Psyllid ID: psy66
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 328701837 | 496 | PREDICTED: facilitated trehalose transpo | 0.743 | 0.245 | 0.456 | 5e-25 | |
| 357611704 | 583 | hypothetical protein KGM_13558 [Danaus p | 0.676 | 0.190 | 0.351 | 8e-17 | |
| 91085493 | 539 | PREDICTED: similar to sugar transporter | 0.707 | 0.215 | 0.32 | 4e-15 | |
| 322794505 | 513 | hypothetical protein SINV_10456 [Solenop | 0.75 | 0.239 | 0.341 | 5e-15 | |
| 307202951 | 521 | Solute carrier family 2, facilitated glu | 0.743 | 0.234 | 0.352 | 1e-14 | |
| 242017426 | 515 | conserved hypothetical protein [Pediculu | 0.725 | 0.231 | 0.336 | 2e-14 | |
| 91085503 | 518 | PREDICTED: similar to sugar transporter | 0.743 | 0.235 | 0.325 | 2e-14 | |
| 260806545 | 507 | hypothetical protein BRAFLDRAFT_82927 [B | 0.719 | 0.232 | 0.379 | 3e-14 | |
| 270008828 | 522 | hypothetical protein TcasGA2_TC015433 [T | 0.621 | 0.195 | 0.392 | 3e-14 | |
| 91084359 | 484 | PREDICTED: similar to AGAP007667-PA [Tri | 0.792 | 0.268 | 0.360 | 4e-14 |
| >gi|328701837|ref|XP_001944504.2| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 119 bits (297), Expect = 5e-25, Method: Compositional matrix adjust.
Identities = 57/125 (45%), Positives = 82/125 (65%), Gaps = 3/125 (2%)
Query: 1 MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISF 60
M S+ YVYV+E+SL +RG+ +S GP+FVS+GVL VY G ++ WQ+V CA T+ +SF
Sbjct: 128 MSSACYVYVAEVSLAKHRGVLSSFGPIFVSIGVLIVYSLGSIMPWQVVSIPCALTSLLSF 187
Query: 61 IIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQT 120
+ V PE+P+W ASKG V + SL WLR ++A+ E+A+IL ++ D S
Sbjct: 188 LSVNLTPESPSWLASKGRVADAGKSLMWLRRKPSLADKELAEILNNLG---DGNGSTAPM 244
Query: 121 LREFT 125
LR+FT
Sbjct: 245 LRDFT 249
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357611704|gb|EHJ67616.1| hypothetical protein KGM_13558 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|91085493|ref|XP_971034.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] gi|270008379|gb|EFA04827.1| hypothetical protein TcasGA2_TC014877 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|322794505|gb|EFZ17558.1| hypothetical protein SINV_10456 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307202951|gb|EFN82171.1| Solute carrier family 2, facilitated glucose transporter member 6 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242017426|ref|XP_002429189.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514078|gb|EEB16451.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91085503|ref|XP_971406.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] gi|270008374|gb|EFA04822.1| hypothetical protein TcasGA2_TC014872 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|260806545|ref|XP_002598144.1| hypothetical protein BRAFLDRAFT_82927 [Branchiostoma floridae] gi|229283416|gb|EEN54156.1| hypothetical protein BRAFLDRAFT_82927 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|270008828|gb|EFA05276.1| hypothetical protein TcasGA2_TC015433 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91084359|ref|XP_973264.1| PREDICTED: similar to AGAP007667-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| UNIPROTKB|A9ZSY3 | 505 | Tret1 "Facilitated trehalose t | 0.737 | 0.239 | 0.322 | 1e-12 | |
| UNIPROTKB|B4HNS1 | 488 | Tret1-2 "Facilitated trehalose | 0.676 | 0.227 | 0.300 | 2.6e-12 | |
| UNIPROTKB|B4P624 | 856 | Tret1 "Facilitated trehalose t | 0.780 | 0.149 | 0.291 | 5e-12 | |
| FB|FBgn0050035 | 857 | Tret1-1 "Trehalose transporter | 0.774 | 0.148 | 0.274 | 5e-12 | |
| UNIPROTKB|B4HNS0 | 857 | Tret1-1 "Facilitated trehalose | 0.774 | 0.148 | 0.274 | 5e-12 | |
| UNIPROTKB|B4MYA4 | 872 | Tret1 "Facilitated trehalose t | 0.780 | 0.146 | 0.299 | 5.1e-12 | |
| UNIPROTKB|B4QBN3 | 488 | Tret1-2 "Facilitated trehalose | 0.664 | 0.223 | 0.293 | 5.5e-12 | |
| UNIPROTKB|B3NSE1 | 856 | Tret1 "Facilitated trehalose t | 0.780 | 0.149 | 0.284 | 8.2e-12 | |
| UNIPROTKB|B4QBN2 | 857 | Tret1-1 "Facilitated trehalose | 0.695 | 0.133 | 0.296 | 8.2e-12 | |
| UNIPROTKB|B0WC46 | 517 | Tret1 "Facilitated trehalose t | 0.634 | 0.201 | 0.339 | 1e-11 |
| UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] | Back alignment and assigned GO terms |
|---|
Score = 177 (67.4 bits), Expect = 1.0e-12, P = 1.0e-12
Identities = 40/124 (32%), Positives = 59/124 (47%)
Query: 7 VYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFM 66
VY+ E P RG L F + G+L + G L W + +F AA F+++
Sbjct: 164 VYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILT 223
Query: 67 PETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTP 126
PETP WY SK V ++ SL WLR + E+ D+ +IS+ E D+ G ++
Sbjct: 224 PETPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDL--TISQTESDRTG-GNAFKQLFS 280
Query: 127 IRIL 130
R L
Sbjct: 281 KRYL 284
|
|
| UNIPROTKB|B4HNS1 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila sechellia (taxid:7238)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4P624 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila yakuba (taxid:7245)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0050035 Tret1-1 "Trehalose transporter 1-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4HNS0 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila sechellia (taxid:7238)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4MYA4 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila willistoni (taxid:7260)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4QBN3 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila simulans (taxid:7240)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3NSE1 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila erecta (taxid:7220)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4QBN2 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila simulans (taxid:7240)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| pfam00083 | 449 | pfam00083, Sugar_tr, Sugar (and other) transporter | 8e-11 | |
| TIGR00879 | 481 | TIGR00879, SP, MFS transporter, sugar porter (SP) | 3e-10 | |
| TIGR00898 | 505 | TIGR00898, 2A0119, cation transport protein | 0.003 |
| >gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter | Back alignment and domain information |
|---|
Score = 58.8 bits (143), Expect = 8e-11
Identities = 35/141 (24%), Positives = 55/141 (39%), Gaps = 9/141 (6%)
Query: 7 VYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML-------HWQIVCYFCAATACIS 59
+Y+SEI+ RG SL + ++ G+L G L W+I A +
Sbjct: 124 MYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLNKYSNSDGWRIPLGLQFVPAILL 183
Query: 60 FIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQ 119
I + F+PE+P W KG + ++ A L LR S + EI + S+ ER + +
Sbjct: 184 LIGLLFLPESPRWLVLKGKLEEARAVLAKLRGVS-DVDQEIQEEKDSL-ERSVEAEKASW 241
Query: 120 TLREFTPIRILTTRNVASLQC 140
LQ
Sbjct: 242 LELFRGKTVRQRLLMGVMLQI 262
|
Length = 449 |
| >gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| KOG0569|consensus | 485 | 99.9 | ||
| KOG0254|consensus | 513 | 99.79 | ||
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 99.74 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 99.72 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 99.7 | |
| KOG0255|consensus | 521 | 99.68 | ||
| TIGR00898 | 505 | 2A0119 cation transport protein. | 99.66 | |
| KOG0253|consensus | 528 | 99.54 | ||
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 99.4 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 99.26 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 99.21 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 99.1 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 98.81 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 98.8 | |
| KOG0252|consensus | 538 | 98.78 | ||
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 98.72 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 98.7 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 98.65 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 98.52 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 98.51 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 98.46 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 98.44 | |
| KOG2533|consensus | 495 | 98.39 | ||
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 98.32 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 98.28 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 98.21 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 98.19 | |
| KOG2532|consensus | 466 | 98.18 | ||
| PRK15075 | 434 | citrate-proton symporter; Provisional | 98.15 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 98.12 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 98.11 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 98.09 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 98.08 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 98.08 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 98.02 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 97.96 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 97.92 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 97.91 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 97.9 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 97.89 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 97.88 | |
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 97.87 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 97.87 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 97.85 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 97.85 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 97.82 | |
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 97.75 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 97.72 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 97.67 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 97.66 | |
| KOG2615|consensus | 451 | 97.65 | ||
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 97.65 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 97.64 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 97.59 | |
| PRK12382 | 392 | putative transporter; Provisional | 97.56 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.56 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 97.54 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 97.53 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 97.46 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 97.44 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 97.41 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 97.39 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 97.38 | |
| PRK11043 | 401 | putative transporter; Provisional | 97.37 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 97.34 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 97.29 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 97.28 | |
| KOG1330|consensus | 493 | 97.17 | ||
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 97.17 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 97.16 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 97.15 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 97.15 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 97.1 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 97.05 | |
| PRK03699 | 394 | putative transporter; Provisional | 97.04 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 97.01 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 97.01 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 97.01 | |
| PRK10504 | 471 | putative transporter; Provisional | 96.93 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.91 | |
| PRK10054 | 395 | putative transporter; Provisional | 96.9 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.88 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 96.85 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 96.79 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 96.78 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 96.7 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 96.69 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 96.67 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 96.56 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 96.55 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 96.47 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 96.47 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 96.36 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 96.34 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.28 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 96.24 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 96.23 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 96.2 | |
| PRK12382 | 392 | putative transporter; Provisional | 96.14 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.09 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 95.96 | |
| KOG3626|consensus | 735 | 95.92 | ||
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 95.92 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 95.89 | |
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 95.88 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 95.79 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 95.71 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 95.7 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 95.68 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 95.66 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 95.65 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 95.63 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 95.56 | |
| PF03137 | 539 | OATP: Organic Anion Transporter Polypeptide (OATP) | 95.51 | |
| KOG0569|consensus | 485 | 95.46 | ||
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 95.4 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 95.33 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 95.27 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 95.26 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 95.2 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 95.18 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 95.02 | |
| PF03209 | 403 | PUCC: PUCC protein; InterPro: IPR004896 This prote | 94.99 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 94.88 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 94.88 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 94.74 | |
| COG0738 | 422 | FucP Fucose permease [Carbohydrate transport and m | 94.54 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 94.47 | |
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 94.45 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 94.45 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 94.22 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 94.09 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 94.08 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 93.61 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 93.58 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 93.36 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 93.32 | |
| PRK11462 | 460 | putative transporter; Provisional | 93.26 | |
| PF01770 | 412 | Folate_carrier: Reduced folate carrier; InterPro: | 93.21 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 93.18 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 93.06 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 93.05 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 92.92 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 92.73 | |
| KOG2816|consensus | 463 | 92.46 | ||
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 92.31 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 92.26 | |
| KOG3764|consensus | 464 | 92.24 | ||
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 91.94 | |
| COG2211 | 467 | MelB Na+/melibiose symporter and related transport | 91.74 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 91.56 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 91.2 | |
| PRK10504 | 471 | putative transporter; Provisional | 91.19 | |
| KOG0255|consensus | 521 | 91.1 | ||
| KOG0252|consensus | 538 | 90.8 | ||
| PF03092 | 433 | BT1: BT1 family; InterPro: IPR004324 Members of th | 90.5 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 89.84 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 89.66 | |
| PF07672 | 267 | MFS_Mycoplasma: Mycoplasma MFS transporter; InterP | 89.19 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 89.14 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 88.94 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 87.63 | |
| PRK10054 | 395 | putative transporter; Provisional | 86.4 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 86.39 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 86.35 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 86.31 | |
| KOG0254|consensus | 513 | 86.29 | ||
| KOG3810|consensus | 433 | 86.09 | ||
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 85.81 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 85.15 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 85.0 | |
| KOG2504|consensus | 509 | 84.03 | ||
| COG3202 | 509 | ATP/ADP translocase [Energy production and convers | 83.7 | |
| PF06813 | 250 | Nodulin-like: Nodulin-like; InterPro: IPR010658 Th | 82.69 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 82.44 | |
| KOG0253|consensus | 528 | 81.88 | ||
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 80.96 | |
| PRK03699 | 394 | putative transporter; Provisional | 80.92 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 80.83 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 80.61 |
| >KOG0569|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.2e-22 Score=161.61 Aligned_cols=138 Identities=22% Similarity=0.275 Sum_probs=112.7
Q ss_pred ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH------hHHHHHHHHHHHHHHHHHHHhhcCCchHHHHh-
Q psy66 3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML------HWQIVCYFCAATACISFIIVTFMPETPAWYAS- 75 (164)
Q Consensus 3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~------~Wr~~~~~~~~~~~l~~~~~~~~pESp~~l~~- 75 (164)
...|+|+.|++|++.||..+++.+++..+|.+++..++... .|++++.+..+|+++.++..+++|||||||+.
T Consensus 135 ~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~l~~~PESPk~Ll~~ 214 (485)
T KOG0569|consen 135 GLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLALLPFLPESPKYLLIK 214 (485)
T ss_pred HHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHHHhcCCCCcchHHHH
Confidence 46799999999999999999999999999999998888766 79999999999999999999999999999997
Q ss_pred cCCHHHHHHHHHHHhCCChhhHHHHHHHHHHHHhh--hhcccchhhhhhccchH-HHHHHHHHHHHHH
Q psy66 76 KGLVVKSSASLNWLRNSSAIANAEIADILQSISER--EDDKKSCGQTLREFTPI-RILTTRNVASLQC 140 (164)
Q Consensus 76 ~~~~~~a~~~l~~i~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~l~~~~~~~-~~~~~~~l~~~~~ 140 (164)
|||.+||++.++++++++++..+..++..+.++++ ++++.+++|+++++..| .+.+++.+.+.|.
T Consensus 215 k~~~~~A~~sl~~y~G~~~~~~~~e~~~~e~~~~~~~~~~~~sl~~~~~~~~lR~~~~i~~~v~~~qq 282 (485)
T KOG0569|consen 215 KGDEEEARKALKFYRGKEDVEAEIEEMLREIEEEELEKKKQISLRQLLKNPTLRRPLLIGIVVSFAQQ 282 (485)
T ss_pred cCCHHHHHHHHHHHhCCCcchhHHHHHHHHHHHhccccccCCcHHHHhcCcchhHHHHHHHHHHHHHH
Confidence 99999999999999997543333323223322222 23667899999997555 5567777777665
|
|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >KOG2533|consensus | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >KOG2816|consensus | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >KOG3764|consensus | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >KOG3810|consensus | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2504|consensus | Back alignment and domain information |
|---|
| >COG3202 ATP/ADP translocase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 99.71 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 98.47 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 98.3 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 98.1 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 97.7 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 97.51 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.07 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 96.35 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 95.79 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 95.71 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 94.71 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 86.76 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 86.09 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 85.39 |
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
Probab=99.71 E-value=2.3e-16 Score=124.76 Aligned_cols=90 Identities=21% Similarity=0.451 Sum_probs=83.5
Q ss_pred ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH------------hHHHHHHHHHHHHHHHHHHHhhcCCch
Q psy66 3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML------------HWQIVCYFCAATACISFIIVTFMPETP 70 (164)
Q Consensus 3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~------------~Wr~~~~~~~~~~~l~~~~~~~~pESp 70 (164)
+++++|++|++|+++||+..++.+.++.+|.++++.++... +||+++.+..+++++.++..+++||||
T Consensus 145 ~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp 224 (491)
T 4gc0_A 145 MLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESP 224 (491)
T ss_dssp HHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGSCCCH
T ss_pred HHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcCCCCh
Confidence 46789999999999999999999999999999999988755 799999999999999999999999999
Q ss_pred HHHHhcCCHHHHHHHHHHHhCC
Q psy66 71 AWYASKGLVVKSSASLNWLRNS 92 (164)
Q Consensus 71 ~~l~~~~~~~~a~~~l~~i~~~ 92 (164)
|||..|++.|++++.+++..++
T Consensus 225 ~~L~~~~~~~~a~~~l~~~~~~ 246 (491)
T 4gc0_A 225 RWLMSRGKQEQAEGILRKIMGN 246 (491)
T ss_dssp HHHHHTTCHHHHHHHHHHHHHH
T ss_pred HHHHHcCchhHHHHhHHHhcCC
Confidence 9999999999999999988764
|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 98.32 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 97.35 | |
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 96.29 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 89.77 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=98.32 E-value=2e-07 Score=70.09 Aligned_cols=70 Identities=16% Similarity=0.054 Sum_probs=56.2
Q ss_pred ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH-----hHHHHHHHHHHHHHHHH-HHHhhcCCchHH
Q psy66 3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML-----HWQIVCYFCAATACISF-IIVTFMPETPAW 72 (164)
Q Consensus 3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~-----~Wr~~~~~~~~~~~l~~-~~~~~~pESp~~ 72 (164)
+....++.|+.|+++||+..++.+.+..+|.++++.++... +||+.+++..++.++.. +...+++|+|+.
T Consensus 135 ~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 (447)
T d1pw4a_ 135 PPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQS 210 (447)
T ss_dssp HHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred hHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence 34567899999999999999999999999999988876654 89999888887766554 445567777754
|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|