Psyllid ID: psy682


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM
ccccccccEEEEEEccHHHHHccccccccccHHcccccccccccccccccccEEEEEEEcccccEEEEcccccccccccEEEEEEcccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEcccccccccccccccccccccccccccccccccHHHHHHHccccccccEEEEEccccccccccccccccHHHHHHccccEEEEEEEccccEEEcHHHHHHHccccccccccccccccccHHHHHccccccccccccccccccEEcccccccHHHHHHHHcc
cccccccEEEEEEEccHHHHHHcHHHHHHHHHccccccccccccHcccccccEEEEEEccccccEEEEEccccccccccEEEEEEccEEEEEEcccccccccccccccccccccccccccEEEccEEEEccccccccccccccccccccccEEcccEEEEEccccEEEEEccccccEEEEEccccEEEEEEEccEEEEEEccccEEEEccccccEEEEEEEEcccccccccccccccccEEEEEccccEEEEEEEEcEEEEccccccEEEEEccccHHHHcccccccccHHEEccccEEEEEEccccEEcccEcccccccHHHHHHHHcc
MSGGDKGIVEVWRTFNLALLYafpscdssvRSLAlshdqkyspmmfSTVLDDVCmslkfpsnspichvtantyvTLHMPSVVTVTANHQfainrwnpdyaasiqspsyaetpgsppgnlpltldpilthptsnnnapvpkrhlgdnfsqklrvrhncfvttVDSRFLLACgfwdnsfrepFTTMYLALQegkfdhpnrlfSSISLAWKNcqrdtsdvkvhTTFGDllrsldppsgfaspesvvmSREGVIVVNYERGHIAAFTmngnrlrheshndnlqelipelfflpemlvnsngyclgktednvninnvelppwasspeqFVRINRM
MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINnvelppwasspeqfvrinrm
MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM
******GIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA********************************************NFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRS************VVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPW*************
****DKGIVEVWRTFNLALLYAFPSCDSS*********QKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPD*******************NLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM
MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQS**********PGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM
****DKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLR*LDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKYSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query330 2.2.26 [Sep-21-2011]
Q9W4E23578 Neurobeachin OS=Drosophil yes N/A 0.754 0.069 0.453 4e-54
Q9ESE12856 Lipopolysaccharide-respon yes N/A 0.733 0.084 0.327 1e-26
Q9EPN12936 Neurobeachin OS=Mus muscu no N/A 0.742 0.083 0.341 1e-26
Q8NFP92946 Neurobeachin OS=Homo sapi yes N/A 0.742 0.083 0.341 2e-26
P508512863 Lipopolysaccharide-respon no N/A 0.733 0.084 0.323 2e-26
A8XSV32531 Putative neurobeachin hom N/A N/A 0.721 0.094 0.333 9e-26
Q193172507 Putative neurobeachin hom yes N/A 0.721 0.094 0.329 3e-24
Q54U63 2491 BEACH domain-containing p yes N/A 0.081 0.010 0.490 2e-09
Q55AV3 2967 BEACH domain-containing p no N/A 0.290 0.032 0.307 5e-09
E7FAW3 2801 Neurobeachin-like protein no N/A 0.178 0.021 0.524 4e-08
>sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=rg PE=1 SV=3 Back     alignment and function desciption
 Score =  211 bits (538), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 164/269 (60%), Gaps = 20/269 (7%)

Query: 42   SPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA 101
            SPMMFS + +D+C  LKF  NSP+ H++ANTY  L +PSVVTVTA HQFA+NRWN +Y A
Sbjct: 3201 SPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWNCNYTA 3260

Query: 102  SIQSPSYAETPGSPPGNLPLTLDPILT-HPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVT 160
            S+QSPSYAE+P SP  N PLT+DP+L  H T+NN+    +RHLGDNFSQ L++R NCFVT
Sbjct: 3261 SVQSPSYAESPQSPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVT 3320

Query: 161  TVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVH 220
            TVDSRFL+ACGFWDNSFR  F T    + +  F H    F  ++   ++    TSD  + 
Sbjct: 3321 TVDSRFLIACGFWDNSFR-VFATETAKIVQIVFGH----FGVVTCMARSECNITSDCYIA 3375

Query: 221  TTFGD---LL-------RSLDPPSGFASPESVVMSREGV---IVVNYERGHIAAFTMNGN 267
            +   D   LL       +S+       +P + +   E     +V++ E G + + + NG 
Sbjct: 3376 SGSADCTVLLWHWNARTQSIVGEGDVPTPRATLTGHEQAVTSVVISAELGLVVSGSSNGP 3435

Query: 268  RLRHESHNDNLQELI-PELFFLPEMLVNS 295
             L H +  D L+ L  P  F  PE++  S
Sbjct: 3436 VLIHTTFGDLLRSLDPPAEFHSPELITMS 3464




Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. Required for correct retinal pattern formation and may function in cell fate determination through its interactions with the EGFR and Notch signaling pathways.
Drosophila melanogaster (taxid: 7227)
>sp|Q9ESE1|LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus GN=Lrba PE=1 SV=1 Back     alignment and function description
>sp|Q9EPN1|NBEA_MOUSE Neurobeachin OS=Mus musculus GN=Nbea PE=1 SV=1 Back     alignment and function description
>sp|Q8NFP9|NBEA_HUMAN Neurobeachin OS=Homo sapiens GN=NBEA PE=1 SV=3 Back     alignment and function description
>sp|P50851|LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens GN=LRBA PE=1 SV=4 Back     alignment and function description
>sp|A8XSV3|NBEA_CAEBR Putative neurobeachin homolog OS=Caenorhabditis briggsae GN=sel-2 PE=3 SV=1 Back     alignment and function description
>sp|Q19317|NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans GN=sel-2 PE=2 SV=3 Back     alignment and function description
>sp|Q54U63|LVSC_DICDI BEACH domain-containing protein lvsC OS=Dictyostelium discoideum GN=lvsC PE=4 SV=2 Back     alignment and function description
>sp|Q55AV3|LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum GN=lvsD PE=4 SV=2 Back     alignment and function description
>sp|E7FAW3|NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio GN=nbeal2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
312384812 2590 hypothetical protein AND_01512 [Anophele 0.660 0.084 0.525 5e-60
345481241 3146 PREDICTED: neurobeachin-like [Nasonia vi 0.460 0.048 0.655 6e-54
195129838 3747 GI15273 [Drosophila mojavensis] gi|19390 0.754 0.066 0.464 6e-54
195425835 3583 GK10290 [Drosophila willistoni] gi|19415 0.754 0.069 0.460 3e-53
380020287 2983 PREDICTED: neurobeachin-like [Apis flore 0.751 0.083 0.447 4e-53
195396793 3654 GJ16846 [Drosophila virilis] gi|19414678 0.754 0.068 0.460 5e-53
195046432 3712 GH24603 [Drosophila grimshawi] gi|193892 0.754 0.067 0.453 1e-52
194763773 3624 GF21330 [Drosophila ananassae] gi|190618 0.754 0.068 0.457 1e-52
332025325 732 Neurobeachin [Acromyrmex echinatior] 0.754 0.340 0.444 2e-52
350417191 3204 PREDICTED: neurobeachin-like [Bombus imp 0.460 0.047 0.636 2e-52
>gi|312384812|gb|EFR29447.1| hypothetical protein AND_01512 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  237 bits (605), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 126/240 (52%), Positives = 163/240 (67%), Gaps = 22/240 (9%)

Query: 42   SPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA 101
            SPMMF+T+ DDVCMSLKF  NSPI H++ANTY  L MPSVVTVTA HQFA+NRWN  Y A
Sbjct: 2320 SPMMFNTMPDDVCMSLKFHLNSPIIHISANTYPQLPMPSVVTVTAGHQFAVNRWNCQYTA 2379

Query: 102  SIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNA--PVPKRHLGDNFSQKLRVRHNCFV 159
            SIQSPSYAE+  +   NLPLT+DP+L+    +N++     +RHLGDNFSQKL+++ NC+V
Sbjct: 2380 SIQSPSYAESAQNMNANLPLTMDPLLSQINGHNSSSNQQNRRHLGDNFSQKLQIKSNCYV 2439

Query: 160  TTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKV 219
            TT+ +      G          T++ ++ + G       L  S S+        +  V V
Sbjct: 2440 TTIPTPRATLTG-----HETAVTSVVISAELG-------LVVSGSI--------SGPVLV 2479

Query: 220  HTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQ 279
            HTTFGDLLRSL+ P GF SPE++ +SREG IVVNY+ G +AA+T+NG  LR+E+HNDN Q
Sbjct: 2480 HTTFGDLLRSLEAPKGFISPENITLSREGFIVVNYDEGSVAAYTINGKLLRYETHNDNFQ 2539




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345481241|ref|XP_001602669.2| PREDICTED: neurobeachin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195129838|ref|XP_002009361.1| GI15273 [Drosophila mojavensis] gi|193907811|gb|EDW06678.1| GI15273 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195425835|ref|XP_002061170.1| GK10290 [Drosophila willistoni] gi|194157255|gb|EDW72156.1| GK10290 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|380020287|ref|XP_003694021.1| PREDICTED: neurobeachin-like [Apis florea] Back     alignment and taxonomy information
>gi|195396793|ref|XP_002057013.1| GJ16846 [Drosophila virilis] gi|194146780|gb|EDW62499.1| GJ16846 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195046432|ref|XP_001992152.1| GH24603 [Drosophila grimshawi] gi|193892993|gb|EDV91859.1| GH24603 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194763773|ref|XP_001964007.1| GF21330 [Drosophila ananassae] gi|190618932|gb|EDV34456.1| GF21330 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|332025325|gb|EGI65493.1| Neurobeachin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350417191|ref|XP_003491301.1| PREDICTED: neurobeachin-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
FB|FBgn00869113578 rg "rugose" [Drosophila melano 0.751 0.069 0.459 4.2e-51
UNIPROTKB|B7Z2H9739 NBEA "Uncharacterized protein" 0.745 0.332 0.346 7.8e-27
UNIPROTKB|F1MF642809 NBEA "Uncharacterized protein" 0.745 0.087 0.346 5.8e-26
MGI|MGI:13470752936 Nbea "neurobeachin" [Mus muscu 0.745 0.083 0.346 6.2e-26
UNIPROTKB|Q8NFP92946 NBEA "Neurobeachin" [Homo sapi 0.745 0.083 0.346 6.2e-26
MGI|MGI:19331622856 Lrba "LPS-responsive beige-lik 0.742 0.085 0.335 1.6e-25
UNIPROTKB|P508512863 LRBA "Lipopolysaccharide-respo 0.742 0.085 0.328 6.9e-25
UNIPROTKB|E1C6E62850 LRBA "Uncharacterized protein" 0.730 0.084 0.329 1.4e-24
UNIPROTKB|F1P3D02855 NBEA "Neurobeachin" [Gallus ga 0.748 0.086 0.342 1.4e-24
RGD|13114282709 Lrba "LPS-responsive vesicle t 0.748 0.091 0.330 1.7e-24
FB|FBgn0086911 rg "rugose" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 549 (198.3 bits), Expect = 4.2e-51, P = 4.2e-51
 Identities = 124/270 (45%), Positives = 165/270 (61%)

Query:    42 SPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA 101
             SPMMFS + +D+C  LKF  NSP+ H++ANTY  L +PSVVTVTA HQFA+NRWN +Y A
Sbjct:  3201 SPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWNCNYTA 3260

Query:   102 SIQSPSYAETPGSPPGNLPLTLDPILT-HPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVT 160
             S+QSPSYAE+P SP  N PLT+DP+L  H T+NN+    +RHLGDNFSQ L++R NCFVT
Sbjct:  3261 SVQSPSYAESPQSPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVT 3320

Query:   161 TVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRLFSSIS-LAWKNCQRDTSDVKV 219
             TVDSRFL+ACGFWDNSFR  F T    + +  F H    F  ++ +A   C   TSD  +
Sbjct:  3321 TVDSRFLIACGFWDNSFRV-FATETAKIVQIVFGH----FGVVTCMARSECNI-TSDCYI 3374

Query:   220 HTTFGD---LL-------RSLDPPSGFASPESVVMSREGVI---VVNYERGHIAAFTMNG 266
              +   D   LL       +S+       +P + +   E  +   V++ E G + + + NG
Sbjct:  3375 ASGSADCTVLLWHWNARTQSIVGEGDVPTPRATLTGHEQAVTSVVISAELGLVVSGSSNG 3434

Query:   267 NRLRHESHNDNLQELIPEL-FFLPEMLVNS 295
               L H +  D L+ L P   F  PE++  S
Sbjct:  3435 PVLIHTTFGDLLRSLDPPAEFHSPELITMS 3464


GO:0016021 "integral to membrane" evidence=IDA
GO:0008104 "protein localization" evidence=NAS;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0051018 "protein kinase A binding" evidence=NAS;IDA
GO:0042675 "compound eye cone cell differentiation" evidence=IMP
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0008355 "olfactory learning" evidence=IMP
GO:0043025 "neuronal cell body" evidence=IDA
GO:0016319 "mushroom body development" evidence=IMP
UNIPROTKB|B7Z2H9 NBEA "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF64 NBEA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1347075 Nbea "neurobeachin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFP9 NBEA "Neurobeachin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1933162 Lrba "LPS-responsive beige-like anchor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P50851 LRBA "Lipopolysaccharide-responsive and beige-like anchor protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6E6 LRBA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3D0 NBEA "Neurobeachin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1311428 Lrba "LPS-responsive vesicle trafficking, beach and anchor containing" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
smart01026280 smart01026, Beach, Beige/BEACH domain 4e-28
pfam02138274 pfam02138, Beach, Beige/BEACH domain 5e-18
cd06071275 cd06071, Beach, BEACH (Beige and Chediak-Higashi) 9e-18
pfam02138274 pfam02138, Beach, Beige/BEACH domain 3e-12
cd06071275 cd06071, Beach, BEACH (Beige and Chediak-Higashi) 2e-11
>gnl|CDD|214982 smart01026, Beach, Beige/BEACH domain Back     alignment and domain information
 Score =  110 bits (276), Expect = 4e-28
 Identities = 51/154 (33%), Positives = 72/154 (46%), Gaps = 61/154 (39%)

Query: 178 REPFTTMYLALQEGKFDHPNRLFSSISLAWKNCQRDTSDVKVHTTFGDLLRSLDPPSGFA 237
            EPFTT++L LQ G+FDH +RLF S++  W++                           A
Sbjct: 107 LEPFTTLFLQLQGGRFDHADRLFHSVAATWRS---------------------------A 139

Query: 238 SPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQELIPELFFLPEMLVNSNG 297
           S ES  M+                                ++ELIPE F+LPE LVN NG
Sbjct: 140 SLES--MTD-------------------------------VKELIPEFFYLPEFLVNING 166

Query: 298 YCLGKTEDNVNINNVELPPWA-SSPEQFVRINRM 330
           +  G  +D  ++++VELPPWA  SPE+F+R +R 
Sbjct: 167 FDFGTRQDGEDVDDVELPPWAKGSPEEFIRKHRE 200


The BEACH domain was described in the BEIGE protein (D1035670) and in the highly homologous CHS protein. The BEACH domain is usually followed by a series of WD repeats. The function of the BEACH domain is unknown. Length = 280

>gnl|CDD|216896 pfam02138, Beach, Beige/BEACH domain Back     alignment and domain information
>gnl|CDD|100117 cd06071, Beach, BEACH (Beige and Chediak-Higashi) domains, implicated in membrane trafficking, are present in a family of proteins conserved throughout eukaryotes Back     alignment and domain information
>gnl|CDD|216896 pfam02138, Beach, Beige/BEACH domain Back     alignment and domain information
>gnl|CDD|100117 cd06071, Beach, BEACH (Beige and Chediak-Higashi) domains, implicated in membrane trafficking, are present in a family of proteins conserved throughout eukaryotes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG0271|consensus480 99.97
KOG0272|consensus459 99.96
KOG0271|consensus480 99.93
KOG0295|consensus406 99.92
KOG0272|consensus459 99.92
KOG0279|consensus315 99.91
KOG0263|consensus707 99.9
KOG0266|consensus456 99.9
KOG0279|consensus315 99.89
KOG0315|consensus311 99.89
KOG0286|consensus343 99.88
KOG0319|consensus 775 99.88
KOG0319|consensus775 99.86
KOG0273|consensus524 99.86
KOG0281|consensus499 99.85
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.85
KOG0306|consensus 888 99.82
KOG0266|consensus456 99.82
KOG0286|consensus343 99.81
KOG0291|consensus 893 99.81
KOG0293|consensus519 99.81
KOG0281|consensus499 99.81
KOG0285|consensus460 99.8
KOG0263|consensus707 99.8
KOG0276|consensus 794 99.8
PLN00181793 protein SPA1-RELATED; Provisional 99.79
KOG0645|consensus312 99.78
PTZ00421 493 coronin; Provisional 99.78
PTZ00420 568 coronin; Provisional 99.78
KOG0316|consensus307 99.78
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.78
KOG0274|consensus537 99.78
KOG0318|consensus603 99.78
KOG0313|consensus423 99.77
PLN00181793 protein SPA1-RELATED; Provisional 99.77
cd06071275 Beach BEACH (Beige and Chediak-Higashi) domains, i 99.76
KOG0316|consensus307 99.76
KOG0295|consensus406 99.76
KOG0291|consensus 893 99.76
KOG0265|consensus338 99.75
KOG0300|consensus481 99.74
KOG0645|consensus312 99.74
KOG0301|consensus 745 99.74
KOG0301|consensus 745 99.74
KOG0296|consensus399 99.73
KOG0318|consensus 603 99.73
KOG0265|consensus338 99.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.72
KOG1332|consensus299 99.72
KOG0292|consensus 1202 99.71
KOG0284|consensus464 99.7
KOG0282|consensus503 99.69
PTZ00420 568 coronin; Provisional 99.69
KOG0276|consensus 794 99.68
KOG0308|consensus 735 99.68
KOG0278|consensus334 99.67
PF02138270 Beach: Beige/BEACH domain; InterPro: IPR000409 The 99.67
KOG0643|consensus327 99.66
PTZ00421493 coronin; Provisional 99.64
KOG0277|consensus311 99.64
KOG0273|consensus524 99.64
KOG0313|consensus423 99.64
KOG0275|consensus508 99.63
KOG0267|consensus 825 99.62
KOG0288|consensus459 99.62
KOG0285|consensus460 99.62
KOG0315|consensus311 99.61
KOG0268|consensus433 99.59
KOG0284|consensus464 99.59
KOG0292|consensus 1202 99.59
KOG0274|consensus537 99.56
KOG1446|consensus311 99.56
KOG0306|consensus 888 99.56
KOG0275|consensus508 99.55
KOG2096|consensus420 99.55
KOG0973|consensus 942 99.55
KOG0288|consensus459 99.53
KOG0310|consensus 487 99.53
KOG0283|consensus 712 99.51
KOG0289|consensus506 99.51
KOG0294|consensus362 99.5
KOG0296|consensus399 99.5
KOG0305|consensus484 99.48
KOG0310|consensus 487 99.48
KOG1539|consensus 910 99.47
KOG0293|consensus519 99.47
KOG0299|consensus479 99.45
KOG1408|consensus 1080 99.44
KOG1408|consensus 1080 99.44
KOG0283|consensus712 99.44
KOG0264|consensus422 99.43
KOG0772|consensus 641 99.42
KOG0278|consensus334 99.41
KOG0646|consensus 476 99.37
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.36
KOG0302|consensus440 99.35
KOG0640|consensus430 99.35
KOG2096|consensus420 99.34
KOG0300|consensus481 99.34
KOG0299|consensus479 99.33
KOG0305|consensus484 99.32
KOG1787|consensus 1126 99.31
KOG0282|consensus503 99.3
KOG0277|consensus311 99.3
KOG0772|consensus 641 99.3
KOG1446|consensus311 99.28
KOG0644|consensus 1113 99.28
KOG1407|consensus313 99.27
KOG0973|consensus 942 99.27
PRK11028330 6-phosphogluconolactonase; Provisional 99.27
KOG0641|consensus350 99.26
KOG0289|consensus506 99.26
KOG0269|consensus 839 99.25
PRK01742429 tolB translocation protein TolB; Provisional 99.23
KOG0647|consensus347 99.23
KOG4378|consensus 673 99.22
KOG0321|consensus 720 99.22
KOG1063|consensus764 99.21
COG2319466 FOG: WD40 repeat [General function prediction only 99.2
KOG0642|consensus577 99.19
KOG0270|consensus463 99.18
KOG0643|consensus327 99.17
KOG0269|consensus 839 99.17
KOG1063|consensus 764 99.16
KOG0640|consensus430 99.15
KOG0308|consensus 735 99.15
KOG1009|consensus 434 99.15
KOG1407|consensus313 99.15
KOG0267|consensus 825 99.15
KOG4283|consensus397 99.14
KOG0294|consensus362 99.14
KOG1036|consensus323 99.14
KOG2055|consensus514 99.14
KOG2048|consensus 691 99.09
KOG0264|consensus422 99.09
KOG4283|consensus397 99.08
KOG0641|consensus350 99.08
PRK04922433 tolB translocation protein TolB; Provisional 99.07
COG2319466 FOG: WD40 repeat [General function prediction only 99.07
KOG2919|consensus406 99.07
KOG1034|consensus385 99.06
PRK05137435 tolB translocation protein TolB; Provisional 99.05
KOG2445|consensus361 99.04
KOG0307|consensus 1049 99.04
KOG0650|consensus733 99.03
KOG1538|consensus 1081 99.03
KOG0639|consensus705 99.03
KOG1274|consensus 933 99.01
KOG0303|consensus 472 99.0
KOG0270|consensus463 99.0
PRK03629429 tolB translocation protein TolB; Provisional 98.99
KOG0647|consensus347 98.98
KOG0268|consensus433 98.97
KOG1274|consensus 933 98.96
KOG0303|consensus 472 98.95
KOG0322|consensus323 98.92
PRK02889427 tolB translocation protein TolB; Provisional 98.91
KOG1539|consensus 910 98.9
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.89
KOG0771|consensus398 98.89
KOG2048|consensus 691 98.88
KOG2106|consensus626 98.87
KOG4378|consensus 673 98.86
KOG2106|consensus 626 98.83
KOG1332|consensus299 98.83
PRK01742429 tolB translocation protein TolB; Provisional 98.83
KOG0649|consensus325 98.77
KOG0639|consensus705 98.7
PRK11028330 6-phosphogluconolactonase; Provisional 98.68
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.68
KOG1273|consensus405 98.67
KOG4328|consensus498 98.67
KOG1036|consensus323 98.66
KOG4328|consensus498 98.66
KOG0642|consensus577 98.66
KOG0646|consensus 476 98.64
KOG0321|consensus 720 98.64
KOG2919|consensus406 98.63
PRK00178430 tolB translocation protein TolB; Provisional 98.62
PRK04792448 tolB translocation protein TolB; Provisional 98.58
KOG1524|consensus 737 98.58
KOG1517|consensus1387 98.58
PRK03629429 tolB translocation protein TolB; Provisional 98.56
KOG0974|consensus 967 98.55
KOG1034|consensus 385 98.54
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.5
KOG1786|consensus 1081 98.46
KOG1445|consensus1012 98.43
KOG1524|consensus 737 98.42
KOG1538|consensus 1081 98.4
KOG1445|consensus 1012 98.4
PRK01029428 tolB translocation protein TolB; Provisional 98.4
KOG2111|consensus346 98.4
KOG2055|consensus514 98.38
KOG1007|consensus370 98.37
KOG2110|consensus391 98.36
KOG0644|consensus 1113 98.34
PRK05137435 tolB translocation protein TolB; Provisional 98.31
KOG1188|consensus376 98.29
KOG1009|consensus 434 98.29
KOG0307|consensus 1049 98.27
KOG0302|consensus440 98.26
KOG0771|consensus398 98.23
KOG0322|consensus323 98.19
KOG1787|consensus1126 98.17
KOG0974|consensus 967 98.15
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.14
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.14
KOG1963|consensus 792 98.11
PRK04922433 tolB translocation protein TolB; Provisional 98.08
KOG1786|consensus1081 98.05
PRK04043419 tolB translocation protein TolB; Provisional 98.05
KOG2394|consensus 636 98.03
KOG1517|consensus1387 98.03
KOG1007|consensus370 98.03
PRK02889427 tolB translocation protein TolB; Provisional 98.0
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.99
KOG1240|consensus 1431 97.97
KOG2110|consensus391 97.95
KOG2394|consensus 636 97.93
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.9
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.9
KOG1523|consensus361 97.9
KOG0649|consensus325 97.86
KOG2445|consensus 361 97.85
KOG1963|consensus 792 97.74
KOG1310|consensus 758 97.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.69
KOG0650|consensus733 97.66
KOG1587|consensus555 97.66
KOG1272|consensus545 97.64
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.64
KOG4227|consensus 609 97.63
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.63
PRK00178430 tolB translocation protein TolB; Provisional 97.62
KOG4547|consensus 541 97.6
KOG1334|consensus559 97.59
PRK04792448 tolB translocation protein TolB; Provisional 97.55
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.52
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.52
KOG1310|consensus 758 97.47
KOG2139|consensus445 97.45
KOG3914|consensus390 97.32
PRK01029428 tolB translocation protein TolB; Provisional 97.29
KOG1273|consensus405 97.27
KOG4497|consensus447 97.27
KOG1064|consensus2439 97.2
KOG4190|consensus1034 97.18
KOG2315|consensus 566 97.16
KOG2111|consensus346 97.15
KOG3914|consensus390 97.14
KOG2321|consensus 703 97.13
KOG1188|consensus 376 97.11
KOG1240|consensus1431 97.11
KOG1354|consensus433 97.05
KOG4190|consensus1034 97.01
KOG0309|consensus 1081 96.9
KOG4547|consensus 541 96.79
KOG0290|consensus364 96.77
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.75
KOG4227|consensus 609 96.69
KOG1272|consensus545 96.68
KOG0290|consensus364 96.53
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.51
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.47
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.47
COG4946668 Uncharacterized protein related to the periplasmic 96.42
KOG1334|consensus559 96.39
PRK04043419 tolB translocation protein TolB; Provisional 96.35
KOG1587|consensus555 96.23
KOG3881|consensus412 96.14
KOG2315|consensus566 96.14
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.03
KOG3881|consensus412 95.95
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 95.91
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.9
KOG1064|consensus2439 95.86
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.66
KOG4497|consensus 447 95.61
KOG2321|consensus 703 95.54
KOG1409|consensus404 95.45
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.21
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.09
KOG2041|consensus 1189 94.91
KOG0309|consensus 1081 94.29
KOG2139|consensus 445 94.04
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 94.01
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 93.51
KOG2041|consensus 1189 93.49
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 93.14
KOG1523|consensus361 93.01
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 92.94
KOG1409|consensus 404 92.6
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 90.97
KOG4532|consensus344 90.23
KOG0882|consensus 558 89.79
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 89.58
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.15
COG0823425 TolB Periplasmic component of the Tol biopolymer t 89.12
KOG4714|consensus319 88.75
KOG2695|consensus425 88.67
COG3386307 Gluconolactonase [Carbohydrate transport and metab 87.91
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 87.78
KOG2114|consensus 933 87.67
KOG1916|consensus 1283 87.33
KOG1832|consensus1516 87.02
KOG4532|consensus344 86.7
KOG2695|consensus425 86.6
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 86.02
PRK02888635 nitrous-oxide reductase; Validated 85.29
PRK02888 635 nitrous-oxide reductase; Validated 85.14
KOG0280|consensus339 84.63
KOG1354|consensus 433 83.8
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 83.07
KOG2079|consensus 1206 82.66
PRK13616591 lipoprotein LpqB; Provisional 82.46
KOG3617|consensus 1416 82.21
KOG0280|consensus339 81.95
KOG3621|consensus 726 81.87
COG3386307 Gluconolactonase [Carbohydrate transport and metab 81.51
KOG1920|consensus 1265 80.95
>KOG0271|consensus Back     alignment and domain information
Probab=99.97  E-value=6.2e-31  Score=251.71  Aligned_cols=240  Identities=15%  Similarity=0.144  Sum_probs=190.1

Q ss_pred             CcccCCCcEEEeecccccccceeecCCCceeEEEeCCCCCc-------------Cc------ceeeeecCccEEEEEeCC
Q psy682            1 MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKY-------------SP------MMFSTVLDDVCMSLKFPS   61 (330)
Q Consensus         1 asgs~d~~V~lW~~~~g~~l~tl~gH~~~V~svafSpdg~~-------------~~------l~~~~~~~d~~~~v~Fs~   61 (330)
                      |||+.|.||||||+.+..+++|++||..||.+|++||||+.             +|      -..+++|...|+.++|-|
T Consensus       131 ~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~~~g~~l~gH~K~It~Lawep  210 (480)
T KOG0271|consen  131 VTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQQIGRALRGHKKWITALAWEP  210 (480)
T ss_pred             EecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCCcccccccCcccceeEEeecc
Confidence            68999999999999999999999999999999999999998             11      123568888888888876


Q ss_pred             CCCeeEeeeccceeccCCcEEEEEcCCcceEEEeCCCCC-CcccCCCCCCCCCCCCCCccccCCCceeccCCCCCCCcce
Q psy682           62 NSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYA-ASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPK  140 (330)
Q Consensus        62 ~~~v~~~~~~~~~~~~~~~~v~vS~~~~~tv~lW~~~~~-~~~~~~~h~~~~~~~~~~l~fs~D~~l~~~s~~~~~~~~~  140 (330)
                      -            ++.++...+||++.|++|++|+.... .+..+.||+.    ++.|+.---++.+.++|.+.+.++|+
T Consensus       211 ~------------hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~----~VTCvrwGG~gliySgS~DrtIkvw~  274 (480)
T KOG0271|consen  211 L------------HLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTA----SVTCVRWGGEGLIYSGSQDRTIKVWR  274 (480)
T ss_pred             c------------ccCCCccceecccCCCCEEEEEccCceEEEEeccCcc----ceEEEEEcCCceEEecCCCceEEEEE
Confidence            3            34577788999999999999999754 4677779984    66778777777777666555555442


Q ss_pred             e-------ccCCC-------------------C-----------------------------------------------
Q psy682          141 R-------HLGDN-------------------F-----------------------------------------------  147 (330)
Q Consensus       141 ~-------~l~~~-------------------~-----------------------------------------------  147 (330)
                      -       .+.++                   |                                               
T Consensus       275 a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgsDd~tlflW~p~  354 (480)
T KOG0271|consen  275 ALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGSDDFTLFLWNPF  354 (480)
T ss_pred             ccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEecCCceEEEeccc
Confidence            2       11111                   0                                               


Q ss_pred             -----ccceeeee---eEEEEecCCCeEEEeeccCCeEEEeeecccccccccccCCCCcE--EE----eHHHHHhhhccC
Q psy682          148 -----SQKLRVRH---NCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDHPNRL--FS----SISLAWKNCQRD  213 (330)
Q Consensus       148 -----~~~~~~~~---~~~~~spDg~~i~asg~~D~tirl~w~~~~g~l~~~l~gH~d~V--ia----St~~lW~~SgS~  213 (330)
                           ..+..+|.   +.+.||||++| ||++|.|++||| |+-.+|+.+.++.||-+.|  ++    |-..+   |||.
T Consensus       355 ~~kkpi~rmtgHq~lVn~V~fSPd~r~-IASaSFDkSVkL-W~g~tGk~lasfRGHv~~VYqvawsaDsRLlV---S~Sk  429 (480)
T KOG0271|consen  355 KSKKPITRMTGHQALVNHVSFSPDGRY-IASASFDKSVKL-WDGRTGKFLASFRGHVAAVYQVAWSADSRLLV---SGSK  429 (480)
T ss_pred             ccccchhhhhchhhheeeEEECCCccE-EEEeecccceee-eeCCCcchhhhhhhccceeEEEEeccCccEEE---EcCC
Confidence                 01223333   67899999999 778889999999 9999999999999999988  33    23444   9999


Q ss_pred             CCcEEEEcc-cCceeeecCCCCCCCCCcEEEeCCCccEEEEccCCe-EEEEe
Q psy682          214 TSDVKVHTT-FGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGH-IAAFT  263 (330)
Q Consensus       214 Dgtvkl~~~-~G~ll~tL~~h~~~~~v~~v~fS~dG~~l~s~~~~~-~~~~s  263 (330)
                      |.|+|+|.. +-++...|.||.+  .|+.|.+||||+.++||+++. +.+|.
T Consensus       430 DsTLKvw~V~tkKl~~DLpGh~D--EVf~vDwspDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  430 DSTLKVWDVRTKKLKQDLPGHAD--EVFAVDWSPDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             CceEEEEEeeeeeecccCCCCCc--eEEEEEecCCCceeecCCCceEEEeec
Confidence            999999986 6788889999999  999999999999999998665 45553



>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd06071 Beach BEACH (Beige and Chediak-Higashi) domains, implicated in membrane trafficking, are present in a family of proteins conserved throughout eukaryotes Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>PF02138 Beach: Beige/BEACH domain; InterPro: IPR000409 The BEACH domain is found in eukaryotic proteins that have diverse cellular functions ranging from lysosomal traffic to apoptosis and cytokinesisin vesicle trafficking, membrane dynamics, and receptor signaling Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1787|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1786|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1787|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1786|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
1mi1_A414 Crystal Structure Of The Ph-Beach Domain Of Human N 2e-15
1t77_A414 Crystal Structure Of The Ph-Beach Domains Of Human 1e-12
>pdb|1MI1|A Chain A, Crystal Structure Of The Ph-Beach Domain Of Human Neurobeachin Length = 414 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 34/53 (64%), Positives = 42/53 (79%) Query: 277 NLQELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINR 329 +++ELIPE ++LPE VNSNGY LG ED V +N+V+LPPWA PE FVRINR Sbjct: 281 DVKELIPEFYYLPEXFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINR 333
>pdb|1T77|A Chain A, Crystal Structure Of The Ph-Beach Domains Of Human LrbaBGL Length = 414 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
1t77_A414 Lipopolysaccharide-responsive and beige-like ancho 6e-14
1t77_A414 Lipopolysaccharide-responsive and beige-like ancho 2e-09
>1t77_A Lipopolysaccharide-responsive and beige-like anchor protein, CDC4-like protein; PH-beach domains, vesicle trafficking, signal transduction; 2.40A {Homo sapiens} SCOP: a.169.1.1 b.55.1.6 PDB: 1mi1_A Length = 414 Back     alignment and structure
 Score = 71.0 bits (173), Expect = 6e-14
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 280 ELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM 330
           ELIPE ++LPEM VN N Y LG  +D   +++VELPPWA + E+FV INR+
Sbjct: 284 ELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRL 334


>1t77_A Lipopolysaccharide-responsive and beige-like anchor protein, CDC4-like protein; PH-beach domains, vesicle trafficking, signal transduction; 2.40A {Homo sapiens} SCOP: a.169.1.1 b.55.1.6 PDB: 1mi1_A Length = 414 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.98
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.96
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.96
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.94
2pm7_B297 Protein transport protein SEC13, protein transport 99.94
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.94
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.93
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.93
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.93
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.93
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.93
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.93
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.93
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.93
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.92
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.92
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.92
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.92
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.92
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.92
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.92
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.91
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.91
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.91
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.91
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.91
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.91
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.9
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.9
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
2pm7_B297 Protein transport protein SEC13, protein transport 99.89
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.89
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.89
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.89
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.89
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.89
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.88
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.88
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.88
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.88
3jrp_A379 Fusion protein of protein transport protein SEC13 99.88
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.88
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.87
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.87
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.87
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.87
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.86
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.86
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.86
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.86
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.85
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.85
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.85
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.85
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.85
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.84
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.83
3jro_A 753 Fusion protein of protein transport protein SEC13 99.83
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.83
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.83
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.82
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.82
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.82
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.82
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.82
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.82
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.81
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.81
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.81
3jrp_A379 Fusion protein of protein transport protein SEC13 99.81
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.81
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.8
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.79
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.79
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.79
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.79
1t77_A414 Lipopolysaccharide-responsive and beige-like ancho 99.78
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.78
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.77
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.77
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.77
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.77
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.76
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.74
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.74
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.74
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.73
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.73
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.73
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.72
3jro_A 753 Fusion protein of protein transport protein SEC13 99.72
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.71
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.71
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.71
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.68
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.63
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.63
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.6
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.58
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.58
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.57
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.57
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.57
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.55
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.53
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.51
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.5
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.48
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.46
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.45
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.45
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.44
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.43
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.43
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.42
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.41
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.38
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.36
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.35
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.34
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.32
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.27
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.26
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.25
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.25
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.24
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.23
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.15
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.08
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.06
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.05
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.04
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.02
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.99
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.97
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.93
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.91
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.89
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.87
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.81
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.8
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.78
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.71
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.7
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.7
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.66
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.62
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.57
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.55
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.53
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.45
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.45
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.42
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.41
2qe8_A343 Uncharacterized protein; structural genomics, join 98.36
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.25
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.2
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.19
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.17
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.13
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.13
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.09
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.09
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.06
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.04
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.91
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.85
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.85
2qe8_A343 Uncharacterized protein; structural genomics, join 97.79
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.77
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.74
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.67
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.64
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.56
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.53
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.51
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.41
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.36
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.3
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.16
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.13
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.97
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 96.74
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.7
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.38
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.27
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.15
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.68
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.58
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.54
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.28
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 95.19
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 94.98
3v65_B386 Low-density lipoprotein receptor-related protein; 94.95
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 94.89
2ece_A462 462AA long hypothetical selenium-binding protein; 94.88
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.81
2ece_A462 462AA long hypothetical selenium-binding protein; 94.68
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.46
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.45
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 93.95
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.69
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.47
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.83
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 92.49
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.23
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.01
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.14
3v65_B386 Low-density lipoprotein receptor-related protein; 89.77
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 89.59
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 89.57
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 89.49
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 89.15
3kya_A496 Putative phosphatase; structural genomics, joint c 88.99
3p5b_L400 Low density lipoprotein receptor variant; B-propel 88.91
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 87.94
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 87.03
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 86.95
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 86.78
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 86.34
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 86.07
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 85.84
3kya_A496 Putative phosphatase; structural genomics, joint c 81.74
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 81.18
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
Probab=99.98  E-value=6.7e-32  Score=267.08  Aligned_cols=269  Identities=17%  Similarity=0.216  Sum_probs=216.2

Q ss_pred             CcccCCCcEEEeecccccccceeecCCCceeEEEeCCCCCc-----------------CcceeeeecCccEEEEEeCCCC
Q psy682            1 MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKY-----------------SPMMFSTVLDDVCMSLKFPSNS   63 (330)
Q Consensus         1 asgs~d~~V~lW~~~~g~~l~tl~gH~~~V~svafSpdg~~-----------------~~l~~~~~~~d~~~~v~Fs~~~   63 (330)
                      |+|+.||+|++|+. +++.+.++.+|...|.+++|+|||+.                 ..+....+|+..+..++|+||+
T Consensus       196 ~~~~~d~~v~~w~~-~~~~~~~~~~~~~~v~~~~~s~dg~~l~~~~~d~~i~~w~~~~~~~~~~~~~~~~v~~v~~~~d~  274 (577)
T 2ymu_A          196 ASASDDKTVKLWNR-NGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDG  274 (577)
T ss_dssp             EEEETTSEEEEECT-TSCEEEEEECCSSCEEEEEECTTSSCEEEEETTSCEEEECTTSCEEEEECCCSSCEEEEEECTTS
T ss_pred             EEEcCCCEEEEEeC-CCcEEEEEecCCCCEEEEEECCCCCEEEEEeCCCEEEEEeCCCCEEEEEecCCCCEEEEEEcCCC
Confidence            47889999999997 67899999999999999999999987                 2223456888999999999999


Q ss_pred             CeeEeeeccc------------------------eeccCCcEEEEEcCCcceEEEeCCCCCCcccCCCCCCCCCCCCCCc
Q psy682           64 PICHVTANTY------------------------VTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNL  119 (330)
Q Consensus        64 ~v~~~~~~~~------------------------~~~~~~~~v~vS~~~~~tv~lW~~~~~~~~~~~~h~~~~~~~~~~l  119 (330)
                      +.++.+....                        ..+.+++..+++++.+++|++|+.++..+....+|..    .+.++
T Consensus       275 ~~l~~~~~d~~i~~w~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~t~~~d~~i~~w~~~~~~~~~~~~~~~----~v~~~  350 (577)
T 2ymu_A          275 QTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQHLQTLTGHSS----SVWGV  350 (577)
T ss_dssp             SEEEEEETTSCEEEEETTSCEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTSCEEEEECCCSS----CEEEE
T ss_pred             CEEEEEeCCCEEEEEeCCCcEEEEEecCCCCeEEEEECCCCCEEEEEeCCCeEEEEeCCCCeeEEEeCCCC----CEEEE
Confidence            9888765432                        2456677778899999999999998888888888874    66789


Q ss_pred             cccCCCc-eeccCCCCCCCcceeccCCCCccceeeee---eEEEEecCCCeEEEeeccCCeEEEeeecccccccccccCC
Q psy682          120 PLTLDPI-LTHPTSNNNAPVPKRHLGDNFSQKLRVRH---NCFVTTVDSRFLLACGFWDNSFREPFTTMYLALQEGKFDH  195 (330)
Q Consensus       120 ~fs~D~~-l~~~s~~~~~~~~~~~l~~~~~~~~~~~~---~~~~~spDg~~i~asg~~D~tirl~w~~~~g~l~~~l~gH  195 (330)
                      .|+||+. +++++.++.  +..+...+...+++..+.   .+++|+|||++ +++|+.|++|++ |+. ++++++.+.+|
T Consensus       351 ~~s~~g~~l~~~~~dg~--v~~~~~~~~~~~~~~~~~~~v~~~~~s~dg~~-l~~~~~d~~v~~-~~~-~~~~~~~~~~~  425 (577)
T 2ymu_A          351 AFSPDGQTIASASDDKT--VKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQT-IASASDDKTVKL-WNR-NGQLLQTLTGH  425 (577)
T ss_dssp             EECTTSSEEEEEETTSE--EEEEETTCCEEEEEECCSSCEEEEEECTTSSC-EEEEETTSEEEE-ECT-TCCEEEEEECC
T ss_pred             EECCCCCEEEEEeCCCE--EEEEcCCCCEEEEecCCCCCeEEEEECCCCCE-EEEEeCCCEEEE-EeC-CCCEEEEecCC
Confidence            9999999 554333332  334443333334444443   57899999999 555668999999 997 58999999999


Q ss_pred             CCcE-----------EEe-----HHHHHhh----------------------------hccCCCcEEEEcccCceeeecC
Q psy682          196 PNRL-----------FSS-----ISLAWKN----------------------------CQRDTSDVKVHTTFGDLLRSLD  231 (330)
Q Consensus       196 ~d~V-----------iaS-----t~~lW~~----------------------------SgS~Dgtvkl~~~~G~ll~tL~  231 (330)
                      ...|           +++     ++++|+.                            +|+.||+|+||+.+|+++++|.
T Consensus       426 ~~~v~~~~~s~d~~~l~~~~~d~~v~~w~~~~~~~~~~~~~~~~v~~~~~spd~~~las~~~d~~i~iw~~~~~~~~~~~  505 (577)
T 2ymu_A          426 SSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLT  505 (577)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSEEEEEETTSCEEEEEECCSSCEEEEEECTTSCEEEEEETTSEEEEEETTSCEEEEEE
T ss_pred             CCCeEEEEECCCCCEEEEEcCCCEEEEEECCCCEEEEEcCCCCCEEEEEEcCCCCEEEEEeCCCEEEEEcCCCCEEEEEe
Confidence            9987           222     7888876                            8899999999999999999999


Q ss_pred             CCCCCCCCcEEEeCCCccEEEEcc-CCeEEEEeeCCceeeeccCc-cccccc
Q psy682          232 PPSGFASPESVVMSREGVIVVNYE-RGHIAAFTMNGNRLRHESHN-DNLQEL  281 (330)
Q Consensus       232 ~h~~~~~v~~v~fS~dG~~l~s~~-~~~~~~~s~nG~~las~~~~-~dVkEL  281 (330)
                      +|.+  .|.+|+|||||+.||+++ ++.+++|..+|+.++.+..| +.|..|
T Consensus       506 ~h~~--~v~~l~~s~dg~~l~s~~~dg~v~lwd~~~~~~~~~~~h~~~v~~~  555 (577)
T 2ymu_A          506 GHSS--SVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGV  555 (577)
T ss_dssp             CCSS--CEEEEEECTTSSCEEEEETTSEEEEECTTSCEEEEEECCSSCEEEE
T ss_pred             CCCC--CEEEEEEcCCCCEEEEEECcCEEEEEeCCCCEEEEEcCCCCCEEEE
Confidence            9999  999999999999999985 78999999999999998755 445544



>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1t77_A Lipopolysaccharide-responsive and beige-like anchor protein, CDC4-like protein; PH-beach domains, vesicle trafficking, signal transduction; 2.40A {Homo sapiens} SCOP: a.169.1.1 b.55.1.6 PDB: 1mi1_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d1t77a1304 a.169.1.1 (A:2186-2489) Lipopolysaccharide-respons 2e-14
>d1t77a1 a.169.1.1 (A:2186-2489) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} Length = 304 Back     information, alignment and structure

class: All alpha proteins
fold: BEACH domain
superfamily: BEACH domain
family: BEACH domain
domain: Lipopolysaccharide-responsive and beige-like anchor protein LRBA
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.0 bits (171), Expect = 2e-14
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 280 ELIPELFFLPEMLVNSNGYCLGKTEDNVNINNVELPPWASSPEQFVRINRM 330
           ELIPE ++LPEM VN N Y LG  +D   +++VELPPWA + E+FV INR+
Sbjct: 174 ELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRL 224


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.92
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.92
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.91
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.91
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.91
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.91
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.91
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.91
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.89
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.87
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.87
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.86
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.84
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.83
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.82
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.81
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.8
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.8
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.78
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.78
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.76
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.76
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.74
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.73
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.73
d1t77a1304 Lipopolysaccharide-responsive and beige-like ancho 99.72
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.68
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.65
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.65
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.6
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.59
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.56
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.53
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.52
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.43
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.42
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.42
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.3
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.21
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.18
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.14
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.12
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.05
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.99
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.8
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.72
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.51
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.25
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.11
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.91
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.67
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.4
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.34
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.13
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.88
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.39
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.18
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.13
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.7
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.62
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 92.69
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.47
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=2.8e-29  Score=220.36  Aligned_cols=232  Identities=13%  Similarity=0.122  Sum_probs=176.1

Q ss_pred             CcccCCCcEEEeecccccccceeecCCCceeEEEeCCCCCc------------------CcceeeeecCccEEEEEeCCC
Q psy682            1 MSGGDKGIVEVWRTFNLALLYAFPSCDSSVRSLALSHDQKY------------------SPMMFSTVLDDVCMSLKFPSN   62 (330)
Q Consensus         1 asgs~d~~V~lW~~~~g~~l~tl~gH~~~V~svafSpdg~~------------------~~l~~~~~~~d~~~~v~Fs~~   62 (330)
                      ||||.||+||||++.+|+++.+|++|...|++++|+|++..                  .......++...+..+.|+|+
T Consensus        33 ~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (317)
T d1vyhc1          33 VSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPN  112 (317)
T ss_dssp             EEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETTSSCEEECCCCCSSCEEEEEECSS
T ss_pred             EEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeecccccccccccccccccccccccccccccccccccceeeeccCC
Confidence            58999999999999999999999999999999999999987                  111123467778888999999


Q ss_pred             CCeeEeeeccceeccCCcEEEEEcCCcceEEEeCCCCCC-cccCCCCCCCCCCCCCCccccCCCc-eeccCCCCCCCcce
Q psy682           63 SPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA-SIQSPSYAETPGSPPGNLPLTLDPI-LTHPTSNNNAPVPK  140 (330)
Q Consensus        63 ~~v~~~~~~~~~~~~~~~~v~vS~~~~~tv~lW~~~~~~-~~~~~~h~~~~~~~~~~l~fs~D~~-l~~~s~~~~~~~~~  140 (330)
                      ++.+                 ++++.|+.+++|+..... ...+.+|.    ....++.|++|+. +++++.++..  ..
T Consensus       113 ~~~~-----------------~~~~~d~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~l~~~~~d~~v--~~  169 (317)
T d1vyhc1         113 GDHI-----------------VSASRDKTIKMWEVQTGYCVKTFTGHR----EWVRMVRPNQDGTLIASCSNDQTV--RV  169 (317)
T ss_dssp             SSEE-----------------EEEETTSEEEEEETTTCCEEEEEECCS----SCEEEEEECTTSSEEEEEETTSCE--EE
T ss_pred             CceE-----------------EeeccCcceeEeecccceeeeEEccCC----CcceeeecccCCCEEEEEeCCCeE--EE
Confidence            8874                 778889999999987554 44445776    3567899999999 5543333332  22


Q ss_pred             eccCC-CCccceeee---eeEEEEecC--------------------CCeEEEeeccCCeEEEeeecccccccccccCCC
Q psy682          141 RHLGD-NFSQKLRVR---HNCFVTTVD--------------------SRFLLACGFWDNSFREPFTTMYLALQEGKFDHP  196 (330)
Q Consensus       141 ~~l~~-~~~~~~~~~---~~~~~~spD--------------------g~~i~asg~~D~tirl~w~~~~g~l~~~l~gH~  196 (330)
                      +.+.. .....+..+   ..+++++|+                    +++ +.+|+.|++|++ |++.+++++.++.+|.
T Consensus       170 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~d~~i~~-~~~~~~~~~~~~~~~~  247 (317)
T d1vyhc1         170 WVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPF-LLSGSRDKTIKM-WDVSTGMCLMTLVGHD  247 (317)
T ss_dssp             EETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCE-EEEEETTSEEEE-EETTTTEEEEEEECCS
T ss_pred             EeeccceeeEEEecCCCCceEEEEeeccccceeeccccceeeeeccCCce-eEeccCCCEEEE-EECCCCcEEEEEeCCC
Confidence            22211 011111111   124444444                    445 566778999999 9999999999999999


Q ss_pred             CcEE--E-e---HHHHHhhhccCCCcEEEEcc-cCceeeecCCCCCCCCCcEEEeCCCccEEEEcc-CCeEEEE
Q psy682          197 NRLF--S-S---ISLAWKNCQRDTSDVKVHTT-FGDLLRSLDPPSGFASPESVVMSREGVIVVNYE-RGHIAAF  262 (330)
Q Consensus       197 d~Vi--a-S---t~~lW~~SgS~Dgtvkl~~~-~G~ll~tL~~h~~~~~v~~v~fS~dG~~l~s~~-~~~~~~~  262 (330)
                      ..|.  + +   ...+   +|+.||+|+||+. +|+++++|.+|.+  .|.+|+|||||+.||+++ |++|++|
T Consensus       248 ~~v~~~~~~~~~~~l~---s~~~dg~i~iwd~~~~~~~~~~~~h~~--~V~~~~~s~~~~~l~s~s~Dg~i~iW  316 (317)
T d1vyhc1         248 NWVRGVLFHSGGKFIL---SCADDKTLRVWDYKNKRCMKTLNAHEH--FVTSLDFHKTAPYVVTGSVDQTVKVW  316 (317)
T ss_dssp             SCEEEEEECSSSSCEE---EEETTTEEEEECCTTSCCCEEEECCSS--CEEEEEECSSSSCEEEEETTSEEEEE
T ss_pred             CCEEEEEECCCCCEEE---EEECCCeEEEEECCCCcEEEEEcCCCC--CEEEEEEcCCCCEEEEEeCCCeEEEe
Confidence            9882  2 2   3344   8999999999976 7999999999999  999999999999999985 7889888



>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t77a1 a.169.1.1 (A:2186-2489) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure