Psyllid ID: psy66


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
ccccccHHcccccccccccHHHcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccccEEEEEcccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHccEEEEcEccc
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTfmpetpawyaskGLVVKSSASLNWLRNSSAIANAEIADILQSISereddkkscgqtlreftpiriltTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSisereddkkscgqtlreftpirilttRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
****TYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQS**********CGQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYC*
*GSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADI*******************EFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSIS*********GQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
**SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTPIRILTTRNVASLQCSIENSCNQRAIATGYLCMYDFYCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
A9ZSY3 505 Facilitated trehalose tra N/A N/A 0.737 0.239 0.322 8e-13
B4HNS1 488 Facilitated trehalose tra N/A N/A 0.731 0.245 0.286 1e-12
B4QBN3 488 Facilitated trehalose tra N/A N/A 0.682 0.229 0.294 2e-12
B4MYA4 872 Facilitated trehalose tra N/A N/A 0.786 0.147 0.294 2e-12
B4P624 856 Facilitated trehalose tra N/A N/A 0.786 0.150 0.279 2e-12
B3NSE1 856 Facilitated trehalose tra N/A N/A 0.786 0.150 0.272 3e-12
B4QBN2 857 Facilitated trehalose tra N/A N/A 0.707 0.135 0.279 3e-12
Q8MKK4 488 Facilitated trehalose tra no N/A 0.731 0.245 0.270 7e-12
B4HNS0 857 Facilitated trehalose tra N/A N/A 0.689 0.131 0.278 9e-12
A1Z8N1 857 Facilitated trehalose tra no N/A 0.689 0.131 0.278 9e-12
>sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 7   VYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFM 66
           VY+ E   P  RG    L   F + G+L  +  G  L W  + +F AA     F+++   
Sbjct: 164 VYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILT 223

Query: 67  PETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTP 126
           PETP WY SK  V ++  SL WLR  +     E+ D+  +IS+ E D ++ G   ++   
Sbjct: 224 PETPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDL--TISQTESD-RTGGNAFKQLFS 280

Query: 127 IRIL 130
            R L
Sbjct: 281 KRYL 284




High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Bombyx mori (taxid: 7091)
>sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 Back     alignment and function description
>sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 Back     alignment and function description
>sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 Back     alignment and function description
>sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 Back     alignment and function description
>sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 Back     alignment and function description
>sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
328701837 496 PREDICTED: facilitated trehalose transpo 0.743 0.245 0.456 5e-25
357611704 583 hypothetical protein KGM_13558 [Danaus p 0.676 0.190 0.351 8e-17
91085493 539 PREDICTED: similar to sugar transporter 0.707 0.215 0.32 4e-15
322794505 513 hypothetical protein SINV_10456 [Solenop 0.75 0.239 0.341 5e-15
307202951 521 Solute carrier family 2, facilitated glu 0.743 0.234 0.352 1e-14
242017426 515 conserved hypothetical protein [Pediculu 0.725 0.231 0.336 2e-14
91085503 518 PREDICTED: similar to sugar transporter 0.743 0.235 0.325 2e-14
260806545 507 hypothetical protein BRAFLDRAFT_82927 [B 0.719 0.232 0.379 3e-14
270008828 522 hypothetical protein TcasGA2_TC015433 [T 0.621 0.195 0.392 3e-14
91084359 484 PREDICTED: similar to AGAP007667-PA [Tri 0.792 0.268 0.360 4e-14
>gi|328701837|ref|XP_001944504.2| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 82/125 (65%), Gaps = 3/125 (2%)

Query: 1   MGSSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISF 60
           M S+ YVYV+E+SL  +RG+ +S GP+FVS+GVL VY  G ++ WQ+V   CA T+ +SF
Sbjct: 128 MSSACYVYVAEVSLAKHRGVLSSFGPIFVSIGVLIVYSLGSIMPWQVVSIPCALTSLLSF 187

Query: 61  IIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQT 120
           + V   PE+P+W ASKG V  +  SL WLR   ++A+ E+A+IL ++    D   S    
Sbjct: 188 LSVNLTPESPSWLASKGRVADAGKSLMWLRRKPSLADKELAEILNNLG---DGNGSTAPM 244

Query: 121 LREFT 125
           LR+FT
Sbjct: 245 LRDFT 249




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357611704|gb|EHJ67616.1| hypothetical protein KGM_13558 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91085493|ref|XP_971034.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] gi|270008379|gb|EFA04827.1| hypothetical protein TcasGA2_TC014877 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322794505|gb|EFZ17558.1| hypothetical protein SINV_10456 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307202951|gb|EFN82171.1| Solute carrier family 2, facilitated glucose transporter member 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242017426|ref|XP_002429189.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514078|gb|EEB16451.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91085503|ref|XP_971406.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] gi|270008374|gb|EFA04822.1| hypothetical protein TcasGA2_TC014872 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|260806545|ref|XP_002598144.1| hypothetical protein BRAFLDRAFT_82927 [Branchiostoma floridae] gi|229283416|gb|EEN54156.1| hypothetical protein BRAFLDRAFT_82927 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|270008828|gb|EFA05276.1| hypothetical protein TcasGA2_TC015433 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91084359|ref|XP_973264.1| PREDICTED: similar to AGAP007667-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
UNIPROTKB|A9ZSY3 505 Tret1 "Facilitated trehalose t 0.737 0.239 0.322 1e-12
UNIPROTKB|B4HNS1 488 Tret1-2 "Facilitated trehalose 0.676 0.227 0.300 2.6e-12
UNIPROTKB|B4P624 856 Tret1 "Facilitated trehalose t 0.780 0.149 0.291 5e-12
FB|FBgn0050035 857 Tret1-1 "Trehalose transporter 0.774 0.148 0.274 5e-12
UNIPROTKB|B4HNS0 857 Tret1-1 "Facilitated trehalose 0.774 0.148 0.274 5e-12
UNIPROTKB|B4MYA4 872 Tret1 "Facilitated trehalose t 0.780 0.146 0.299 5.1e-12
UNIPROTKB|B4QBN3 488 Tret1-2 "Facilitated trehalose 0.664 0.223 0.293 5.5e-12
UNIPROTKB|B3NSE1 856 Tret1 "Facilitated trehalose t 0.780 0.149 0.284 8.2e-12
UNIPROTKB|B4QBN2 857 Tret1-1 "Facilitated trehalose 0.695 0.133 0.296 8.2e-12
UNIPROTKB|B0WC46 517 Tret1 "Facilitated trehalose t 0.634 0.201 0.339 1e-11
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.0e-12, P = 1.0e-12
 Identities = 40/124 (32%), Positives = 59/124 (47%)

Query:     7 VYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYMLHWQIVCYFCAATACISFIIVTFM 66
             VY+ E   P  RG    L   F + G+L  +  G  L W  + +F AA     F+++   
Sbjct:   164 VYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILT 223

Query:    67 PETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQTLREFTP 126
             PETP WY SK  V ++  SL WLR  +     E+ D+  +IS+ E D+   G   ++   
Sbjct:   224 PETPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDL--TISQTESDRTG-GNAFKQLFS 280

Query:   127 IRIL 130
              R L
Sbjct:   281 KRYL 284




GO:0015574 "trehalose transmembrane transporter activity" evidence=IDA
GO:0015771 "trehalose transport" evidence=IDA
GO:0044459 "plasma membrane part" evidence=IDA
GO:0015767 "lactose transport" evidence=IDA
GO:0015768 "maltose transport" evidence=IDA
GO:0015770 "sucrose transport" evidence=IDA
UNIPROTKB|B4HNS1 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4P624 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0050035 Tret1-1 "Trehalose transporter 1-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS0 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4MYA4 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN3 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B3NSE1 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN2 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 8e-11
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 3e-10
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 0.003
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
 Score = 58.8 bits (143), Expect = 8e-11
 Identities = 35/141 (24%), Positives = 55/141 (39%), Gaps = 9/141 (6%)

Query: 7   VYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML-------HWQIVCYFCAATACIS 59
           +Y+SEI+    RG   SL  + ++ G+L     G  L        W+I        A + 
Sbjct: 124 MYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLNKYSNSDGWRIPLGLQFVPAILL 183

Query: 60  FIIVTFMPETPAWYASKGLVVKSSASLNWLRNSSAIANAEIADILQSISEREDDKKSCGQ 119
            I + F+PE+P W   KG + ++ A L  LR  S   + EI +   S+ ER  + +    
Sbjct: 184 LIGLLFLPESPRWLVLKGKLEEARAVLAKLRGVS-DVDQEIQEEKDSL-ERSVEAEKASW 241

Query: 120 TLREFTPIRILTTRNVASLQC 140
                             LQ 
Sbjct: 242 LELFRGKTVRQRLLMGVMLQI 262


Length = 449

>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
KOG0569|consensus 485 99.9
KOG0254|consensus 513 99.79
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.74
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.72
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.7
KOG0255|consensus 521 99.68
TIGR00898 505 2A0119 cation transport protein. 99.66
KOG0253|consensus 528 99.54
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.4
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.26
PRK10642490 proline/glycine betaine transporter; Provisional 99.21
PRK10642 490 proline/glycine betaine transporter; Provisional 99.1
TIGR00895 398 2A0115 benzoate transport. 98.81
PRK09952 438 shikimate transporter; Provisional 98.8
KOG0252|consensus 538 98.78
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.72
TIGR00891 405 2A0112 putative sialic acid transporter. 98.7
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.65
PRK12307 426 putative sialic acid transporter; Provisional 98.52
TIGR00893 399 2A0114 d-galactonate transporter. 98.51
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.46
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.44
KOG2533|consensus 495 98.39
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 98.32
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.28
PRK11663 434 regulatory protein UhpC; Provisional 98.21
PRK03893 496 putative sialic acid transporter; Provisional 98.19
KOG2532|consensus 466 98.18
PRK15075 434 citrate-proton symporter; Provisional 98.15
TIGR00901356 2A0125 AmpG-related permease. 98.12
PRK11010 491 ampG muropeptide transporter; Validated 98.11
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.09
PRK11902 402 ampG muropeptide transporter; Reviewed 98.08
TIGR00900365 2A0121 H+ Antiporter protein. 98.08
TIGR00805 633 oat sodium-independent organic anion transporter. 98.02
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.96
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 97.92
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.91
PTZ00207 591 hypothetical protein; Provisional 97.9
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.89
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.88
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.87
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 97.87
PRK03545 390 putative arabinose transporter; Provisional 97.85
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.85
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.82
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.75
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.72
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 97.67
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.66
KOG2615|consensus 451 97.65
PRK10091 382 MFS transport protein AraJ; Provisional 97.65
PRK10489 417 enterobactin exporter EntS; Provisional 97.64
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.59
PRK12382392 putative transporter; Provisional 97.56
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.56
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.54
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.53
PRK05122 399 major facilitator superfamily transporter; Provisi 97.46
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.44
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.41
PLN00028 476 nitrate transmembrane transporter; Provisional 97.39
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.38
PRK11043 401 putative transporter; Provisional 97.37
PRK09874 408 drug efflux system protein MdtG; Provisional 97.34
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.29
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 97.28
KOG1330|consensus 493 97.17
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.17
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.16
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.15
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.15
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.1
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.05
PRK03699 394 putative transporter; Provisional 97.04
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 97.01
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.01
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.01
PRK10504 471 putative transporter; Provisional 96.93
PRK15011 393 sugar efflux transporter B; Provisional 96.91
PRK10054 395 putative transporter; Provisional 96.9
PRK15011393 sugar efflux transporter B; Provisional 96.88
TIGR00898505 2A0119 cation transport protein. 96.85
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.79
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.78
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 96.7
PRK05122399 major facilitator superfamily transporter; Provisi 96.69
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 96.67
TIGR00896355 CynX cyanate transporter. This family of proteins 96.56
TIGR01272310 gluP glucose/galactose transporter. Disruption of 96.55
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 96.47
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 96.47
TIGR00893399 2A0114 d-galactonate transporter. 96.36
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 96.34
TIGR00892 455 2A0113 monocarboxylate transporter 1. 96.28
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 96.24
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 96.23
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 96.2
PRK12382392 putative transporter; Provisional 96.14
TIGR00892455 2A0113 monocarboxylate transporter 1. 96.09
PRK09528420 lacY galactoside permease; Reviewed 95.96
KOG3626|consensus 735 95.92
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 95.92
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.89
PF13347 428 MFS_2: MFS/sugar transport protein 95.88
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.79
PRK09952438 shikimate transporter; Provisional 95.71
PRK03633381 putative MFS family transporter protein; Provision 95.7
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 95.68
PRK10489417 enterobactin exporter EntS; Provisional 95.66
PRK09705 393 cynX putative cyanate transporter; Provisional 95.65
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 95.63
PRK09584 500 tppB putative tripeptide transporter permease; Rev 95.56
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 95.51
KOG0569|consensus485 95.46
TIGR00788468 fbt folate/biopterin transporter. The only functio 95.4
PRK03893496 putative sialic acid transporter; Provisional 95.33
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 95.27
PRK15462 493 dipeptide/tripeptide permease D; Provisional 95.26
PRK10133 438 L-fucose transporter; Provisional 95.2
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 95.18
PRK11663434 regulatory protein UhpC; Provisional 95.02
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 94.99
PRK09874408 drug efflux system protein MdtG; Provisional 94.88
PRK03633 381 putative MFS family transporter protein; Provision 94.88
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 94.74
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 94.54
PRK12307426 putative sialic acid transporter; Provisional 94.47
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 94.45
TIGR00788 468 fbt folate/biopterin transporter. The only functio 94.45
PRK11010491 ampG muropeptide transporter; Validated 94.22
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 94.09
PRK11646400 multidrug resistance protein MdtH; Provisional 94.08
PRK09528 420 lacY galactoside permease; Reviewed 93.61
TIGR00897402 2A0118 polyol permease family. This family of prot 93.58
PRK10406432 alpha-ketoglutarate transporter; Provisional 93.36
PRK09584500 tppB putative tripeptide transporter permease; Rev 93.32
PRK11462 460 putative transporter; Provisional 93.26
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 93.21
PRK09669 444 putative symporter YagG; Provisional 93.18
TIGR00891405 2A0112 putative sialic acid transporter. 93.06
PRK03545390 putative arabinose transporter; Provisional 93.05
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 92.92
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 92.73
KOG2816|consensus 463 92.46
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 92.31
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 92.26
KOG3764|consensus 464 92.24
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 91.94
COG2211 467 MelB Na+/melibiose symporter and related transport 91.74
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 91.56
PRK09705393 cynX putative cyanate transporter; Provisional 91.2
PRK10504471 putative transporter; Provisional 91.19
KOG0255|consensus521 91.1
KOG0252|consensus538 90.8
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 90.5
PRK11902402 ampG muropeptide transporter; Reviewed 89.84
PRK10429 473 melibiose:sodium symporter; Provisional 89.66
PF07672 267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 89.19
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 89.14
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 88.94
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 87.63
PRK10054395 putative transporter; Provisional 86.4
TIGR00902382 2A0127 phenyl proprionate permease family protein. 86.39
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 86.35
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 86.31
KOG0254|consensus513 86.29
KOG3810|consensus 433 86.09
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 85.81
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 85.15
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 85.0
KOG2504|consensus 509 84.03
COG3202 509 ATP/ADP translocase [Energy production and convers 83.7
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 82.69
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 82.44
KOG0253|consensus528 81.88
PLN00028476 nitrate transmembrane transporter; Provisional 80.96
PRK03699394 putative transporter; Provisional 80.92
PRK15402406 multidrug efflux system translocase MdfA; Provisio 80.83
PRK10207489 dipeptide/tripeptide permease B; Provisional 80.61
>KOG0569|consensus Back     alignment and domain information
Probab=99.90  E-value=1.2e-22  Score=161.61  Aligned_cols=138  Identities=22%  Similarity=0.275  Sum_probs=112.7

Q ss_pred             ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH------hHHHHHHHHHHHHHHHHHHHhhcCCchHHHHh-
Q psy66             3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML------HWQIVCYFCAATACISFIIVTFMPETPAWYAS-   75 (164)
Q Consensus         3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~------~Wr~~~~~~~~~~~l~~~~~~~~pESp~~l~~-   75 (164)
                      ...|+|+.|++|++.||..+++.+++..+|.+++..++...      .|++++.+..+|+++.++..+++|||||||+. 
T Consensus       135 ~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~l~~~PESPk~Ll~~  214 (485)
T KOG0569|consen  135 GLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLALLPFLPESPKYLLIK  214 (485)
T ss_pred             HHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHHHhcCCCCcchHHHH
Confidence            46799999999999999999999999999999998888766      79999999999999999999999999999997 


Q ss_pred             cCCHHHHHHHHHHHhCCChhhHHHHHHHHHHHHhh--hhcccchhhhhhccchH-HHHHHHHHHHHHH
Q psy66            76 KGLVVKSSASLNWLRNSSAIANAEIADILQSISER--EDDKKSCGQTLREFTPI-RILTTRNVASLQC  140 (164)
Q Consensus        76 ~~~~~~a~~~l~~i~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~l~~~~~~~-~~~~~~~l~~~~~  140 (164)
                      |||.+||++.++++++++++..+..++..+.++++  ++++.+++|+++++..| .+.+++.+.+.|.
T Consensus       215 k~~~~~A~~sl~~y~G~~~~~~~~e~~~~e~~~~~~~~~~~~sl~~~~~~~~lR~~~~i~~~v~~~qq  282 (485)
T KOG0569|consen  215 KGDEEEARKALKFYRGKEDVEAEIEEMLREIEEEELEKKKQISLRQLLKNPTLRRPLLIGIVVSFAQQ  282 (485)
T ss_pred             cCCHHHHHHHHHHHhCCCcchhHHHHHHHHHHHhccccccCCcHHHHhcCcchhHHHHHHHHHHHHHH
Confidence            99999999999999997543333323223322222  23667899999997555 5567777777665



>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.71
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.47
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.3
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.1
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.7
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 97.51
2xut_A 524 Proton/peptide symporter family protein; transport 97.07
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 96.35
2cfq_A417 Lactose permease; transport, transport mechanism, 95.79
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 95.71
2xut_A524 Proton/peptide symporter family protein; transport 94.71
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 86.76
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 86.09
2cfq_A 417 Lactose permease; transport, transport mechanism, 85.39
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.71  E-value=2.3e-16  Score=124.76  Aligned_cols=90  Identities=21%  Similarity=0.451  Sum_probs=83.5

Q ss_pred             ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH------------hHHHHHHHHHHHHHHHHHHHhhcCCch
Q psy66             3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML------------HWQIVCYFCAATACISFIIVTFMPETP   70 (164)
Q Consensus         3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~------------~Wr~~~~~~~~~~~l~~~~~~~~pESp   70 (164)
                      +++++|++|++|+++||+..++.+.++.+|.++++.++...            +||+++.+..+++++.++..+++||||
T Consensus       145 ~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp  224 (491)
T 4gc0_A          145 MLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESP  224 (491)
T ss_dssp             HHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGSCCCH
T ss_pred             HHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcCCCCh
Confidence            46789999999999999999999999999999999988755            799999999999999999999999999


Q ss_pred             HHHHhcCCHHHHHHHHHHHhCC
Q psy66            71 AWYASKGLVVKSSASLNWLRNS   92 (164)
Q Consensus        71 ~~l~~~~~~~~a~~~l~~i~~~   92 (164)
                      |||..|++.|++++.+++..++
T Consensus       225 ~~L~~~~~~~~a~~~l~~~~~~  246 (491)
T 4gc0_A          225 RWLMSRGKQEQAEGILRKIMGN  246 (491)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHcCchhHHHHhHHHhcCC
Confidence            9999999999999999988764



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.32
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.35
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 96.29
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 89.77
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.32  E-value=2e-07  Score=70.09  Aligned_cols=70  Identities=16%  Similarity=0.054  Sum_probs=56.2

Q ss_pred             ccchhhhhhccCchhHHHHHhHHHHHHHHHHHHHHHHHHhH-----hHHHHHHHHHHHHHHHH-HHHhhcCCchHH
Q psy66             3 SSTYVYVSEISLPAYRGLFASLGPVFVSLGVLFVYYAGYML-----HWQIVCYFCAATACISF-IIVTFMPETPAW   72 (164)
Q Consensus         3 ~~~~~~i~E~~p~~~Rg~~~~~~~~~~~~G~ll~~~~~~~~-----~Wr~~~~~~~~~~~l~~-~~~~~~pESp~~   72 (164)
                      +....++.|+.|+++||+..++.+.+..+|.++++.++...     +||+.+++..++.++.. +...+++|+|+.
T Consensus       135 ~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (447)
T d1pw4a_         135 PPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQS  210 (447)
T ss_dssp             HHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred             hHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence            34567899999999999999999999999999988876654     89999888887766554 445567777754



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure