Psyllid ID: psy6577

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQINAQRNPRMYL
cccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHcccccccccccccc
cccccccccEEEccccccHHHHHEHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccEEcccccccccc
meqlqmgqgiltNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEaqdgaetktDMKLKLAGFDMIVRNVLGIqinaqrnprmyl
meqlqmgqgiltnvntevwKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLgiqinaqrnprmyl
MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQINAQRNPRMYL
********GILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQIN*********
MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQI*AQ*******
MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQINAQRNPRMYL
**QLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQINAQRN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQINAQRNPRMYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q27589 501 Cytochrome P450 4d2 OS=Dr yes N/A 0.875 0.167 0.354 2e-10
P29981 511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.854 0.160 0.345 9e-09
Q9W011 510 Probable cytochrome P450 no N/A 0.875 0.164 0.348 6e-08
O46051 507 Probable cytochrome P450 no N/A 0.864 0.163 0.326 6e-08
Q964T1 501 Cytochrome P450 4c21 OS=B N/A N/A 0.854 0.163 0.345 8e-08
Q9VS79 463 Cytochrome P450 4d8 OS=Dr no N/A 0.875 0.181 0.325 9e-08
Q9VA27 535 Cytochrome P450 4c3 OS=Dr no N/A 0.864 0.155 0.367 1e-07
O46054 496 Cytochrome P450 4ae1 OS=D no N/A 0.864 0.167 0.321 1e-07
Q9DBW0 525 Cytochrome P450 4V2 OS=Mu yes N/A 0.906 0.165 0.325 2e-07
A2RRT9 525 Cytochrome P450 4V2 OS=Ra yes N/A 0.906 0.165 0.314 2e-07
>sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 9/93 (9%)

Query: 6   MGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKT 65
           +G G+L +   + W  +RKI+TPTFHFKIL  +++ F ++S ++     E+ Q  A+ KT
Sbjct: 110 LGDGLLMSTGRK-WHGRRKIITPTFHFKILEQFVEIFDQQSAVMV----EQLQSRADGKT 164

Query: 66  DMK----LKLAGFDMIVRNVLGIQINAQRNPRM 94
            +     + L   D+I    +G +INAQ+NP +
Sbjct: 165 PINIFPVICLTALDIIAETAMGTKINAQKNPNL 197
Involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 Back     alignment and function description
>sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 Back     alignment and function description
>sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 Back     alignment and function description
>sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 Back     alignment and function description
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 Back     alignment and function description
>sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
321477429 509 hypothetical protein DAPPUDRAFT_311386 [ 0.937 0.176 0.368 2e-11
156356324 509 predicted protein [Nematostella vectensi 0.875 0.165 0.395 2e-11
347963151 509 AGAP013490-PA [Anopheles gambiae str. PE 0.927 0.174 0.4 3e-11
347963149 514 AGAP000088-PA [Anopheles gambiae str. PE 0.895 0.167 0.413 3e-11
321477430 511 hypothetical protein DAPPUDRAFT_311385 [ 0.937 0.176 0.368 3e-11
321477269 428 hypothetical protein DAPPUDRAFT_311767 [ 0.864 0.193 0.409 4e-11
321477432 563 hypothetical protein DAPPUDRAFT_311383 [ 0.927 0.158 0.372 4e-11
321477431 509 hypothetical protein DAPPUDRAFT_42144 [D 0.937 0.176 0.368 4e-11
321477275 399 hypothetical protein DAPPUDRAFT_42067 [D 0.906 0.218 0.372 1e-10
321477428 507 hypothetical protein DAPPUDRAFT_311387 [ 0.937 0.177 0.368 1e-10
>gi|321477429|gb|EFX88388.1| hypothetical protein DAPPUDRAFT_311386 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 59/95 (62%), Gaps = 5/95 (5%)

Query: 6   MGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKT 65
           +GQG+L + + ++W+ +RK+LTP FHF IL+S+++ F E+S++LC II +  Q  A+ K 
Sbjct: 119 LGQGLLIS-SGDLWRSRRKLLTPAFHFSILNSFVEVFNEQSRILCGIIGDICQSFADGKG 177

Query: 66  DMK----LKLAGFDMIVRNVLGIQINAQRNPRMYL 96
           +M     +     D+I    +G +INAQ     Y+
Sbjct: 178 EMDVYPLITRCSLDIICEAAMGTKINAQTETSDYI 212

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156356324|ref|XP_001623876.1| predicted protein [Nematostella vectensis] gi|156210614|gb|EDO31776.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|347963151|ref|XP_003436913.1| AGAP013490-PA [Anopheles gambiae str. PEST] gi|333467339|gb|EGK96536.1| AGAP013490-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347963149|ref|XP_311064.5| AGAP000088-PA [Anopheles gambiae str. PEST] gi|333467340|gb|EAA06312.5| AGAP000088-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|321477430|gb|EFX88389.1| hypothetical protein DAPPUDRAFT_311385 [Daphnia pulex] Back     alignment and taxonomy information
>gi|321477269|gb|EFX88228.1| hypothetical protein DAPPUDRAFT_311767 [Daphnia pulex] Back     alignment and taxonomy information
>gi|321477432|gb|EFX88391.1| hypothetical protein DAPPUDRAFT_311383 [Daphnia pulex] Back     alignment and taxonomy information
>gi|321477431|gb|EFX88390.1| hypothetical protein DAPPUDRAFT_42144 [Daphnia pulex] Back     alignment and taxonomy information
>gi|321477275|gb|EFX88234.1| hypothetical protein DAPPUDRAFT_42067 [Daphnia pulex] Back     alignment and taxonomy information
>gi|321477428|gb|EFX88387.1| hypothetical protein DAPPUDRAFT_311387 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0011576 501 Cyp4d2 "Cytochrome P450-4d2" [ 0.875 0.167 0.354 1.9e-10
FB|FBgn0035344 510 Cyp4d20 "Cyp4d20" [Drosophila 0.875 0.164 0.348 4.9e-09
WB|WBGene00011830 503 cyp-29A2 [Caenorhabditis elega 0.895 0.170 0.348 7.9e-09
WB|WBGene00009226 509 cyp-37B1 [Caenorhabditis elega 0.885 0.166 0.313 1e-08
FB|FBgn0023541 507 Cyp4d14 "Cyp4d14" [Drosophila 0.885 0.167 0.344 1.3e-08
ZFIN|ZDB-GENE-061103-88 510 cyp4v7 "cytochrome P450, famil 0.875 0.164 0.337 1.7e-08
WB|WBGene00016147 529 cyp-32A1 [Caenorhabditis elega 0.854 0.155 0.369 1.8e-08
WB|WBGene00013585 511 cyp-42A1 [Caenorhabditis elega 0.916 0.172 0.340 2.2e-08
FB|FBgn0015033 463 Cyp4d8 "Cytochrome P450-4d8" [ 0.875 0.181 0.325 2.4e-08
ZFIN|ZDB-GENE-061103-601 513 cyp4v8 "cytochrome P450, famil 0.875 0.163 0.325 2.8e-08
FB|FBgn0011576 Cyp4d2 "Cytochrome P450-4d2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 1.9e-10, P = 1.9e-10
 Identities = 33/93 (35%), Positives = 55/93 (59%)

Query:     6 MGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKT 65
             +G G+L +   + W  +RKI+TPTFHFKIL  +++ F ++S ++     E+ Q  A+ KT
Sbjct:   110 LGDGLLMSTGRK-WHGRRKIITPTFHFKILEQFVEIFDQQSAVMV----EQLQSRADGKT 164

Query:    66 DMKLK----LAGFDMIVRNVLGIQINAQRNPRM 94
              + +     L   D+I    +G +INAQ+NP +
Sbjct:   165 PINIFPVICLTALDIIAETAMGTKINAQKNPNL 197
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00011830 cyp-29A2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00009226 cyp-37B1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016147 cyp-32A1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00013585 cyp-42A1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-601 cyp4v8 "cytochrome P450, family 4, subfamily V, polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam00067 461 pfam00067, p450, Cytochrome P450 5e-08
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-05
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 48.4 bits (116), Expect = 5e-08
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 5/93 (5%)

Query: 3   QLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAE 62
              +G+GI+   N   W++ R+ LTPTF      S+     EE++ L   +R+ A  G  
Sbjct: 80  GPFLGKGIV-FANGPRWRQLRRFLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTA--GEP 136

Query: 63  TKTDMK--LKLAGFDMIVRNVLGIQINAQRNPR 93
              D+   L  A  ++I   + G +  +  +P+
Sbjct: 137 GVIDITDLLFRAALNVICSILFGERFGSLEDPK 169

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG0158|consensus 499 99.57
PLN02738 633 carotene beta-ring hydroxylase 99.56
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.5
PLN02936 489 epsilon-ring hydroxylase 99.5
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.5
PLN02290 516 cytokinin trans-hydroxylase 99.49
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.47
PTZ00404 482 cytochrome P450; Provisional 99.47
KOG0157|consensus 497 99.41
PLN02687 517 flavonoid 3'-monooxygenase 99.35
PLN02394 503 trans-cinnamate 4-monooxygenase 99.28
PLN02966 502 cytochrome P450 83A1 99.28
PLN02971 543 tryptophan N-hydroxylase 99.23
PLN03234 499 cytochrome P450 83B1; Provisional 99.23
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.22
KOG0159|consensus 519 99.22
PLN02648 480 allene oxide synthase 99.21
PLN03112 514 cytochrome P450 family protein; Provisional 99.21
PLN00168 519 Cytochrome P450; Provisional 99.2
KOG0156|consensus 489 99.19
PLN02500 490 cytochrome P450 90B1 99.16
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.15
PLN03018 534 homomethionine N-hydroxylase 99.15
PLN02183 516 ferulate 5-hydroxylase 99.12
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.12
PLN02196 463 abscisic acid 8'-hydroxylase 99.1
PLN02302 490 ent-kaurenoic acid oxidase 99.04
PLN02655 466 ent-kaurene oxidase 98.99
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.94
PLN02774 463 brassinosteroid-6-oxidase 98.91
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.5
KOG0684|consensus 486 94.52
KOG4128|consensus 457 82.14
>KOG0158|consensus Back     alignment and domain information 
Probab=99.57  E-value=1.8e-14  Score=92.07  Aligned_cols=84  Identities=24%  Similarity=0.350  Sum_probs=75.2

Q ss_pred             cccccccCCchHHHhhhhcCCCCChHHHhhHHHHHHHHHHHHHHHHHHHhhcCCccchhHHHHHHHHHHHHHHHhccccc
Q psy6577           8 QGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGIQIN   87 (96)
Q Consensus         8 ~~~~~~~~g~~~~~~R~~~~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~vi~~~~fG~~~~   87 (96)
                      .++++ +.|+.||.+|..++|.|+..+++.+.+.+.+.+.++++.+++....+..+++.+.+..+|.|||++++||.+.+
T Consensus       116 ~~Lf~-~~g~~WK~lR~~lsP~Fts~kmk~m~~t~~~~~~~l~~~l~~~~~~~~~~~~~dl~~~yT~DVI~~~AfG~~~~  194 (499)
T KOG0158|consen  116 LNLFF-LRGERWKRLRTKLSPTFTSGKLKKMFPTMEEVGDELVRHLRRKSEGGQEGEIKDLCARYTTDVIGSCAFGLDAN  194 (499)
T ss_pred             cCchh-ccCchHHHHHHhhccccchhhHHHHHHHHHHHHHHHHHHHHHhhcccCCccHHHHHHHHHHHHHhHhhcccchh
Confidence            56777 89999999999999999999999999999999999999999864333578999999999999999999999998


Q ss_pred             CCcCC
Q psy6577          88 AQRNP   92 (96)
Q Consensus        88 ~~~~~   92 (96)
                      .+.++
T Consensus       195 s~~d~  199 (499)
T KOG0158|consen  195 SLRDP  199 (499)
T ss_pred             hhcCc
Confidence            77644

>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>KOG4128|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-04
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
Query: 7   GQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTD 66
           GQG+++  N E W KQR+++   F    L S ++ F E+++ L  I+  EA+   +T   
Sbjct: 74  GQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEIL--EAKADGQTPVS 131
Query: 67  MK--LKLAGFDMIVRNVLGIQ 85
           M+  L     D++ +   G++
Sbjct: 132 MQDMLTYTAMDILAKAAFGME 152

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-19
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-18
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-13
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-13
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 8e-13
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 8e-12
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 6e-11
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-10
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-08
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 8e-07
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-06
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 7e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 6e-05
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-04
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-04
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score = 79.6 bits (197), Expect = 3e-19
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 6   MGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKT 65
            GQG+++  N E W KQR+++   F    L S ++ F E+++ L  I+  +A        
Sbjct: 73  FGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTP--V 130

Query: 66  DMK--LKLAGFDMIVRNVLGIQINAQRNP 92
            M+  L     D++ +   G++ +     
Sbjct: 131 SMQDMLTYTAMDILAKAAFGMETSMLLGA 159
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.61
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.56
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.47
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.45
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.41
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.41
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.33
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.32
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.31
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.3
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.29
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.29
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.27
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.27
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.27
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.26
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.26
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.25
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.25
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.25
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.24
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.24
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.24
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.23
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.22
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.22
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.22
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.22
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.21
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.21
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.21
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.21
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.21
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.21
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.2
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.19
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.19
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.18
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.18
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.17
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.17
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.16
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.16
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.15
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.15
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.14
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.14
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.13
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.13
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.12
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.12
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.12
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.11
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.11
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.11
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.11
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.09
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.08
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.06
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.05
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.05
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.03
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.97
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 98.89
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.89
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.85
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.79
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.75
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 98.73
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.7
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.64
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 98.59
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 98.51
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 98.25
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 97.7
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 97.53
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 94.35
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.61  E-value=3.5e-15  Score=93.81  Aligned_cols=86  Identities=24%  Similarity=0.405  Sum_probs=77.5

Q ss_pred             ccccccccccCCchHHHhhhhcCCCCChHHHhhHHHHHHHHHHHHHHHHHHHhhcCCccchhHHHHHHHHHHHHHHHhcc
Q psy6577           5 QMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVLGI   84 (96)
Q Consensus         5 ~~~~~~~~~~~g~~~~~~R~~~~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~vi~~~~fG~   84 (96)
                      +++.++++ .+|+.|+++|+++.++|++++++.+.+.+.+.+..+++.+......+.++|+.+.+..+++|+|+.++||.
T Consensus        91 ~~~~~l~~-~~g~~w~~~R~~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~g~~~d~~~~~~~~~~dvi~~~~fG~  169 (485)
T 3nxu_A           91 FMKSAISI-AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGV  169 (485)
T ss_dssp             GGGGSTTT-CCHHHHHHHHHHHGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEHHHHHHHHHHHHHHHHHHSC
T ss_pred             ccccCccc-cCCcHHHHHHhhcChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcCcHHHHHHHHHHHHHHHHHcCC
Confidence            34567778 89999999999999999999999999999999999999998765567899999999999999999999999


Q ss_pred             cccCCcC
Q psy6577          85 QINAQRN   91 (96)
Q Consensus        85 ~~~~~~~   91 (96)
                      +++.+++
T Consensus       170 ~~~~~~~  176 (485)
T 3nxu_A          170 NIDSLNN  176 (485)
T ss_dssp             CCCGGGC
T ss_pred             ccccccC
Confidence            9976543
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-07
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-04
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 0.001
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 0.003
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 20/96 (20%), Positives = 37/96 (38%)

Query: 1   MEQLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDG 60
              +   +  ++    E WK+ R +L+PTF    L   +    +   +L   +R EA+ G
Sbjct: 81  FGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG 140

Query: 61  AETKTDMKLKLAGFDMIVRNVLGIQINAQRNPRMYL 96
                         D+I     G+ I++  NP+   
Sbjct: 141 KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPF 176
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.58
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.47
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.43
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.18
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.13
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.11
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.03
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.0
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 98.93
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.9
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.88
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.84
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.81
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.79
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.65
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.65
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.47
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.31
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.18
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.11
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 97.91
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cyp175a1
species: Thermus thermophilus [TaxId: 274]

Probab=99.58  E-value=1.2e-15  Score=92.54  Aligned_cols=80  Identities=25%  Similarity=0.378  Sum_probs=73.1

Q ss_pred             ccccccccccccCCchHHHhhhhcCCCCChHHHhhHHHHHHHHHHHHHHHHHHHhhcCCccchhHHHHHHHHHHHHHHHh
Q psy6577           3 QLQMGQGILTNVNTEVWKKQRKILTPTFHFKILHSYIQYFYEESQLLCNIIREEAQDGAETKTDMKLKLAGFDMIVRNVL   82 (96)
Q Consensus         3 ~~~~~~~~~~~~~g~~~~~~R~~~~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~vi~~~~f   82 (96)
                      .+++|+|+++ ++|+.|+++|++++++|+++.++.+.+.+.+.+.+++++|     +++++|+.+.+..+++++++.++|
T Consensus        72 ~~~~G~gl~~-~~g~~wk~~R~~l~~~f~~~~l~~~~~~~~~~~~~l~~~l-----~~~~vdl~~~l~~~~~~vi~~~~f  145 (385)
T d1n97a_          72 SRLTGRGLLT-DWGESWKEARKALKDPFLPKNVRGYREAMEEEARAFFGEW-----RGEERDLDHEMLALSLRLLGRALF  145 (385)
T ss_dssp             HHHHCSSTTT-CCHHHHHHHHHHHCGGGSHHHHHTTHHHHHHHHHHHHHTC-----CSCCEEHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhCCceec-CCHHHHHHHHHHHhhhhcccccccchhhHHHHHHHHHhhc-----cccchhHHHHHHHHhhhhhhhhhh
Confidence            4678999999 9999999999999999999999999999999999998877     356899999999999999999999


Q ss_pred             cccccC
Q psy6577          83 GIQINA   88 (96)
Q Consensus        83 G~~~~~   88 (96)
                      |.+++.
T Consensus       146 g~~~~~  151 (385)
T d1n97a_         146 GKPLSP  151 (385)
T ss_dssp             SSCCCH
T ss_pred             cccccc
Confidence            998754
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure