Psyllid ID: psy6603

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPCTLDSEQQQQNT
cccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHHHHccc
cccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHcHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHcccc
kcyehkqykNGLKFAKQIltnpkyaehgetLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGllqrsdkkYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTqqvtnsydfEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYIskypkatvpkrlslnyvsgdqFRTEIDKYLRhgfhkgvpplfVNLRslysntekCKIIQDLVESYVEALSktghfslqdegevepASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDeaqsldtadRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGrwgdtlkkCHEVDRKCYEHKQYKNGLKFAKQIltnpkyaehgetLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGllqrsdkkYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLgrwgdtlkkchEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDvlrshpfyyTAARCAIQVYLRlhdrpctldseqqqqnt
kcyehkqyknglkfaKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGlrndlkshvCWHVYGllqrsdkkydEAIKCYRNalkwehdnIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKeqihdkltvEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKypkatvpkrlslnYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGlrndlkshvCWHVYGllqrsdkkydEAIKCYRNalkwehdnIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPCtldseqqqqnt
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPCTLDSEQQQQNT
*******YKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPC***********
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHD**************
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPCT**********
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSL****EVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDR*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKxxxxxxxxxxxxxxxxxxxxxTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRPCTLDSEQQQQNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query724 2.2.26 [Sep-21-2011]
Q6N069 864 N-alpha-acetyltransferase yes N/A 0.687 0.576 0.663 0.0
Q9BXJ9 866 N-alpha-acetyltransferase no N/A 0.682 0.570 0.650 0.0
Q5R4J9 866 N-alpha-acetyltransferase yes N/A 0.682 0.570 0.648 0.0
Q9DBB4 864 N-alpha-acetyltransferase no N/A 0.682 0.571 0.644 0.0
Q80UM3 865 N-alpha-acetyltransferase yes N/A 0.682 0.571 0.642 0.0
O74985729 N-terminal acetyltransfer yes N/A 0.676 0.672 0.413 1e-106
P12945 854 N-terminal acetyltransfer yes N/A 0.820 0.695 0.309 5e-65
Q9Y7X2695 N-terminal acetyltransfer no N/A 0.603 0.628 0.250 9e-22
>sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 Back     alignment and function desciption
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/499 (66%), Positives = 401/499 (80%), Gaps = 1/499 (0%)

Query: 1   KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLK 60
           KCYE KQYKNGLKF K IL+NPK+AEHGETLAMKGLTLNCLG+KEEAYE+VR+GLRND+K
Sbjct: 19  KCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEAYEFVRKGLRNDVK 78

Query: 61  SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRY 120
           SHVCWHVYGLLQRSDKKYDEAIKCYRNALK + DN+QI+RDLSLLQIQMRDLEGYRETRY
Sbjct: 79  SHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQIQMRDLEGYRETRY 138

Query: 121 QLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVT-NSYDFEHSELLLYQSM 179
           QL  LRPTQRASWIG+A+AYHLL D+DMA  +LE FR+TQQV  N  D+E+SEL+LYQ+ 
Sbjct: 139 QLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQVPPNKIDYEYSELILYQNQ 198

Query: 180 VIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENT 239
           V++++  L+E+++H++ +++QI DKL VEE  G + LKLG+  EA + +++LI+RN EN 
Sbjct: 199 VMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEASEVFKNLIDRNAENW 258

Query: 240 LYYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGF 299
            YY  L +A Q++  ++  Q+      ++PKA  P+RL L  V G++FR  +DK+LR  F
Sbjct: 259 CYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTLVPGERFRELMDKFLRVNF 318

Query: 300 HKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYH 359
            KG PPLF  L+SLY NTEK  IIQ+LV +Y  +L     FS  + GE EP + LLWV +
Sbjct: 319 SKGCPPLFTTLKSLYYNTEKVSIIQELVTNYEASLKTCDFFSPYENGEKEPPTTLLWVQY 378

Query: 360 YLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLD 419
           +LAQH+D LG    AL+YINAAI  TPTLIELF  K +IYKH G++ EA KW+DEAQSLD
Sbjct: 379 FLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKHIGNLKEAAKWMDEAQSLD 438

Query: 420 TADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRL 479
           TADR+INSKCAKYMLRAN+IKEAEE CSKFTREG SAMENLNEMQCMWFQTEC  AYQRL
Sbjct: 439 TADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMENLNEMQCMWFQTECISAYQRL 498

Query: 480 GRWGDTLKKCHEVDRKCYE 498
           GR+GD LKKCHEV+R  +E
Sbjct: 499 GRYGDALKKCHEVERHFFE 517
May belong to a complex displaying N-terminal acetyltransferase activity.
Homo sapiens (taxid: 9606)
>sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 Back     alignment and function description
>sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 Back     alignment and function description
>sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=3 SV=1 Back     alignment and function description
>sp|P12945|NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y7X2|YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC418.02 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query724
328709154 868 PREDICTED: n-alpha-acetyltransferase 16, 0.675 0.563 0.759 0.0
242006724 867 NMDA receptor-regulated protein, putativ 0.680 0.568 0.749 0.0
91081191 863 PREDICTED: similar to AGAP002284-PA [Tri 0.682 0.572 0.727 0.0
380019989 856 PREDICTED: N-alpha-acetyltransferase 15, 0.679 0.574 0.729 0.0
350417201 856 PREDICTED: N-alpha-acetyltransferase 15, 0.679 0.574 0.727 0.0
340715008 856 PREDICTED: n-alpha-acetyltransferase 15, 0.679 0.574 0.727 0.0
66511128 856 PREDICTED: n-alpha-acetyltransferase 15, 0.679 0.574 0.727 0.0
383855588 861 PREDICTED: N-alpha-acetyltransferase 15, 0.679 0.571 0.721 0.0
332025341605 NMDA receptor-regulated protein 1 [Acrom 0.679 0.813 0.725 0.0
322794628583 hypothetical protein SINV_12886 [Solenop 0.679 0.843 0.725 0.0
>gi|328709154|ref|XP_001949207.2| PREDICTED: n-alpha-acetyltransferase 16, NatA auxiliary subunit-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/494 (75%), Positives = 423/494 (85%)

Query: 1   KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLK 60
           +CYE KQYKNGLKFAKQIL++PK++EHGETLAMKGLTLN LGRK+EAYE+VRRGLRNDL 
Sbjct: 20  RCYEQKQYKNGLKFAKQILSHPKFSEHGETLAMKGLTLNFLGRKDEAYEHVRRGLRNDLT 79

Query: 61  SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRY 120
           SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWE DNIQI+RDLSLLQIQMRDLEGYR+TRY
Sbjct: 80  SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEKDNIQILRDLSLLQIQMRDLEGYRDTRY 139

Query: 121 QLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMV 180
           QLFMLRPTQRASWIG+AMAYHLL+D DMA  ILE FRKTQ V+  +DFE+SELLLYQ+MV
Sbjct: 140 QLFMLRPTQRASWIGYAMAYHLLNDHDMALKILETFRKTQMVSAPFDFEYSELLLYQNMV 199

Query: 181 IQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTL 240
           IQ+SG + +A+KHLD +KE I DKLTV E YG+L L++G+Y+ A   YE L+ RNQENT 
Sbjct: 200 IQESGGVLDAIKHLDMYKENIFDKLTVLEIYGSLYLQMGEYHLATLCYEKLLRRNQENTP 259

Query: 241 YYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFH 300
           YY  + EAKQL N++ ++ +L  Y  K+PKA  PKRL L + SG+ F++EID YLR GFH
Sbjct: 260 YYLMIKEAKQLHNDECVYNMLCGYRKKFPKALAPKRLCLTFASGNAFQSEIDSYLRAGFH 319

Query: 301 KGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHY 360
           KGVPPLFV+LRSLY N  K +II+ L+E YV  L+K   F  +D    EPASALLWVYHY
Sbjct: 320 KGVPPLFVDLRSLYKNKHKVQIIESLLEMYVNNLTKFSSFDSEDTSCKEPASALLWVYHY 379

Query: 361 LAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDT 420
           LAQHYD+L D  KAL YI+ AI HTPTLIELFVTKGRI+KHAGD  EAYKWLDEAQ LDT
Sbjct: 380 LAQHYDYLDDIQKALTYIDMAIAHTPTLIELFVTKGRIFKHAGDAYEAYKWLDEAQGLDT 439

Query: 421 ADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLG 480
           ADRYINSKCAKYMLRANLIKEAEETCSKFTREGVS MENLNEMQCMWFQTECALAYQRLG
Sbjct: 440 ADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSPMENLNEMQCMWFQTECALAYQRLG 499

Query: 481 RWGDTLKKCHEVDR 494
           +WGD+LKKCHEVDR
Sbjct: 500 KWGDSLKKCHEVDR 513

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242006724|ref|XP_002424197.1| NMDA receptor-regulated protein, putative [Pediculus humanus corporis] gi|212507538|gb|EEB11459.1| NMDA receptor-regulated protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91081191|ref|XP_975602.1| PREDICTED: similar to AGAP002284-PA [Tribolium castaneum] gi|270006047|gb|EFA02495.1| hypothetical protein TcasGA2_TC008190 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380019989|ref|XP_003693881.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|350417201|ref|XP_003491306.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715008|ref|XP_003396013.1| PREDICTED: n-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66511128|ref|XP_394637.2| PREDICTED: n-alpha-acetyltransferase 15, NatA auxiliary subunit-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383855588|ref|XP_003703292.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332025341|gb|EGI65509.1| NMDA receptor-regulated protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322794628|gb|EFZ17636.1| hypothetical protein SINV_12886 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query724
FB|FBgn0031020 890 Nat1 "Nat1" [Drosophila melano 0.682 0.555 0.663 2.4e-236
MGI|MGI:1914147 864 Naa16 "N(alpha)-acetyltransfer 0.687 0.576 0.641 1.5e-223
UNIPROTKB|F1NVR6 852 NAA15 "Uncharacterized protein 0.687 0.584 0.646 1.9e-223
UNIPROTKB|Q9BXJ9 866 NAA15 "N-alpha-acetyltransfera 0.687 0.575 0.647 2.4e-223
UNIPROTKB|F1N4V5 866 NAA15 "Uncharacterized protein 0.687 0.575 0.647 3.1e-223
MGI|MGI:1922088 865 Naa15 "N(alpha)-acetyltransfer 0.687 0.575 0.639 1.2e-221
RGD|1310984 865 Naa15 "N(alpha)-acetyltransfer 0.687 0.575 0.639 1.2e-221
UNIPROTKB|F1RRD3 868 NAA15 "Uncharacterized protein 0.687 0.573 0.644 1.2e-221
UNIPROTKB|Q6N069 864 NAA16 "N-alpha-acetyltransfera 0.687 0.576 0.663 3.8e-181
WB|WBGene00021754852 hpo-29 [Caenorhabditis elegans 0.679 0.577 0.454 7.3e-152
FB|FBgn0031020 Nat1 "Nat1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1798 (638.0 bits), Expect = 2.4e-236, Sum P(2) = 2.4e-236
 Identities = 330/497 (66%), Positives = 407/497 (81%)

Query:     1 KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLK 60
             KCYE KQYKNGLK AKQIL+NPKY EHGETLAMKGLTLN LGR+EEAY+YVR GLRNDL+
Sbjct:    20 KCYELKQYKNGLKLAKQILSNPKYMEHGETLAMKGLTLNGLGRREEAYKYVRLGLRNDLR 79

Query:    61 SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRY 120
             SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWE DN+QI++DLSLLQIQMRDLEGY+ETR+
Sbjct:    80 SHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEKDNLQILKDLSLLQIQMRDLEGYKETRH 139

Query:   121 QLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMV 180
              LF LRP+Q ASWIGFAM+YHLL D+DMA +ILE F ++Q    ++D+ HSELLLYQ+ +
Sbjct:   140 HLFTLRPSQHASWIGFAMSYHLLGDYDMANSILETFSQSQTSIEAHDYRHSELLLYQNQI 199

Query:   181 IQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTL 240
             + +S  L++AV HL +++ QI DKL V ET G L +KL Q  +A+  +ESLI RN EN L
Sbjct:   200 LIESNRLQQAVDHLTKYQGQIVDKLAVRETMGDLYIKLQQQEKAVPIFESLIRRNPENVL 259

Query:   241 YYNKLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFH 300
             YY + + A+Q+T++  +  +   +  +YP+A  P+RL LN  +GD+FR   D+YLR G  
Sbjct:   260 YYEQYIAARQVTDSSAVVSIYRVFQEQYPRALCPRRLPLNIANGDEFRVVTDEYLRRGLR 319

Query:   301 KGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGE---VEPASALLWV 357
             KG+PPLFVN+R+L+   E+  +I++L   Y E L+++GHFS +D      VEPASAL+W 
Sbjct:   320 KGIPPLFVNVRTLHQIPERAAVIEELALQYFENLTRSGHFSREDADAGIPVEPASALVWT 379

Query:   358 YHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQS 417
               +LAQHYD++ DT +AL YIN AIDHTPTLIEL +TKGRI+KHAGD +EAY WL+EAQS
Sbjct:   380 ALFLAQHYDYMRDTDRALEYINVAIDHTPTLIELLITKGRIFKHAGDPVEAYVWLEEAQS 439

Query:   418 LDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQ 477
             +DTADRYINSKCAKYMLRAN+++EAEE C+KFTREGVSAM+NLNEMQCMWFQTECALAYQ
Sbjct:   440 MDTADRYINSKCAKYMLRANMVQEAEEICAKFTREGVSAMDNLNEMQCMWFQTECALAYQ 499

Query:   478 RLGRWGDTLKKCHEVDR 494
             R+GRWG++LKKCHEV+R
Sbjct:   500 RMGRWGESLKKCHEVER 516
GO:0004596 "peptide alpha-N-acetyltransferase activity" evidence=ISS
GO:0072686 "mitotic spindle" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
MGI|MGI:1914147 Naa16 "N(alpha)-acetyltransferase 16, NatA auxiliary subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVR6 NAA15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXJ9 NAA15 "N-alpha-acetyltransferase 15, NatA auxiliary subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4V5 NAA15 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1922088 Naa15 "N(alpha)-acetyltransferase 15, NatA auxiliary subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310984 Naa15 "N(alpha)-acetyltransferase 15, NatA auxiliary subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRD3 NAA15 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6N069 NAA16 "N-alpha-acetyltransferase 16, NatA auxiliary subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00021754 hpo-29 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74985NAT1_SCHPONo assigned EC number0.41350.67670.6721yesN/A
Q80UM3NAA15_MOUSENo assigned EC number0.64240.68230.5710yesN/A
P12945NAT1_YEASTNo assigned EC number0.30980.82040.6955yesN/A
Q6N069NAA16_HUMANNo assigned EC number0.66330.68780.5763yesN/A
Q5R4J9NAA15_PONABNo assigned EC number0.64840.68230.5704yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query724
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-159
pfam12569 516 pfam12569, NARP1, NMDA receptor-regulated protein 8e-58
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information 
 Score =  469 bits (1210), Expect = e-159
 Identities = 171/332 (51%), Positives = 233/332 (70%), Gaps = 5/332 (1%)

Query: 168 FEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKH 227
           +EHSELLLY++ +I++SGDLEEA++HL+  ++QI D+L V E    L LKLG+  EA   
Sbjct: 1   YEHSELLLYKNSLIEESGDLEEALEHLEEKEKQIVDRLAVMEMRADLLLKLGRKEEAEAT 60

Query: 228 YESLIERNQENTLYYNKLVEAKQLT----NNDDIFQLLTHYISKYPKATVPKRLSLNYVS 283
           Y +L++RN EN  YY  L +A  L     + + +  L      KYP++  P+RL L+++ 
Sbjct: 61  YRALLDRNPENYDYYEGLQKALGLEISSGDIEALLALYDELAEKYPRSDAPRRLPLDFLE 120

Query: 284 GDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQ 343
           GD+F+   D YLR    KGVP LF +L+SLYS++EK  I+++LVE YV +L  +G FS  
Sbjct: 121 GDEFKELADAYLRRMLRKGVPSLFADLKSLYSDSEKVDILEELVEGYVSSLKSSGSFSGS 180

Query: 344 DEG-EVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHA 402
           D   E EP S LLW  ++LAQHYD+LG   KAL YI+ AI+HTPTL+EL++TK RI KHA
Sbjct: 181 DSNSEKEPPSTLLWTLYFLAQHYDYLGSRDKALEYIDKAIEHTPTLVELYMTKARILKHA 240

Query: 403 GDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNE 462
           GD+ +A + ++EA+SLD ADRYINSKCAKYMLRAN  +EAE+T S FTR+G   + +LN+
Sbjct: 241 GDLQKAAEAMEEARSLDLADRYINSKCAKYMLRANENEEAEKTASLFTRDGTGPLADLND 300

Query: 463 MQCMWFQTECALAYQRLGRWGDTLKKCHEVDR 494
           MQCMWF TE   AYQR G++G  LK+ H V++
Sbjct: 301 MQCMWFLTEDGEAYQRQGKYGLALKRFHAVEK 332

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam07719, pfam00515. There is a single completely conserved residue L that may be functionally important. NARP1 is the mammalian homologue of a yeast N-terminal acetyltransferase that regulates entry into the G(0) phase of the cell cycle. Length = 516
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 724
KOG1156|consensus 700 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
KOG4626|consensus 966 100.0
KOG4626|consensus 966 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG2002|consensus 1018 100.0
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 100.0
KOG2002|consensus 1018 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK10049765 pgaA outer membrane protein PgaA; Provisional 100.0
KOG2076|consensus895 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
KOG0547|consensus606 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PRK14574 822 hmsH outer membrane protein; Provisional 99.98
KOG0547|consensus606 99.98
KOG0495|consensus913 99.97
KOG2076|consensus895 99.97
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.97
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN032181060 maturation of RBCL 1; Provisional 99.96
KOG1173|consensus611 99.96
KOG0548|consensus539 99.96
PRK14574 822 hmsH outer membrane protein; Provisional 99.96
KOG0495|consensus913 99.96
PLN03218 1060 maturation of RBCL 1; Provisional 99.96
KOG1127|consensus 1238 99.96
KOG2003|consensus840 99.95
KOG2003|consensus840 99.95
KOG1155|consensus559 99.95
KOG1127|consensus1238 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
KOG1126|consensus638 99.94
KOG0548|consensus539 99.94
KOG0624|consensus504 99.94
KOG1126|consensus638 99.94
KOG1155|consensus559 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.94
KOG0624|consensus504 99.94
KOG1173|consensus611 99.93
KOG1915|consensus677 99.92
KOG4162|consensus799 99.92
KOG4162|consensus799 99.9
KOG1915|consensus677 99.9
KOG1156|consensus 700 99.89
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.89
KOG1174|consensus564 99.88
KOG1174|consensus564 99.88
PRK11189296 lipoprotein NlpI; Provisional 99.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
KOG3785|consensus557 99.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.87
KOG2376|consensus652 99.87
KOG1129|consensus478 99.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.86
PRK12370553 invasion protein regulator; Provisional 99.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.86
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
KOG1125|consensus579 99.85
PRK12370553 invasion protein regulator; Provisional 99.84
KOG1129|consensus478 99.84
KOG0550|consensus486 99.83
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.82
KOG1125|consensus579 99.82
KOG0550|consensus486 99.82
PRK11189296 lipoprotein NlpI; Provisional 99.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.81
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.81
KOG3785|consensus557 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
PLN02789320 farnesyltranstransferase 99.78
KOG2047|consensus 835 99.78
KOG1840|consensus508 99.77
PLN02789320 farnesyltranstransferase 99.77
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.76
KOG2376|consensus652 99.76
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.76
KOG1840|consensus508 99.74
KOG2047|consensus 835 99.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.71
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.69
KOG4340|consensus459 99.64
PRK15359144 type III secretion system chaperone protein SscB; 99.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.63
KOG3060|consensus289 99.59
KOG2053|consensus 932 99.59
PRK15359144 type III secretion system chaperone protein SscB; 99.57
KOG4340|consensus459 99.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.55
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.54
PRK10370198 formate-dependent nitrite reductase complex subuni 99.53
PRK10370198 formate-dependent nitrite reductase complex subuni 99.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.5
KOG3060|consensus289 99.5
KOG1130|consensus639 99.5
KOG1130|consensus 639 99.49
PRK04841903 transcriptional regulator MalT; Provisional 99.48
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.47
PRK04841903 transcriptional regulator MalT; Provisional 99.47
KOG0553|consensus304 99.44
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.44
KOG1128|consensus777 99.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.43
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.4
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.39
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.37
KOG1128|consensus777 99.36
KOG3617|consensus1416 99.36
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.34
KOG0553|consensus304 99.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.32
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.3
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.29
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.27
KOG2300|consensus629 99.24
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.23
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.2
KOG3616|consensus 1636 99.2
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.16
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.15
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.15
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.15
KOG2053|consensus 932 99.15
COG3898531 Uncharacterized membrane-bound protein [Function u 99.14
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.14
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.13
KOG2300|consensus629 99.13
KOG3617|consensus1416 99.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.11
KOG1941|consensus518 99.1
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.1
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.06
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.06
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.05
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.05
PRK15331165 chaperone protein SicA; Provisional 99.05
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.05
KOG0543|consensus397 99.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.03
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.03
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.02
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.02
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.01
KOG1070|consensus1710 99.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.0
KOG1941|consensus518 98.99
KOG1070|consensus1710 98.99
KOG3081|consensus299 98.98
PRK10803263 tol-pal system protein YbgF; Provisional 98.98
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.95
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.94
PRK11906458 transcriptional regulator; Provisional 98.94
KOG0543|consensus397 98.93
KOG4648|consensus536 98.92
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.92
PRK15331165 chaperone protein SicA; Provisional 98.91
PRK10803263 tol-pal system protein YbgF; Provisional 98.89
PRK11906458 transcriptional regulator; Provisional 98.85
KOG3081|consensus299 98.85
KOG2471|consensus696 98.84
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.84
PF12688120 TPR_5: Tetratrico peptide repeat 98.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.82
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.81
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.79
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.79
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.78
PF1337173 TPR_9: Tetratricopeptide repeat 98.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.76
KOG4234|consensus271 98.76
COG3898531 Uncharacterized membrane-bound protein [Function u 98.75
KOG1914|consensus656 98.74
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.73
PF1337173 TPR_9: Tetratricopeptide repeat 98.72
KOG3616|consensus 1636 98.72
PF12688120 TPR_5: Tetratrico peptide repeat 98.71
PF13512142 TPR_18: Tetratricopeptide repeat 98.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.68
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.67
PF13512142 TPR_18: Tetratricopeptide repeat 98.66
KOG4648|consensus536 98.65
KOG2471|consensus696 98.63
KOG4234|consensus271 98.63
COG4700251 Uncharacterized protein conserved in bacteria cont 98.6
COG4700251 Uncharacterized protein conserved in bacteria cont 98.58
KOG0985|consensus 1666 98.54
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
KOG1586|consensus288 98.52
KOG2796|consensus366 98.51
KOG4555|consensus175 98.49
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.49
KOG0985|consensus1666 98.48
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.45
KOG1585|consensus308 98.44
KOG4555|consensus175 98.38
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.34
KOG1258|consensus577 98.33
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.33
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.33
KOG1586|consensus288 98.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.31
KOG4507|consensus886 98.3
KOG2796|consensus366 98.26
KOG4642|consensus284 98.24
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.23
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.22
KOG2610|consensus491 98.2
PF1342844 TPR_14: Tetratricopeptide repeat 98.19
KOG1914|consensus656 98.17
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.16
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.15
PF1342844 TPR_14: Tetratricopeptide repeat 98.14
KOG4642|consensus284 98.13
KOG2610|consensus491 98.13
KOG0545|consensus329 98.09
PF1343134 TPR_17: Tetratricopeptide repeat 98.06
PF1343134 TPR_17: Tetratricopeptide repeat 98.03
KOG0545|consensus329 98.02
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.01
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.0
KOG0376|consensus476 97.94
KOG1585|consensus308 97.9
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.9
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.86
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.84
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.81
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.8
KOG1550|consensus552 97.8
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.79
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.79
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.78
KOG0530|consensus318 97.76
KOG4507|consensus886 97.75
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.72
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.72
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.65
KOG2396|consensus568 97.65
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.63
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.61
KOG0376|consensus476 97.6
KOG2396|consensus568 97.6
KOG1550|consensus552 97.56
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 97.51
KOG0551|consensus390 97.49
KOG0551|consensus390 97.49
KOG0890|consensus 2382 97.46
KOG1258|consensus577 97.43
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.41
KOG2041|consensus1189 97.4
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.38
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.36
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.34
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.34
KOG0530|consensus318 97.33
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.31
KOG2041|consensus1189 97.27
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.24
KOG1308|consensus377 97.2
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.18
KOG1308|consensus377 97.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.08
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.02
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.0
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.91
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.89
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.88
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.85
KOG0890|consensus 2382 96.82
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.81
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.69
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.69
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.68
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.64
KOG3824|consensus 472 96.63
KOG1538|consensus 1081 96.63
KOG3824|consensus472 96.62
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 96.6
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.54
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.45
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.43
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.33
KOG0128|consensus881 96.31
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.31
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.31
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.28
KOG1464|consensus440 96.26
KOG3783|consensus546 96.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.19
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.18
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.12
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.09
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 96.09
PRK10941269 hypothetical protein; Provisional 96.07
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.05
PRK10941269 hypothetical protein; Provisional 96.04
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.96
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.96
KOG1538|consensus1081 95.93
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.93
KOG1464|consensus440 95.9
KOG3807|consensus 556 95.87
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.82
KOG0128|consensus 881 95.75
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.73
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.66
KOG3364|consensus149 95.6
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 95.55
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 95.49
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.43
KOG2422|consensus 665 95.28
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.27
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.16
KOG3807|consensus556 95.14
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.89
KOG3364|consensus149 94.73
KOG1310|consensus758 94.43
COG5191435 Uncharacterized conserved protein, contains HAT (H 94.42
KOG0276|consensus794 94.39
COG5191435 Uncharacterized conserved protein, contains HAT (H 94.15
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.08
KOG2422|consensus665 93.95
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 93.85
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 93.76
COG2912269 Uncharacterized conserved protein [Function unknow 93.72
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.69
KOG2581|consensus493 93.57
KOG2581|consensus493 93.4
KOG1839|consensus1236 93.36
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.25
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.15
COG3629280 DnrI DNA-binding transcriptional activator of the 93.01
KOG1839|consensus1236 92.97
KOG0529|consensus421 92.78
KOG2062|consensus 929 92.72
KOG1463|consensus411 92.55
COG1747711 Uncharacterized N-terminal domain of the transcrip 92.43
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.4
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.32
COG5159 421 RPN6 26S proteasome regulatory complex component [ 92.22
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.16
KOG1310|consensus 758 92.09
COG3629280 DnrI DNA-binding transcriptional activator of the 91.96
KOG3783|consensus546 91.94
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.76
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.74
KOG1920|consensus 1265 91.69
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.59
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.4
PF1285434 PPR_1: PPR repeat 91.34
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 91.23
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.94
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.94
COG2912269 Uncharacterized conserved protein [Function unknow 90.89
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.82
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.79
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.75
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.74
COG4941415 Predicted RNA polymerase sigma factor containing a 90.72
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.73
KOG4814|consensus872 89.41
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 89.15
PF1285434 PPR_1: PPR repeat 87.99
COG3947361 Response regulator containing CheY-like receiver a 87.22
KOG0546|consensus372 87.14
PF1304150 PPR_2: PPR repeat family 86.67
KOG2114|consensus933 86.17
COG3947361 Response regulator containing CheY-like receiver a 85.9
PF1304150 PPR_2: PPR repeat family 85.84
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.75
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 85.61
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.53
KOG0529|consensus421 85.33
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.23
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 85.03
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 84.7
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.55
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 84.16
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 83.41
KOG0276|consensus794 83.36
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 82.56
KOG1463|consensus411 82.32
KOG2062|consensus 929 82.24
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 82.06
KOG0546|consensus372 81.79
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 81.46
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 81.3
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 81.22
PRK11619644 lytic murein transglycosylase; Provisional 81.01
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 80.93
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.64
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 80.29
KOG2063|consensus877 80.22
>KOG1156|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-57  Score=426.62  Aligned_cols=551  Identities=62%  Similarity=0.979  Sum_probs=510.9

Q ss_pred             CcccccchhhHHHHHHHhhCCCCCCChHHHHHHHHHHHhccCCHHHHHHHHHHHHHcCCCchhHHHHHHHHHhhcCCHHH
Q psy6603           1 KCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDE   80 (724)
Q Consensus         1 k~~~~~~~~~A~~~~~~~l~~p~~p~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~lg~~~~~~g~~~~   80 (724)
                      |+|+.|+|.+.++.++++++  ++|.+++++..+|..+...|+.++|....+.+++.++.+..+|+.+|.++...++|++
T Consensus        16 k~yE~kQYkkgLK~~~~iL~--k~~eHgeslAmkGL~L~~lg~~~ea~~~vr~glr~d~~S~vCwHv~gl~~R~dK~Y~e   93 (700)
T KOG1156|consen   16 KCYETKQYKKGLKLIKQILK--KFPEHGESLAMKGLTLNCLGKKEEAYELVRLGLRNDLKSHVCWHVLGLLQRSDKKYDE   93 (700)
T ss_pred             HHHHHHHHHhHHHHHHHHHH--hCCccchhHHhccchhhcccchHHHHHHHHHHhccCcccchhHHHHHHHHhhhhhHHH
Confidence            57999999999999999999  9999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhCCCcHHHHHHHHHHHHHhcchHHHHHHHHHHHHhCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHHhh
Q psy6603          81 AIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQ  160 (724)
Q Consensus        81 A~~~~~~a~~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~  160 (724)
                      |+++|+.|+.++|+|..++..++.+..++++++.....-.+.++..|.....|...+.++...|++..|..+++.+.+..
T Consensus        94 aiKcy~nAl~~~~dN~qilrDlslLQ~QmRd~~~~~~tr~~LLql~~~~ra~w~~~Avs~~L~g~y~~A~~il~ef~~t~  173 (700)
T KOG1156|consen   94 AIKCYRNALKIEKDNLQILRDLSLLQIQMRDYEGYLETRNQLLQLRPSQRASWIGFAVAQHLLGEYKMALEILEEFEKTQ  173 (700)
T ss_pred             HHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhhhhHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998888


Q ss_pred             ccCCC-CChhhHHHHHHHHHHHHHcCCHHHHHHHHHHHhhhhccHhhHHHHHHHHHHHcCChHHHHHHHHHHHHHcCCcH
Q psy6603         161 QVTNS-YDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENT  239 (724)
Q Consensus       161 ~~~p~-~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~p~~~  239 (724)
                      ...|+ ......+..+....++...|.+++|++.+..--...-+........+.++.+++++++|...|...+..+|++.
T Consensus       174 ~~~~s~~~~e~se~~Ly~n~i~~E~g~~q~ale~L~~~e~~i~Dkla~~e~ka~l~~kl~~lEeA~~~y~~Ll~rnPdn~  253 (700)
T KOG1156|consen  174 NTSPSKEDYEHSELLLYQNQILIEAGSLQKALEHLLDNEKQIVDKLAFEETKADLLMKLGQLEEAVKVYRRLLERNPDNL  253 (700)
T ss_pred             ccCCCHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHhhhhHHHHHHHHhhhHHHHHHHHhhHHhHHHHHHHHHhhCchhH
Confidence            64444 45677888999999999999999999998876666666677888899999999999999999999999999999


Q ss_pred             HHHHHHHHHhc-cCChHHHH-HHHHHHHHhCCCCCccccccccccCchhHHHHHHHHHHhhhhcCCchhhhhhHHhhhch
Q psy6603         240 LYYNKLVEAKQ-LTNNDDIF-QLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNT  317 (724)
Q Consensus       240 ~~~~~l~~~~~-~~~~~~a~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  317 (724)
                      .++..+-.++. ..+.-+++ ..|...-+.+|....+.++++.++.+.++...++.|++..+.+|+|.++.++.+++..+
T Consensus       254 ~Yy~~l~~~lgk~~d~~~~lk~ly~~ls~~y~r~e~p~Rlplsvl~~eel~~~vdkyL~~~l~Kg~p~vf~dl~SLyk~p  333 (700)
T KOG1156|consen  254 DYYEGLEKALGKIKDMLEALKALYAILSEKYPRHECPRRLPLSVLNGEELKEIVDKYLRPLLSKGVPSVFKDLRSLYKDP  333 (700)
T ss_pred             HHHHHHHHHHHHHhhhHHHHHHHHHHHhhcCcccccchhccHHHhCcchhHHHHHHHHHHHhhcCCCchhhhhHHHHhch
Confidence            99998888863 43444444 88999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCchhHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCChHHHHHHHHH
Q psy6603         318 EKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGR  397 (724)
Q Consensus       318 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~l~~  397 (724)
                      .+...+++.+..|...+...+.+...+....+|+.+.+|+++.++..+...|+++.|..+++.++...|+.++.+...|+
T Consensus       334 ~k~~~le~Lvt~y~~~L~~~~~f~~~D~~~~E~PttllWt~y~laqh~D~~g~~~~A~~yId~AIdHTPTliEly~~KaR  413 (700)
T KOG1156|consen  334 EKVAFLEKLVTSYQHSLSGTGMFNFLDDGKQEPPTTLLWTLYFLAQHYDKLGDYEVALEYIDLAIDHTPTLIELYLVKAR  413 (700)
T ss_pred             hHhHHHHHHHHHHHhhcccccCCCcccccccCCchHHHHHHHHHHHHHHHcccHHHHHHHHHHHhccCchHHHHHHHHHH
Confidence            99999999999999999999988888887889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCHHHHHHHHHHHHccCccchhhhhhHHHHHHHcCCHHHHHHHHHHhhhcccCccCChhHHHHHHHHHHHHHHHH
Q psy6603         398 IYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQ  477 (724)
Q Consensus       398 ~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (724)
                      ++...|++++|..++..+.++|..|..++...|...++.++.++|.+++.+..+.+......++.++|+||..+-     
T Consensus       414 I~kH~G~l~eAa~~l~ea~elD~aDR~INsKcAKYmLrAn~i~eA~~~~skFTr~~~~~~~~L~~mqcmWf~~E~-----  488 (700)
T KOG1156|consen  414 IFKHAGLLDEAAAWLDEAQELDTADRAINSKCAKYMLRANEIEEAEEVLSKFTREGFGAVNNLAEMQCMWFQLED-----  488 (700)
T ss_pred             HHHhcCChHHHHHHHHHHHhccchhHHHHHHHHHHHHHccccHHHHHHHHHhhhcccchhhhHHHhhhHHHhHhh-----
Confidence            999999999999999999999999999999999999999999999999999888776667777777777766322     


Q ss_pred             hhcchhhhhhhhhhhhhHhhhhhchHHHHHHHHHHhcCCCCCchhHHHHhhhhHhhhcCChHHHHHHHHHhhhcCCCccc
Q psy6603         478 RLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHV  557 (724)
Q Consensus       478 ~~g~~~~A~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~  557 (724)
                                                                                                      
T Consensus       489 --------------------------------------------------------------------------------  488 (700)
T KOG1156|consen  489 --------------------------------------------------------------------------------  488 (700)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hHHHHHHHHhccccHHHHHHHHHHHhhhccccHHHHHHHHHHHHHhhhHhhHHHHHHHHHhhhhhhhhhhhhhHHHHHHH
Q psy6603         558 CWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYREGVSAMENLNEMQCMWFQTECALAYQR  637 (724)
Q Consensus       558 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~  637 (724)
                                                                                                |.+|.+
T Consensus       489 --------------------------------------------------------------------------g~ay~r  494 (700)
T KOG1156|consen  489 --------------------------------------------------------------------------GEAYLR  494 (700)
T ss_pred             --------------------------------------------------------------------------hHHHHH
Confidence                                                                                      224444


Q ss_pred             hCChhHHHHHHHHHHHHHhhhhcccchhHHHHHhhhhHHHHHHHHhHHhhhcCChHHHHHHHHHHHHHHHhhcCC
Q psy6603         638 LGRWGDTLKKCHEVDRHFSEIIEDQFDFHTYCMRKMTLRSYVRLLRLEDVLRSHPFYYTAARCAIQVYLRLHDRP  712 (724)
Q Consensus       638 ~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~  712 (724)
                      +|++.+|++-|..+-++|.++..|++|++.||+|++++|+|..+.+|+|.++++|+|.+|++.+++||++|+|.|
T Consensus       495 ~~k~g~ALKkfh~i~k~~~~~~~dqfDfhtyc~rk~tlrsYv~ll~~~d~L~~~p~y~~Aa~~Ai~iYl~l~d~p  569 (700)
T KOG1156|consen  495 QNKLGLALKKFHEIEKHYKTWSEDQFDFHTYCMRKGTLRSYVELLEWEDNLRSSPYYLRAAKGAIEIYLRLHDSP  569 (700)
T ss_pred             HHHHHHHHHHHhhHHHHHHHHhhhhhhHHHHHHhcCcHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcCc
Confidence            455567888899999999999999999999999999999999999999999999999999999999999999999

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query724
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-16
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-04
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-10
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-06
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-04
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-09
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-05
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 7e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 9e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
 Score = 82.8 bits (204), Expect = 2e-16
 Identities = 57/628 (9%), Positives = 131/628 (20%), Gaps = 99/628 (15%)

Query: 21  NPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDE 80
            P        +A        L   +     + +         V    +   +++ +    
Sbjct: 188 TPAQVV---AIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETMQR 244

Query: 81  AIKCYRNALKWEHDNIQIMRDLSLLQIQMRDLEGYRETRYQLFMLRPTQRASWIGFAMAY 140
            +     A     D +  +      +  +  ++       Q   L P Q  +        
Sbjct: 245 LLPVLCQAHGLPPDQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGK 304

Query: 141 HLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVKHLDRFKEQ 200
             L         L    +   +T       +          Q    ++  +  L +    
Sbjct: 305 QALETVQRL---LPVLCQAHGLTPDQVVAIASHDG----GKQALETVQRLLPVLCQAHGL 357

Query: 201 IHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQL 260
             D++    + G  K  L      +           +  +        + L         
Sbjct: 358 TPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGKQALETVQR---- 413

Query: 261 LTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEK- 319
               +    +A     L+ + V                          +        E  
Sbjct: 414 ---LLPVLCQAH---GLTPDQVVA----------------------IASHDGGKQALETV 445

Query: 320 -------CKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALL-----------WVYHYL 361
                  C+    L  + V A++       Q    V+    +L                 
Sbjct: 446 QRLLPVLCQTHG-LTPAQVVAIASHDG-GKQALETVQQLLPVLCQAHGLTPDQVVAIASN 503

Query: 362 AQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTA 421
                 L    + L  +  A   TP  +    + G   +    V      L +A  L   
Sbjct: 504 IGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPD 563

Query: 422 DRYINSKCAKYMLRANLIKEAEETCSK---FTREGVSAMENLNEMQCMWFQTECALAYQR 478
                +           ++       +    T+  V A+ +                 Q 
Sbjct: 564 QVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASN------------IGGKQA 611

Query: 479 LGRWGDTLKKCHEVDRKC--------------YEHKQYKNGLK-FAKQILTNPKYAEHGE 523
           L      L    +                      +  +  L    +     P       
Sbjct: 612 LETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQV---V 668

Query: 524 TLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNAL 583
            +A  G     L   +     + +      +  V        +++ +     +     A 
Sbjct: 669 AIASNGGGKQALETVQRLLPVLCQAHGLTQEQVVAIASNNGGKQALETVQRLLPVLCQAH 728

Query: 584 KWEHDNIQIMRDLSLLQIQMRDLEGYRE 611
               D +     ++      + LE  + 
Sbjct: 729 GLTPDQVVA---IASNGGGKQALETVQR 753
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query724
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.94
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.91
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.85
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.82
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.8
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.8
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.78
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.75
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.7
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.69
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.68
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.68
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.67
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.66
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.64
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.62
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.61
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.61
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.61
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.59
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.58
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.57
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.57
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.57
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.57
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.56
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.55
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.55
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.54
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.53
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.52
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.52
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.51
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.5
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.49
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.47
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.47
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.47
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.46
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.41
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.4
3k9i_A117 BH0479 protein; putative protein binding protein, 99.39
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.39
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.38
3k9i_A117 BH0479 protein; putative protein binding protein, 99.38
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.38
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.38
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.38
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.37
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.37
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.31
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.3
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.21
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.2
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.19
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.18
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.17
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.02
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.95
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.91
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.84
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.76
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.75
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.73
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.73
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.69
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.68
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.64
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.64
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.51
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.47
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.4
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.4
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.36
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.1
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.07
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.76
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.71
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.63
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.54
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.49
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 97.47
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.46
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.44
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.41
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.37
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.16
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.93
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.85
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.75
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.67
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.64
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.54
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.31
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.31
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.18
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.13
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 96.13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.09
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.01
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.8
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.71
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.64
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.06
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.86
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.73
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.69
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.64
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 94.61
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.59
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.37
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.21
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.11
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.0
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.67
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.57
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.44
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 91.09
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.96
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.5e-43  Score=357.28  Aligned_cols=384  Identities=15%  Similarity=0.065  Sum_probs=307.4

Q ss_pred             HHHHHHhccCCHHHHHHHHHHHHHcCCCchhHHHHHHHHHhhcCCHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHhcch
Q psy6603          33 MKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRDL  112 (724)
Q Consensus        33 ~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~la~~~~~~~~~  112 (724)
                      .+|..++..|++++|+..++++++.+|+++.++..+|.++...|++++|+..+++++..+|.++.++..+|.++...|++
T Consensus         4 ~~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~   83 (388)
T 1w3b_A            4 ELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCH
T ss_pred             hHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCCH
Confidence            35777888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHHHHhCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHHHcCCHHHHHH
Q psy6603         113 EGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAVK  192 (724)
Q Consensus       113 ~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~g~~~~A~~  192 (724)
                      ++|+..|+++++.+|+++.++..+|.++...|++++|+..++++.+..   |+    ...++..+|.++...|++++|+.
T Consensus        84 ~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~---p~----~~~~~~~l~~~~~~~g~~~~A~~  156 (388)
T 1w3b_A           84 QEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN---PD----LYCVRSDLGNLLKALGRLEEAKA  156 (388)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC---TT----CTHHHHHHHHHHHTTSCHHHHHH
T ss_pred             HHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC---CC----cHHHHHHHHHHHHHccCHHHHHH
Confidence            888888888888888888888888888888888888888777766543   33    44567777778888888888888


Q ss_pred             HHHHHhhhhccHhhHHHHHHHHHHHcCChHHHHHHHHHHHHHcCCcHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCCC
Q psy6603         193 HLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKAT  272 (724)
Q Consensus       193 ~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~a~~~~~~~~~~~~~~~  272 (724)
                      .|++++...|+++.++..+|.++...|++++|+..|++++..+|++..++.                             
T Consensus       157 ~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~-----------------------------  207 (388)
T 1w3b_A          157 CYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYI-----------------------------  207 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHH-----------------------------
T ss_pred             HHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHH-----------------------------
Confidence            888888888877778888888888888888888888888777776554333                             


Q ss_pred             ccccccccccCchhHHHHHHHHHHhhhhcCCchhhhhhHHhhhchhhHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCchh
Q psy6603         273 VPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPAS  352 (724)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~  352 (724)
                                                                                                      
T Consensus       208 --------------------------------------------------------------------------------  207 (388)
T 1w3b_A          208 --------------------------------------------------------------------------------  207 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHcCCHHHHHHHHHHHHccCccchhhhhhHHHH
Q psy6603         353 ALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAKY  432 (724)
Q Consensus       353 ~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~  432 (724)
                             .+|.++...|++++|+..+++++..+|+++.++..+|.++...|++++|+..|+++++.+|+++.++..++.+
T Consensus       208 -------~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~  280 (388)
T 1w3b_A          208 -------NLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANA  280 (388)
T ss_dssp             -------HHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHH
T ss_pred             -------HHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHH
Confidence                   4555566667777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHcCCHHHHHHHHHHhhhcccCccCChhHHHHHHHHHHHHHHHHhhcchhhhhhhhhhhhhHhhhhhchHHHHHHHHHH
Q psy6603         433 MLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQI  512 (724)
Q Consensus       433 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~A~~~~~~~  512 (724)
                      +...|++++|+..|+++++.                                                            
T Consensus       281 ~~~~g~~~~A~~~~~~al~~------------------------------------------------------------  300 (388)
T 1w3b_A          281 LKEKGSVAEAEDCYNTALRL------------------------------------------------------------  300 (388)
T ss_dssp             HHHHSCHHHHHHHHHHHHHH------------------------------------------------------------
T ss_pred             HHHcCCHHHHHHHHHHHHhh------------------------------------------------------------
Confidence            77777777777766666541                                                            


Q ss_pred             hcCCCCCchhHHHHhhhhHhhhcCChHHHHHHHHHhhhcCCCccchHHHHHHHHhccccHHHHHHHHHHHhhhccccHHH
Q psy6603         513 LTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQI  592 (724)
Q Consensus       513 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~  592 (724)
                           .|.++.++..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|++++|+..|+++++++|+++.+
T Consensus       301 -----~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a  375 (388)
T 1w3b_A          301 -----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADA  375 (388)
T ss_dssp             -----CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHH
T ss_pred             -----CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHH
Confidence                 234555788888888889999999999999999999988899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhh
Q psy6603         593 MRDLSLLQIQMR  604 (724)
Q Consensus       593 ~~~l~~~~~~~~  604 (724)
                      +.++|.++..+|
T Consensus       376 ~~~lg~~~~~~~  387 (388)
T 1w3b_A          376 YSNMGNTLKEMQ  387 (388)
T ss_dssp             HHHHHHHHHHTC
T ss_pred             HHhHHHHHHHcc
Confidence            999888776665
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 724
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-08
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-07
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.002
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 9e-05
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 9e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.003
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.003
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.003
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.1 bits (183), Expect = 5e-15
 Identities = 57/422 (13%), Positives = 121/422 (28%), Gaps = 45/422 (10%)

Query: 184 SGDLEEAVKHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYN 243
           +GD E A +H  +   Q  D   V     ++  +  + + +       I++N      Y+
Sbjct: 12  AGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYS 71

Query: 244 KLVEAKQLTNNDDIFQLLTHYISKYPKATVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGV 303
            L    +             +  +     +   ++L          E          +  
Sbjct: 72  NLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN 131

Query: 304 PPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPASALLWVYHYLAQ 363
           P L+     L +  +    +++    Y++A+    +F+                +  L  
Sbjct: 132 PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFA--------------VAWSNLGC 177

Query: 364 HYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADR 423
            ++  G+   A+++   A+   P  ++ ++  G + K A     A      A SL     
Sbjct: 178 VFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHA 237

Query: 424 YINSKCAKYMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWG 483
            ++   A       LI  A +T  +         +    +         A A +  G   
Sbjct: 238 VVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNL---------ANALKEKGSVA 288

Query: 484 DTLKKCHEVDRKCYEHKQYKNGLKFAKQILTNPKYAEHGETLAMKGLTLNCLGRKEEAYE 543
           +     +   R C  H    N                               G  EEA  
Sbjct: 289 EAEDCYNTALRLCPTHADSLN----------------------NLANIKREQGNIEEAVR 326

Query: 544 YVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQM 603
             R+ L    +          + +   K  EA+  Y+ A++          ++     +M
Sbjct: 327 LYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEM 386

Query: 604 RD 605
           +D
Sbjct: 387 QD 388
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query724
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.82
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.66
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.63
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.61
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.6
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.6
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.59
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.58
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.51
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.51
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.5
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.47
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.46
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.44
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.43
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.41
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.41
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.33
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.3
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.17
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.1
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.08
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.97
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.94
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.66
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.48
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.37
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.07
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.06
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.8
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.51
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.43
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 88.52
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 87.92
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-39  Score=327.80  Aligned_cols=386  Identities=15%  Similarity=0.068  Sum_probs=310.3

Q ss_pred             HHHHHHHhccCCHHHHHHHHHHHHHcCCCchhHHHHHHHHHhhcCCHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHhcc
Q psy6603          32 AMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQIMRDLSLLQIQMRD  111 (724)
Q Consensus        32 ~~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~la~~~~~~~~  111 (724)
                      +.+|..+++.|++++|+..|+++++.+|+++.++..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|+
T Consensus         3 l~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~   82 (388)
T d1w3ba_           3 MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcc
Confidence            45788899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHhCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHHHcCCHHHHH
Q psy6603         112 LEGYRETRYQLFMLRPTQRASWIGFAMAYHLLHDFDMACNILEAFRKTQQVTNSYDFEHSELLLYQSMVIQDSGDLEEAV  191 (724)
Q Consensus       112 ~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~g~~~~A~  191 (724)
                      +++|+..+..+.+..|.........+......+....+.............       ........+......+....+.
T Consensus        83 ~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~  155 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-------LYCVRSDLGNLLKALGRLEEAK  155 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-------CTHHHHHHHHHHHTTSCHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccc-------cccccccccccccccchhhhhH
Confidence            999999999999999999888888888888888877777665554443322       3345566677777888888888


Q ss_pred             HHHHHHhhhhccHhhHHHHHHHHHHHcCChHHHHHHHHHHHHHcCCcHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCC
Q psy6603         192 KHLDRFKEQIHDKLTVEETYGALKLKLGQYNEAMKHYESLIERNQENTLYYNKLVEAKQLTNNDDIFQLLTHYISKYPKA  271 (724)
Q Consensus       192 ~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~a~~~~~~~~~~~~~~  271 (724)
                      ..+.+.+...|+++.++..+|.++...|++++|...++++++.+|++..++..+                          
T Consensus       156 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l--------------------------  209 (388)
T d1w3ba_         156 ACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINL--------------------------  209 (388)
T ss_dssp             HHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHH--------------------------
T ss_pred             HHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHH--------------------------
Confidence            888888888888888888888888888888888888888888888766654444                          


Q ss_pred             CccccccccccCchhHHHHHHHHHHhhhhcCCchhhhhhHHhhhchhhHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCch
Q psy6603         272 TVPKRLSLNYVSGDQFRTEIDKYLRHGFHKGVPPLFVNLRSLYSNTEKCKIIQDLVESYVEALSKTGHFSLQDEGEVEPA  351 (724)
Q Consensus       272 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  351 (724)
                                                                                                      
T Consensus       210 --------------------------------------------------------------------------------  209 (388)
T d1w3ba_         210 --------------------------------------------------------------------------------  209 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHcCCHHHHHHHHHHHHccCccchhhhhhHHH
Q psy6603         352 SALLWVYHYLAQHYDHLGDTMKALNYINAAIDHTPTLIELFVTKGRIYKHAGDVLEAYKWLDEAQSLDTADRYINSKCAK  431 (724)
Q Consensus       352 ~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~  431 (724)
                                |.++...|++++|+..++++....|..+..+..+|.++...|++++|+..|+++++++|+++.++..+|.
T Consensus       210 ----------~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~  279 (388)
T d1w3ba_         210 ----------GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLAN  279 (388)
T ss_dssp             ----------HHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHH
T ss_pred             ----------hhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence                      4445555666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHcCCHHHHHHHHHHhhhcccCccCChhHHHHHHHHHHHHHHHHhhcchhhhhhhhhhhhhHhhhhhchHHHHHHHHH
Q psy6603         432 YMLRANLIKEAEETCSKFTREGVSAMENLNEMQCMWFQTECALAYQRLGRWGDTLKKCHEVDRKCYEHKQYKNGLKFAKQ  511 (724)
Q Consensus       432 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~A~~~~~~  511 (724)
                      ++...|++++|++.++.+..                                                            
T Consensus       280 ~~~~~~~~~~A~~~~~~~~~------------------------------------------------------------  299 (388)
T d1w3ba_         280 ALKEKGSVAEAEDCYNTALR------------------------------------------------------------  299 (388)
T ss_dssp             HHHHHSCHHHHHHHHHHHHH------------------------------------------------------------
T ss_pred             HHHHcCCHHHHHHHHHhhhc------------------------------------------------------------
Confidence            66666666666666655543                                                            


Q ss_pred             HhcCCCCCchhHHHHhhhhHhhhcCChHHHHHHHHHhhhcCCCccchHHHHHHHHhccccHHHHHHHHHHHhhhccccHH
Q psy6603         512 ILTNPKYAEHGETLAMKGLTLNCLGRKEEAYEYVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEHDNIQ  591 (724)
Q Consensus       512 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~  591 (724)
                           ..|.+..++..+|.++...|++++|+..|+++++.+|+++.+++.+|.++...|++++|+.+|+++++++|+++.
T Consensus       300 -----~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~  374 (388)
T d1w3ba_         300 -----LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD  374 (388)
T ss_dssp             -----HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHH
T ss_pred             -----cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHH
Confidence                 223444577788888888899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhh
Q psy6603         592 IMRDLSLLQIQMRD  605 (724)
Q Consensus       592 ~~~~l~~~~~~~~~  605 (724)
                      ++.+||.++..+||
T Consensus       375 a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         375 AYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHcCC
Confidence            99999988877775
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure