
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.45
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 93.97
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 93.81
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.64
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.45
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 93.45
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 93.26
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 92.96
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 92.78
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 92.56
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.47
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 92.13
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.73
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.31
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.26
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.88
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 90.82
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 90.79
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.64
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 90.15
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 89.19
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 89.04
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 88.12
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 87.91
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 87.16
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 86.9
d2ebsa1427 Oligoxyloglucan reducing end-specific cellobiohydr 86.75
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 86.28
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 85.97
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 85.88
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 85.73
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 85.22
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 84.67
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 83.72
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 81.4
d2ebsa1427 Oligoxyloglucan reducing end-specific cellobiohydr 80.83
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 80.56
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.6e-43  Score=397.10  Aligned_cols=256  Identities=35%  Similarity=0.656  Sum_probs=235.2

Q ss_pred             CeEEEEecEEEEEEecCCcc-eEEecccccceeeeeecCCCeEEEeeccCCCccEEEEecC-C----CCeEEee--cCCC
Q psy6572         540 PNLLFTNKYYIREVTQAGVM-TIRIHNQTNAVGLDFDWVDNCLYWSDVTMHGSSIRRSCNN-S----QPELLFP--ATSP  611 (1416)
Q Consensus       540 ~~li~s~~~~I~~i~l~g~~-~~~~~~l~~~~~l~~D~~~~~LYwtD~~~~~~~I~r~~l~-s----~~~~l~~--l~~p  611 (1416)
                      +||||++++.|+++++++.. +.++.++.+++||+||+.+++|||+|...+  .|+++.++ .    ..++++.  +..|
T Consensus         2 ~fLl~s~~~~I~~~~l~~~~~~~~~~~~~~~~~id~d~~~~~lYw~D~~~~--~I~~~~l~~~~~~~~~~~~~~~~~~~p   79 (266)
T d1ijqa1           2 AYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQR--MICSTQLDRAHGVSSYDTVISRDIQAP   79 (266)
T ss_dssp             CEEEEECBSSEEEEETTSCCCEEEECSCSSEEEEEEETTTTEEEEEETTTT--EEEEEEC--------CEEEECSSCSCC
T ss_pred             CEEEEECCCeEEEEECCCCcceeeeCCCCceEEEEEEeCCCEEEEEECCCC--EEEEEEecCCCCCcceEEEEeCCCCCc
Confidence            69999999999999999988 777889999999999999999999998864  89999987 2    2344444  7899


Q ss_pred             ceEEEEccCCcEEEeeCCCCeEEEeecCCCceEEEEcCCCCCcceeeecCCcceEEEeeCCCCceEEEEecCCCCCEEEe
Q psy6572         612 DGLTVDWVGRNLYWCDKGLDTIEVAKLDGRFRKVLINKGLQEPRGIALNPAYGYMYWTDWGQNAHIGKAKMDGSNPKVII  691 (1416)
Q Consensus       612 ~gLAvD~~~~~LYwtD~~~~~I~v~~ldG~~~~vLi~~~l~~P~gIavDp~~g~LYWtD~g~~~~I~ra~mDGs~r~vlv  691 (1416)
                      .||||||++++|||+|...++|+|++++|..+++++...+..|++|||||.+|+|||++++..++|+|++|||+++++|+
T Consensus        80 ~glAvD~~~~~lY~~d~~~~~I~v~~~~g~~~~~~~~~~~~~P~~l~vd~~~g~ly~~~~~~~~~I~r~~~dGs~~~~l~  159 (266)
T d1ijqa1          80 DGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLV  159 (266)
T ss_dssp             CEEEEETTTTEEEEEETTTTEEEEEETTSSSEEEEEECTTCCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCCEEEEE
T ss_pred             ceEEEeeccceEEEEecCCCEEEeEecCCceEEEEEcCCCCCcceEEEEcccCeEEEeccCCCcceeEeccCCCceeccc
Confidence            99999999999999999999999999999999999989999999999999999999999998889999999999999999


Q ss_pred             ecCCCCCeeEEeecCCCeEEEecCCCCeEEEEeCCCCceEEEEeccCCCCcccccceeEEEecCcEEEeecCCCeeEEec
Q psy6572         692 SKNLSWPNALTISYETNELFWGDAHEDYIAVSDLNGENIKIIVSRRMDPTINLHHVFALAVFEDHLFWTDWEMKSIERCD  771 (1416)
Q Consensus       692 ~~~l~~P~gLaiD~~~~rLYWtD~~~~~I~~~~ldG~~r~~v~~~~~~p~~~l~~P~~lav~~d~LYwtD~~~~~I~~~n  771 (1416)
                      ...+.+|+|||||+.+++|||+|...+.|++++++|+++++++...    ..+.+|++|++++++|||+|+..++|++++
T Consensus       160 ~~~~~~p~gl~iD~~~~~lYw~d~~~~~I~~~~~dG~~~~~~~~~~----~~~~~p~~lav~~~~ly~td~~~~~I~~~~  235 (266)
T d1ijqa1         160 TENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDE----KRLAHPFSLAVFEDKVFWTDIINEAIFSAN  235 (266)
T ss_dssp             CSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEEECT----TTTSSEEEEEEETTEEEEEETTTTEEEEEE
T ss_pred             ccccceeeEEEeeccccEEEEecCCcCEEEEEECCCCCEEEEEeCC----CcccccEEEEEECCEEEEEECCCCeEEEEE
Confidence            9899999999999999999999999999999999999999888754    247899999999999999999999999999


Q ss_pred             ccCCCceEEEEeCCCCCCeeeeeecccCCCCC
Q psy6572         772 KYTGKNCTSVVKNLVHKPMDLRVYHPYRQTPL  803 (1416)
Q Consensus       772 k~tG~~~~~l~~~~~~~p~~I~v~h~~~q~p~  803 (1416)
                      |.+|+..+++. ..+..|++|+||||.+| |.
T Consensus       236 ~~~g~~~~~~~-~~~~~p~~i~v~~~~~Q-P~  265 (266)
T d1ijqa1         236 RLTGSDVNLLA-ENLLSPEDMVLFHNLTQ-PR  265 (266)
T ss_dssp             TTTCCCCEEEE-CSCSCCCCEEEESGGGS-CC
T ss_pred             CCCCcceEEEE-cCCCCceEEEEECCccC-CC
Confidence            99999988887 78889999999999999 64
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure