Psyllid ID: psy6616
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 383852541 | 330 | PREDICTED: guanine nucleotide-binding pr | 0.887 | 0.190 | 0.984 | 9e-30 | |
| 209180425 | 354 | guanine nucleotide binding protein (G pr | 0.887 | 0.177 | 0.984 | 1e-29 | |
| 383852539 | 354 | PREDICTED: guanine nucleotide-binding pr | 0.887 | 0.177 | 0.984 | 1e-29 | |
| 112982857 | 354 | G protein alpha subunit Go isoform 1 [Bo | 0.887 | 0.177 | 0.984 | 1e-29 | |
| 283536458 | 354 | guanine nucleotide-binding protein G(o) | 0.887 | 0.177 | 0.984 | 1e-29 | |
| 585173 | 354 | RecName: Full=Guanine nucleotide-binding | 0.887 | 0.177 | 0.984 | 2e-29 | |
| 307202998 | 302 | Guanine nucleotide-binding protein G(o) | 0.887 | 0.208 | 0.984 | 2e-29 | |
| 242015524 | 356 | Guanine nucleotide-binding protein G(O) | 0.887 | 0.176 | 0.984 | 3e-29 | |
| 357614081 | 221 | guanine nucleotide-binding protein G(o) | 0.887 | 0.285 | 0.984 | 3e-29 | |
| 290563180 | 354 | G protein alpha subunit Go isoform 2 [Bo | 0.887 | 0.177 | 0.968 | 3e-29 |
| >gi|383852541|ref|XP_003701785.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 134 bits (336), Expect = 9e-30, Method: Compositional matrix adjust.
Identities = 62/63 (98%), Positives = 63/63 (100%)
Query: 9 SGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC 68
+GAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC
Sbjct: 268 AGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC 327
Query: 69 GLY 71
GLY
Sbjct: 328 GLY 330
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|209180425|ref|NP_001129194.1| guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O [Acyrthosiphon pisum] gi|47524492|gb|AAT34978.1| guanine nucleotide-binding protein G(o) alpha subunit [Sitobion avenae] | Back alignment and taxonomy information |
|---|
| >gi|383852539|ref|XP_003701784.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|112982857|ref|NP_001036916.1| G protein alpha subunit Go isoform 1 [Bombyx mori] gi|56342245|dbj|BAD74000.1| G protein alpha subunit Go [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|283536458|gb|ADB25316.1| guanine nucleotide-binding protein G(o) subunit alpha 1 isoform 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|585173|sp|P38404.1|GNAO_LOCMI RecName: Full=Guanine nucleotide-binding protein G(o) subunit alpha | Back alignment and taxonomy information |
|---|
| >gi|307202998|gb|EFN82214.1| Guanine nucleotide-binding protein G(o) subunit alpha [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242015524|ref|XP_002428403.1| Guanine nucleotide-binding protein G(O) subunit alpha, putative [Pediculus humanus corporis] gi|212513015|gb|EEB15665.1| Guanine nucleotide-binding protein G(O) subunit alpha, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|357614081|gb|EHJ68893.1| guanine nucleotide-binding protein G(o) subunit alpha 1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|290563180|ref|NP_001166852.1| G protein alpha subunit Go isoform 2 [Bombyx mori] gi|283536460|gb|ADB25317.1| guanine nucleotide-binding protein G(o) subunit alpha 1 isoform 2 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| FB|FBgn0001122 | 354 | Galphao "G protein alpha o sub | 0.887 | 0.177 | 0.952 | 7.1e-29 | |
| WB|WBGene00001648 | 354 | goa-1 [Caenorhabditis elegans | 0.887 | 0.177 | 0.888 | 2.5e-26 | |
| UNIPROTKB|P51875 | 354 | goa-1 "Guanine nucleotide-bind | 0.887 | 0.177 | 0.888 | 2.5e-26 | |
| UNIPROTKB|G8JKZ5 | 267 | GNAO1 "Guanine nucleotide-bind | 0.887 | 0.235 | 0.809 | 2e-24 | |
| UNIPROTKB|P08239 | 354 | GNAO1 "Guanine nucleotide-bind | 0.887 | 0.177 | 0.809 | 2e-24 | |
| UNIPROTKB|E1C347 | 302 | GNAO1 "Uncharacterized protein | 0.887 | 0.208 | 0.809 | 3.3e-24 | |
| UNIPROTKB|E2RLG2 | 354 | GNAO1 "Uncharacterized protein | 0.887 | 0.177 | 0.809 | 3.3e-24 | |
| UNIPROTKB|H3BNR5 | 94 | GNAO1 "Guanine nucleotide-bind | 0.887 | 0.670 | 0.809 | 3.3e-24 | |
| UNIPROTKB|P09471 | 354 | GNAO1 "Guanine nucleotide-bind | 0.887 | 0.177 | 0.809 | 3.3e-24 | |
| UNIPROTKB|Q6UIQ1 | 241 | GNAO1 "Guanine nucleotide-bind | 0.887 | 0.261 | 0.809 | 3.3e-24 |
| FB|FBgn0001122 Galphao "G protein alpha o subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
Identities = 60/63 (95%), Positives = 62/63 (98%)
Query: 9 SGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC 68
+G QEYGEAAAYIQAQFEAKNKST+KEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC
Sbjct: 292 TGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGC 351
Query: 69 GLY 71
GLY
Sbjct: 352 GLY 354
|
|
| WB|WBGene00001648 goa-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51875 goa-1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G8JKZ5 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08239 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C347 GNAO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RLG2 GNAO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BNR5 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09471 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6UIQ1 GNAO1 "Guanine nucleotide-binding protein" [Macaca mulatta (taxid:9544)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| cd00066 | 315 | cd00066, G-alpha, Alpha subunit of G proteins (gua | 7e-27 | |
| smart00275 | 342 | smart00275, G_alpha, G protein alpha subunit | 1e-22 | |
| pfam00503 | 329 | pfam00503, G-alpha, G-protein alpha subunit | 1e-20 |
| >gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) | Back alignment and domain information |
|---|
Score = 98.4 bits (246), Expect = 7e-27
Identities = 34/64 (53%), Positives = 43/64 (67%)
Query: 2 KYFTELLSGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVII 61
YF + +Y EAA YI+ +F N++ KEIY H TCATDT NI+FVFDAV D+I+
Sbjct: 252 DYFPDYTGPPNDYEEAAKYIKKKFLDLNRNPNKEIYPHFTCATDTENIRFVFDAVKDIIL 311
Query: 62 ANNL 65
NNL
Sbjct: 312 QNNL 315
|
The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute. Length = 315 |
| >gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| KOG0085|consensus | 359 | 99.9 | ||
| KOG0082|consensus | 354 | 99.89 | ||
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 99.83 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 99.83 | |
| KOG0099|consensus | 379 | 99.76 | ||
| PF00503 | 389 | G-alpha: G-protein alpha subunit; InterPro: IPR001 | 99.66 |
| >KOG0085|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=3.4e-24 Score=147.57 Aligned_cols=69 Identities=43% Similarity=0.702 Sum_probs=65.8
Q ss_pred cccCCCCCCC-CChHHHHHHHHHHHHhhccCCCCCeeEeecccccCccHHHHHHHHHHHHHHhhhhhcCCC
Q psy6616 2 KYFTELLSGA-QEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 71 (71)
Q Consensus 2 ~~Fp~~y~G~-~~~~~~~~fi~~kF~~~~~~~~r~iy~h~T~AtDt~ni~~vf~~V~d~Il~~nl~~~~l~ 71 (71)
+|||+ |+|| .|..+|.+||.++|.+.+++..|.+|+||||||||+||++||.+|+|+||+.||++++|+
T Consensus 290 ~YFPe-~~GP~qDa~AAreFILkm~~d~nPd~dKii~SHfTcATDT~NIRfVFaaVkDtiLq~~LkE~NLv 359 (359)
T KOG0085|consen 290 DYFPE-FDGPKQDAQAAREFILKMYVDMNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV 359 (359)
T ss_pred HhCcc-cCCCcccHHHHHHHHHHHHHhhCCCccceeeeeeeecccchhHHHHHHHHHHHHHHhhhHhhccC
Confidence 69999 9998 688899999999999999888999999999999999999999999999999999999875
|
|
| >KOG0082|consensus | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >KOG0099|consensus | Back alignment and domain information |
|---|
| >PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 71 | ||||
| 3c7k_A | 333 | Molecular Architecture Of Galphao And The Structura | 6e-26 | ||
| 1shz_A | 340 | Crystal Structure Of The P115rhogef Rgrgs Domain In | 2e-20 | ||
| 2ihb_A | 323 | Crystal Structure Of The Heterodimeric Complex Of H | 6e-20 | ||
| 4g5r_A | 330 | Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 | 6e-20 | ||
| 4g5o_A | 330 | Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length | 6e-20 | ||
| 1as0_A | 353 | Gtp-Gamma-S Bound G42v Gia1 Length = 353 | 7e-20 | ||
| 3ums_A | 354 | Crystal Structure Of The G202a Mutant Of Human G-Al | 7e-20 | ||
| 1gil_A | 353 | Structure Of Active Conformations Of Gia1 And The M | 7e-20 | ||
| 2gtp_A | 323 | Crystal Structure Of The Heterodimeric Complex Of H | 7e-20 | ||
| 3qe0_A | 325 | A Galpha-I1 P-Loop Mutation Prevents Transition To | 7e-20 | ||
| 2xns_A | 327 | Crystal Structure Of Human G Alpha I1 Bound To A De | 7e-20 | ||
| 1y3a_A | 329 | Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe | 8e-20 | ||
| 4g5q_A | 330 | Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 | 8e-20 | ||
| 3qi2_A | 328 | A Galpha P-Loop Mutation Prevents Transition To The | 8e-20 | ||
| 1gp2_A | 353 | G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi | 8e-20 | ||
| 1gg2_A | 353 | G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet | 8e-20 | ||
| 1svk_A | 353 | Structure Of The K180p Mutant Of Gi Alpha Subunit B | 8e-20 | ||
| 3umr_A | 354 | Crystal Structure Of The G202d Mutant Of Human G-Al | 8e-20 | ||
| 2ik8_A | 324 | Crystal Structure Of The Heterodimeric Complex Of H | 8e-20 | ||
| 1kjy_A | 325 | Crystal Structure Of Human G[alpha]i1 Bound To The | 8e-20 | ||
| 3onw_A | 328 | Structure Of A G-Alpha-I1 Mutant With Enhanced Affi | 8e-20 | ||
| 2zjy_A | 356 | Structure Of The K349p Mutant Of Gi Alpha 1 Subunit | 2e-19 | ||
| 3ffb_A | 360 | Crystal Structure Of A Fast Activating G Protein Mu | 3e-19 | ||
| 3d7m_A | 354 | Crystal Structure Of The G Protein Fast-Exchange Do | 1e-18 | ||
| 2ode_A | 350 | Crystal Structure Of The Heterodimeric Complex Of H | 3e-17 | ||
| 3v00_C | 356 | Studies Of A Constitutively Active G-Alpha Subunit | 1e-16 | ||
| 1fqj_A | 325 | Crystal Structure Of The Heterotrimeric Complex Of | 2e-16 | ||
| 1tnd_A | 324 | The 2.2 Angstroms Crystal Structure Of Transducin-A | 6e-16 | ||
| 1got_A | 350 | Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer | 8e-16 | ||
| 1bh2_A | 315 | A326s Mutant Of An Inhibitory Alpha Subunit Length | 2e-15 | ||
| 2g83_A | 313 | Structure Of Activated G-alpha-i1 Bound To A Nucleo | 3e-15 | ||
| 4ekc_A | 347 | Structure Of Human Regulator Of G Protein Signaling | 3e-08 | ||
| 2bcj_Q | 353 | Crystal Structure Of G Protein-coupled Receptor Kin | 4e-08 | ||
| 3ah8_A | 355 | Structure Of Heterotrimeric G Protein Galpha-Q Beta | 4e-08 | ||
| 3ohm_A | 327 | Crystal Structure Of Activated G Alpha Q Bound To I | 4e-08 | ||
| 4gnk_A | 353 | Crystal Structure Of Galphaq In Complex With Full-l | 4e-08 | ||
| 1zca_A | 359 | Crystal Structure Of G Alpha 12 In Complex With Gdp | 1e-06 |
| >pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 | Back alignment and structure |
|
| >pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 | Back alignment and structure |
| >pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 | Back alignment and structure |
| >pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 | Back alignment and structure |
| >pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 | Back alignment and structure |
| >pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 | Back alignment and structure |
| >pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 | Back alignment and structure |
| >pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 | Back alignment and structure |
| >pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 | Back alignment and structure |
| >pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 | Back alignment and structure |
| >pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 | Back alignment and structure |
| >pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 | Back alignment and structure |
| >pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 | Back alignment and structure |
| >pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 | Back alignment and structure |
| >pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 | Back alignment and structure |
| >pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 | Back alignment and structure |
| >pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 | Back alignment and structure |
| >pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 | Back alignment and structure |
| >pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 | Back alignment and structure |
| >pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 | Back alignment and structure |
| >pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 | Back alignment and structure |
| >pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 | Back alignment and structure |
| >pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 | Back alignment and structure |
| >pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 | Back alignment and structure |
| >pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 | Back alignment and structure |
| >pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 | Back alignment and structure |
| >pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 | Back alignment and structure |
| >pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 | Back alignment and structure |
| >pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 | Back alignment and structure |
| >pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 | Back alignment and structure |
| >pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 | Back alignment and structure |
| >pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 | Back alignment and structure |
| >pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 | Back alignment and structure |
| >pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 | Back alignment and structure |
| >pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 8e-27 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 2e-23 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 7e-23 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 3e-21 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 1e-20 |
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 | Back alignment and structure |
|---|
Score = 98.2 bits (244), Expect = 8e-27
Identities = 29/69 (42%), Positives = 36/69 (52%)
Query: 2 KYFTELLSGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVII 61
YF E ++ A +I F N + K IY H TCATDT NI+FVF AV D I+
Sbjct: 258 DYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTIL 317
Query: 62 ANNLRGCGL 70
NL+ L
Sbjct: 318 QLNLKEYNL 326
|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 99.8 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 99.78 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 99.58 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 99.57 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 99.54 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 99.5 | |
| 2dce_A | 111 | KIAA1915 protein; swirm domain, structural genomic | 86.15 | |
| 2fq3_A | 104 | Transcription regulatory protein SWI3; four-helix | 80.92 |
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
Probab=99.80 E-value=8.8e-20 Score=126.96 Aligned_cols=69 Identities=43% Similarity=0.692 Sum_probs=61.1
Q ss_pred cccCCCCCCC-CChHHHHHHHHHHHHhhccCCCCCeeEeecccccCccHHHHHHHHHHHHHHhhhhhcCCC
Q psy6616 2 KYFTELLSGA-QEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 71 (71)
Q Consensus 2 ~~Fp~~y~G~-~~~~~~~~fi~~kF~~~~~~~~r~iy~h~T~AtDt~ni~~vf~~V~d~Il~~nl~~~~l~ 71 (71)
+|||+ |+|+ +++++|.+||+++|.++++.+.+.+|+|+|||+||+||+.||.+|.++|++.||+++||+
T Consensus 258 ~~fp~-y~g~~~~~e~a~~fi~~~F~~~~~~~~~~i~~~~TsA~d~~nV~~vF~~v~~~Il~~~l~~~~l~ 327 (327)
T 3ohm_A 258 DYFPE-YDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV 327 (327)
T ss_dssp GTCTT-CCSCSSCHHHHHHHHHHHHHSSCTTTTSCEEEEECCTTCHHHHHHHHHHHHHHHHHTTCC-----
T ss_pred hhchh-ccCCCCCHHHHHHHHHHHHHhhcccccCCcEEEEEEeecCHHHHHHHHHHHHHHHHHhHHhcCCC
Confidence 59999 9996 799999999999999998777899999999999999999999999999999999999974
|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 71 | ||||
| d1zcba2 | 200 | c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub | 1e-20 | |
| d2bcjq2 | 200 | c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub | 2e-19 | |
| d1azta2 | 221 | c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub | 2e-18 | |
| d1svsa1 | 195 | c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub | 1e-15 |
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Transducin (alpha subunit) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 78.0 bits (191), Expect = 1e-20
Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
Query: 2 KYFTELLSGAQEYGEAAAYIQAQFEAKNK-STTKEIYCHMTCATDTNNIQFVFDAVTDVI 60
YF E + ++ F K + + +Y H T A +T NI+ VF V D I
Sbjct: 135 DYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTI 194
Query: 61 IANNLR 66
+ +NL+
Sbjct: 195 LHDNLK 200
|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 99.79 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.77 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.58 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 99.49 |
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Transducin (alpha subunit) species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.79 E-value=3e-20 Score=119.90 Aligned_cols=66 Identities=32% Similarity=0.496 Sum_probs=57.1
Q ss_pred cccCCCCCCC-------------CChHHHHHHHHHHHHhhcc---CCCCCeeEeecccccCccHHHHHHHHHHHHHHhhh
Q psy6616 2 KYFTELLSGA-------------QEYGEAAAYIQAQFEAKNK---STTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNL 65 (71)
Q Consensus 2 ~~Fp~~y~G~-------------~~~~~~~~fi~~kF~~~~~---~~~r~iy~h~T~AtDt~ni~~vf~~V~d~Il~~nl 65 (71)
+|||+ |.|+ .++.+|.+||+++|.++++ +++|.+|+|+||||||+||+.||++|+|+|+++||
T Consensus 140 ~~f~~-~~~~~~~~~~~~~~g~~~~~~~a~~~i~~~f~~~~~~~~~~~~~~y~h~T~A~Dt~ni~~vf~~v~d~I~~~~l 218 (221)
T d1azta2 140 DYFPE-FARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHL 218 (221)
T ss_dssp HHCGG-GGGCCCCTTCCCCTTCCHHHHHHHHHHHHHHHHHHTSSCTTSCCEEEEECCTTCHHHHHHHHHTTHHHHHHHHH
T ss_pred HhCcc-ccccCCcccccccCCCchhHHHHHHHHHHHHHHHhccCCCCCCceeeeecceeccHHHHHHHHHHHHHHHHHHh
Confidence 58999 8642 2477899999999998753 45789999999999999999999999999999999
Q ss_pred hhc
Q psy6616 66 RGC 68 (71)
Q Consensus 66 ~~~ 68 (71)
++.
T Consensus 219 ~~~ 221 (221)
T d1azta2 219 RQY 221 (221)
T ss_dssp TTC
T ss_pred hcC
Confidence 863
|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|