Psyllid ID: psy6628


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEccccccccccccccccEccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccc
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHvrnkhgsseerprfkcegrgecdrvfTTRNMLNIHikrdhqkekpyqcsqcsksffskydhkihsrvhtgekpyacefcpltfrhsshlFRHRRSLHQMYEQ
msvvhnihrvvFTCQVCSKIFSYENGLKahvrnkhgsseerprfkcegrgecdrvfTTRNMLNIHikrdhqkekpyQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTfrhsshlfrhrrslhQMYEQ
**VVHNIHRVVFTCQVCSKIFSYENGLKAH***************CEGRGECDRVFTTRNMLNIHIKRDH***KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFR***********
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLF************
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHV**************CEGRGECDRVFTTRNMLNIHIKRD*********SQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ
**V**NIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVVHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q14588 700 Zinc finger protein 234 O yes N/A 0.878 0.165 0.423 6e-18
Q86WZ6 799 Zinc finger protein 227 O no N/A 0.795 0.131 0.469 1e-17
Q9NYT6 803 Zinc finger protein 226 O no N/A 0.848 0.139 0.428 3e-17
Q32M78642 Zinc finger protein 699 O no N/A 0.818 0.168 0.413 3e-17
Q1H9T6 681 Zinc finger and BTB domai no N/A 0.840 0.162 0.415 1e-16
Q9UJW7 825 Zinc finger protein 229 O no N/A 0.795 0.127 0.447 1e-16
A1YG60 578 Zinc finger protein 192 O N/A N/A 0.780 0.178 0.408 2e-16
A2T736 578 Zinc finger protein 192 O no N/A 0.780 0.178 0.408 2e-16
Q5R633 688 Zinc finger and BTB domai no N/A 0.840 0.161 0.415 2e-16
P10074 688 Zinc finger and BTB domai no N/A 0.840 0.161 0.415 2e-16
>sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 14/130 (10%)

Query: 1   MSVVHNIHRVVFT------CQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDR 54
           M + + +H VV T      C+VC K F   + LK H++     S ++P FKCE   EC +
Sbjct: 411 MKIHYQVHLVVHTGEKPYKCEVCGKAFRQSSYLKIHLK---AHSVQKP-FKCE---ECGQ 463

Query: 55  VFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFR 114
            F   + L IH +  H  EKPY+C +C K F  + D KIH R+HTGEKPY CE C   F 
Sbjct: 464 GFNQSSRLQIH-QLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFS 522

Query: 115 HSSHLFRHRR 124
            +SHL  H+R
Sbjct: 523 QASHLLTHQR 532




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=1 SV=2 Back     alignment and function description
>sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=2 SV=1 Back     alignment and function description
>sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 Back     alignment and function description
>sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 Back     alignment and function description
>sp|A1YG60|ZN192_PANPA Zinc finger protein 192 OS=Pan paniscus GN=ZNF192 PE=3 SV=1 Back     alignment and function description
>sp|A2T736|ZN192_PANTR Zinc finger protein 192 OS=Pan troglodytes GN=ZNF192 PE=3 SV=1 Back     alignment and function description
>sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 Back     alignment and function description
>sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
328778727 522 PREDICTED: zinc finger protein 510-like 0.795 0.201 0.427 3e-19
340717368 832 PREDICTED: hypothetical protein LOC10064 0.795 0.126 0.418 7e-19
350413353 832 PREDICTED: hypothetical protein LOC10074 0.795 0.126 0.418 8e-19
380015049 622 PREDICTED: zinc finger protein 107-like 0.795 0.168 0.435 9e-19
383856197 558 PREDICTED: zinc finger protein 675-like 0.795 0.188 0.444 2e-18
332028893 950 Zinc finger protein 358 [Acromyrmex echi 0.893 0.124 0.393 1e-17
327286356 476 PREDICTED: zinc finger protein 135-like 0.803 0.222 0.456 7e-17
398880228 896 RHS repeat-associated core domain protei 0.818 0.120 0.413 1e-16
328702651 693 PREDICTED: zinc finger protein 91-like [ 0.803 0.152 0.447 1e-16
366039961 581 zinc-finger protein 80-like [Mus musculu 0.803 0.182 0.447 1e-16
>gi|328778727|ref|XP_003249539.1| PREDICTED: zinc finger protein 510-like [Apis mellifera] Back     alignment and taxonomy information
 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 71/117 (60%), Gaps = 12/117 (10%)

Query: 12  FTCQVCSKIFSYENGLKAHVRNKHGSSEERP----RFKCEGRGECDRVFTTRNMLNIHIK 67
           F C+ C   F++++ L  H+ N H     RP    +F C+    C++++ T + +N H+K
Sbjct: 411 FHCKDCKISFAWKSTLNKHIANNH-----RPDGPQKFACDI---CNKIYNTSSQVNEHVK 462

Query: 68  RDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRR 124
           RDH K++ + CSQC KSFF KYD KIH R+HT E+PY C  C   F H SH+ RH R
Sbjct: 463 RDHLKQRNHVCSQCGKSFFKKYDLKIHGRIHTDERPYVCRACGKRFHHRSHIIRHER 519




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340717368|ref|XP_003397156.1| PREDICTED: hypothetical protein LOC100647221 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413353|ref|XP_003489968.1| PREDICTED: hypothetical protein LOC100748408 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380015049|ref|XP_003691524.1| PREDICTED: zinc finger protein 107-like [Apis florea] Back     alignment and taxonomy information
>gi|383856197|ref|XP_003703596.1| PREDICTED: zinc finger protein 675-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332028893|gb|EGI68915.1| Zinc finger protein 358 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|327286356|ref|XP_003227896.1| PREDICTED: zinc finger protein 135-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|398880228|ref|ZP_10635292.1| RHS repeat-associated core domain protein-containing protein [Pseudomonas sp. GM67] gi|398193833|gb|EJM80926.1| RHS repeat-associated core domain protein-containing protein [Pseudomonas sp. GM67] Back     alignment and taxonomy information
>gi|328702651|ref|XP_003241968.1| PREDICTED: zinc finger protein 91-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|366039961|ref|NP_001242994.1| zinc-finger protein 80-like [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
UNIPROTKB|F1LZ45 381 LOC691254 "Protein LOC691254" 0.681 0.236 0.459 1.1e-18
ZFIN|ZDB-GENE-110914-181225 si:dkey-262g12.7 "si:dkey-262g 0.681 0.4 0.428 1.4e-18
UNIPROTKB|F1LTL1455 LOC691254 "Protein LOC691254" 0.681 0.197 0.459 2.2e-18
UNIPROTKB|E2RHJ1 812 ZNF227 "Uncharacterized protei 0.681 0.110 0.469 2.2e-18
UNIPROTKB|B7Z5P9 748 ZNF227 "Zinc finger protein 22 0.681 0.120 0.479 2.5e-18
UNIPROTKB|Q86WZ6 799 ZNF227 "Zinc finger protein 22 0.681 0.112 0.479 2.8e-18
ZFIN|ZDB-GENE-080218-13260 zgc:175008 "zgc:175008" [Danio 0.681 0.346 0.459 2.8e-18
UNIPROTKB|F1M3A8353 F1M3A8 "Uncharacterized protei 0.681 0.254 0.448 4.5e-18
ZFIN|ZDB-GENE-110913-98 393 si:dkey-92j16.1 "si:dkey-92j16 0.681 0.229 0.448 4.7e-18
UNIPROTKB|F1LYI4407 F1LYI4 "Uncharacterized protei 0.681 0.221 0.438 5.4e-18
UNIPROTKB|F1LZ45 LOC691254 "Protein LOC691254" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 1.1e-18, P = 1.1e-18
 Identities = 45/98 (45%), Positives = 60/98 (61%)

Query:    12 FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQ 71
             + C  C K F+ +  LK H+R   G   E+P +KC    ECD+ F  ++ LNIH +R H 
Sbjct:   159 YKCSECDKCFTEKGTLKRHMRIHTG---EKP-YKCS---ECDKCFRLQSHLNIH-QRIHT 210

Query:    72 KEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFC 109
              EKPY+CS+C K F  K + +IH R+HTGEKPY C  C
Sbjct:   211 GEKPYKCSECEKYFTDKCNFRIHQRIHTGEKPYKCSEC 248


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-110914-181 si:dkey-262g12.7 "si:dkey-262g12.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTL1 LOC691254 "Protein LOC691254" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHJ1 ZNF227 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z5P9 ZNF227 "Zinc finger protein 227" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86WZ6 ZNF227 "Zinc finger protein 227" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080218-13 zgc:175008 "zgc:175008" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3A8 F1M3A8 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-98 si:dkey-92j16.1 "si:dkey-92j16.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LYI4 F1LYI4 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.004
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 35.5 bits (81), Expect = 0.004
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 12/89 (13%)

Query: 39  EERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVH 98
           + +P +KC   G C++ +  +N L  H+   H        +Q      S     I S   
Sbjct: 346 DGKP-YKCPVEG-CNKKYKNQNGLKYHMLHGH-------QNQKLHENPSPEKMNIFS--- 393

Query: 99  TGEKPYACEFCPLTFRHSSHLFRHRRSLH 127
             +KPY CE C   +++ + L  HR+  H
Sbjct: 394 AKDKPYRCEVCDKRYKNLNGLKYHRKHSH 422


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
KOG2462|consensus279 99.96
KOG2462|consensus279 99.96
KOG1074|consensus 958 99.75
KOG3576|consensus267 99.73
KOG1074|consensus958 99.73
KOG3623|consensus 1007 99.71
KOG3608|consensus 467 99.67
KOG3576|consensus267 99.65
KOG3623|consensus1007 99.61
KOG3608|consensus467 99.52
PHA00733128 hypothetical protein 99.33
PLN03086567 PRLI-interacting factor K; Provisional 99.22
PHA0276855 hypothetical protein; Provisional 99.17
PHA00733128 hypothetical protein 99.04
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.03
PHA0061644 hypothetical protein 98.96
PLN03086567 PRLI-interacting factor K; Provisional 98.91
PHA0276855 hypothetical protein; Provisional 98.9
KOG3993|consensus 500 98.54
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.54
PHA0073279 hypothetical protein 98.54
PHA0061644 hypothetical protein 98.54
KOG3993|consensus500 98.51
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.48
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.4
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.38
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 98.3
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.3
PHA0073279 hypothetical protein 98.18
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.17
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.11
COG5189423 SFP1 Putative transcriptional repressor regulating 97.97
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.96
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.87
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.84
smart0035526 ZnF_C2H2 zinc finger. 97.7
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.64
smart0035526 ZnF_C2H2 zinc finger. 97.57
COG5189423 SFP1 Putative transcriptional repressor regulating 97.55
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.51
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.32
PRK04860160 hypothetical protein; Provisional 97.2
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.13
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.04
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.78
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.73
KOG2231|consensus 669 96.67
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.18
COG404965 Uncharacterized protein containing archaeal-type C 95.69
KOG2893|consensus 341 95.66
COG404965 Uncharacterized protein containing archaeal-type C 95.6
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.6
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.37
KOG4173|consensus253 95.1
PRK04860160 hypothetical protein; Provisional 95.09
KOG1146|consensus 1406 94.49
COG1592166 Rubrerythrin [Energy production and conversion] 93.86
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.06
COG5048 467 FOG: Zn-finger [General function prediction only] 92.82
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.77
KOG4173|consensus253 92.76
KOG1146|consensus1406 92.69
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.64
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 92.07
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 92.0
KOG2893|consensus 341 91.01
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 90.81
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.69
KOG2186|consensus 276 90.66
PF1290740 zf-met2: Zinc-binding 90.62
KOG2482|consensus423 89.91
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 89.85
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 89.23
PF1371736 zinc_ribbon_4: zinc-ribbon domain 89.16
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 89.02
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.57
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.47
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 88.39
KOG2482|consensus 423 87.64
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 86.34
KOG2785|consensus 390 85.9
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 85.58
COG5048467 FOG: Zn-finger [General function prediction only] 85.45
PF1371937 zinc_ribbon_5: zinc-ribbon domain 83.47
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 82.94
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 82.75
KOG4167|consensus907 82.62
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 82.31
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 81.63
PRK00464154 nrdR transcriptional regulator NrdR; Validated 81.45
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.26
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 80.29
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=7.8e-30  Score=157.04  Aligned_cols=107  Identities=31%  Similarity=0.646  Sum_probs=89.2

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      .+.+.|+.||++|.+..+|..|+++|..      +..|.   +||+.|...+.|+.|+ +.|+|+|||.|..|+++|.+.
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~l------~c~C~---iCGKaFSRPWLLQGHi-RTHTGEKPF~C~hC~kAFADR  228 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHTL------PCECG---ICGKAFSRPWLLQGHI-RTHTGEKPFSCPHCGKAFADR  228 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccCC------Ccccc---cccccccchHHhhccc-ccccCCCCccCCcccchhcch
Confidence            5567788888888888888888888753      27777   8888888888888888 778888888888888888888


Q ss_pred             hhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHh
Q psy6628          89 YDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus        89 ~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      ++|+.||++|.+.|.|+|+.|+|.|+..+.|.+|...
T Consensus       229 SNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  229 SNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            8888888888888888888888888888888888754



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-13
2i13_A 190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-08
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-08
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-04
2ep1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 9e-05
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 9e-05
2ysp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2em7_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2eof_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 41/98 (41%), Positives = 54/98 (55%), Gaps = 8/98 (8%) Query: 12 FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQ 71 + C C K FS + L H R G E+P +KC EC + F+ + L H +R H Sbjct: 22 YACPECGKSFSRSDHLAEHQRTHTG---EKP-YKCP---ECGKSFSDKKDLTRH-QRTHT 73 Query: 72 KEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFC 109 EKPY+C +C KSF + + + H R HTGEKPYAC C Sbjct: 74 GEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPEC 111
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EP1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 435- 467) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YSP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 507- 539) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EM7|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 339- 371) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 411- 441) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-12
2rpc_A 155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-24
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-19
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 7e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-13
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 1e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-16
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-17
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-16
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-12
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 9e-05
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 93.1 bits (232), Expect = 2e-25
 Identities = 40/119 (33%), Positives = 52/119 (43%), Gaps = 7/119 (5%)

Query: 12  FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRG--ECDRVFTTRNMLNIHIKRD 69
              + C + FS  + L  HV  +H    E+    C         + F  +  L  HI R 
Sbjct: 26  RPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHI-RV 84

Query: 70  HQKEKPYQCS--QCSKSFFSKYDHKIHSRVHTGEKPYACEF--CPLTFRHSSHLFRHRR 124
           H  EKP+ C    C K F    + KIH R HTGEKP+ CEF  C   F +SS   +H  
Sbjct: 85  HTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMH 143


>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.95
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.95
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.89
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.88
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.87
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.86
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.86
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.84
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.83
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.8
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.79
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.78
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.77
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.76
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.76
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.75
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.75
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.75
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.75
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.74
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.74
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.74
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.73
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.72
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.71
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.71
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.69
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.69
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.68
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.65
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.65
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.63
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.62
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.62
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.57
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.56
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.56
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.55
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.54
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.49
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.47
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.47
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.46
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.45
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.45
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.45
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.44
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.44
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.44
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.43
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.43
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.42
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.42
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.42
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.41
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.4
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.39
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.39
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.33
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.32
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.32
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.32
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.3
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.29
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.29
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.29
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.28
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.28
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.27
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.26
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.26
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.25
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.25
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.24
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.23
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.21
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.21
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.21
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.2
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.19
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.18
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.18
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.16
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.16
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.13
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.13
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.1
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.04
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.99
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.93
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.92
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.9
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.89
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.89
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.89
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.88
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.88
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.87
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.84
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.84
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.83
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.82
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.8
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.8
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.79
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.79
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.25
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.25
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.75
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.75
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.74
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.72
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.72
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.69
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.69
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.64
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.62
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.59
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.58
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.98
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.55
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.53
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.5
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.5
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.49
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.47
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.47
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.46
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.45
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.45
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.44
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.41
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.38
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.38
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.37
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.71
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.67
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.29
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.61
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.21
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.05
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.03
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.63
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.26
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.18
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.93
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.69
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 96.23
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.08
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.82
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.76
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 93.58
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.2
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 92.11
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 91.71
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 91.38
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.94
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 90.6
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 90.59
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 90.47
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.26
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 89.97
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 89.65
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 87.53
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 87.2
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 87.07
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 85.98
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 85.19
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.38
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 81.71
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 80.48
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=2.6e-30  Score=156.86  Aligned_cols=117  Identities=38%  Similarity=0.740  Sum_probs=90.0

Q ss_pred             cceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccC
Q psy6628           8 HRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFS   87 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~   87 (132)
                      ++++|.|+.|++.|.....|..|+..|.+   +.+ |.|+   .|++.|.....|..|+ ..|.++++|.|..|++.|..
T Consensus        74 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~-~~C~---~C~~~f~~~~~l~~H~-~~h~~~~~~~C~~C~~~f~~  145 (190)
T 2i13_A           74 GEKPYKCPECGKSFSQRANLRAHQRTHTG---EKP-YACP---ECGKSFSQLAHLRAHQ-RTHTGEKPYKCPECGKSFSR  145 (190)
T ss_dssp             CCCCEECTTTCCEESCHHHHHHHHHHHHT---CCC-EECT---TTCCEESSHHHHHHHH-HHHHCCCCEECTTTCCEESC
T ss_pred             CCCCccCcccCCccCCHHHHHHHHHhcCC---CCC-CcCC---CCCCccCCHHHHHHHH-HHhCCCCCeECCCCCcccCC
Confidence            45567777777777777777777777665   444 7787   7888888888888887 66888888888888888888


Q ss_pred             hhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhhhhhccC
Q psy6628          88 KYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ  132 (132)
Q Consensus        88 ~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  132 (132)
                      ...|..|+..|.+++||.|++|++.|...+.|..|++.|+|++||
T Consensus       146 ~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          146 EDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             HHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            888888888888888899999999999888999998888888886



>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 9e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.5 bits (111), Expect = 5e-09
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 73  EKPYQCSQCSKSFFSKYDHKIHSR-VHTGEKPYACE 107
            KPY C  C K F        H + VHT E+P+ C+
Sbjct: 3   GKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQ 38


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.79
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.53
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.52
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.5
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.46
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.44
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.41
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.37
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.37
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.34
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.33
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.29
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.25
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.21
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.17
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.15
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.13
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.13
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.12
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.1
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.0
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.99
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.99
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.85
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.69
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.61
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.57
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.55
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.37
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.21
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.2
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.2
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.17
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.17
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.14
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.12
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.97
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.95
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.95
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.93
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.89
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.84
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.83
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.78
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.72
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.66
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.56
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.56
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.55
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.55
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.52
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.46
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.45
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.25
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.24
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.23
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.2
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.18
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.15
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.09
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.01
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.95
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.94
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.94
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.81
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.8
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.7
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.43
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 96.18
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.14
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.77
d1y0jb136 U-shaped transcription factor, different fingers { 95.49
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.36
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.25
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.21
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 94.94
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 94.83
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.79
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.79
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.74
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.64
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.59
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 93.27
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.15
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.7
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.48
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.49
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 89.9
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 89.7
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.31
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 87.83
d1fu9a_36 U-shaped transcription factor, different fingers { 87.57
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 87.18
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.55
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 83.24
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 83.04
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 82.96
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 81.97
d2ct5a160 Zinc finger BED domain-containing protein 1 {Human 80.77
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=4.3e-20  Score=88.29  Aligned_cols=53  Identities=36%  Similarity=0.743  Sum_probs=50.5

Q ss_pred             CCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhh
Q psy6628          73 EKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSL  126 (132)
Q Consensus        73 ~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  126 (132)
                      +|||.|+ ||+.|.....|..|+.+|++++||.|.+|++.|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5799995 9999999999999999999999999999999999999999999875



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure