Psyllid ID: psy6837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MRDLTLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
cEEEEccccccccEEEEEEEEEEccccccccccccEEEEEEccccccccEEEEEEEEccccccEEEEEEEEcccccEEEEccccEEEEccccccccccEEEEEEEEEEcccccEEEEEEEEc
cccccccccccccEEEEEEEEEEEcccccccEccccEEEEEccccccccEEEEEEEEccccccEEEEEEEcccccEEEEcccccEEEEEccccHHHcccEEEEEEEEcccccccEEEEEEcc
MRDLTLNLAHKFGVIGCVQLrildrndsppsfadfhteytisedvpvGTLVAKVkaidpdlpgtiayslvagdegKFVLesssgnlklkdtldreQKDKYRVQVrasdgvqsADVVLTILNC
mrdltlnlAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVlesssgnlklkdtldreqKDKYRVqvrasdgvqsadvvLTILNC
MRDLTLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
****TLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVL**********************************DVVLTI***
MRDLTLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
MRDLTLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
****TLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDLTLNLAHKFGVIGCVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKFVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTILNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
P33450 5147 Cadherin-related tumor su yes N/A 0.811 0.019 0.470 1e-21
Q2PZL6 4981 Protocadherin Fat 4 OS=Mu yes N/A 0.852 0.020 0.396 8e-13
Q96JQ0 3298 Protocadherin-16 OS=Homo yes N/A 0.803 0.029 0.41 8e-13
Q6V0I7 4981 Protocadherin Fat 4 OS=Ho no N/A 0.852 0.020 0.369 3e-12
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.745 0.019 0.387 6e-11
Q14517 4588 Protocadherin Fat 1 OS=Ho no N/A 0.836 0.022 0.371 7e-11
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.745 0.019 0.387 8e-11
Q6V1P9 2916 Protocadherin-23 OS=Homo no N/A 0.836 0.034 0.351 9e-11
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.778 0.020 0.363 5e-10
P58365 3317 Cadherin-23 OS=Rattus nor no N/A 0.737 0.027 0.408 1e-09
>sp|P33450|FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster GN=ft PE=1 SV=3 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (68%)

Query: 18   VQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKF 77
            V++ +LD+NDSPP F D    Y +SED+ +G  ++ ++A DPD  G++ + L+ G +GKF
Sbjct: 1809 VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKF 1868

Query: 78   VLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTI 119
            +LE S+G L L DTLDRE K KY +++R SDGVQ  +   TI
Sbjct: 1869 LLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATI 1910
Could function as a cell-adhesion protein. Acts as a tumor suppressor. Required for correct morphogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q2PZL6|FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus GN=Fat4 PE=1 SV=2 Back     alignment and function description
>sp|Q96JQ0|PCD16_HUMAN Protocadherin-16 OS=Homo sapiens GN=DCHS1 PE=2 SV=1 Back     alignment and function description
>sp|Q6V0I7|FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q6V1P9|PCD23_HUMAN Protocadherin-23 OS=Homo sapiens GN=DCHS2 PE=2 SV=1 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|P58365|CAD23_RAT Cadherin-23 OS=Rattus norvegicus GN=Cdh23 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
242014336 5078 protocadherin-16 precursor, putative [Pe 0.844 0.020 0.538 3e-25
189236209 4974 PREDICTED: similar to AGAP007924-PA [Tri 0.811 0.019 0.558 7e-24
270006423 3284 cadherin-like protein [Tribolium castane 0.811 0.030 0.558 7e-24
170032325 644 conserved hypothetical protein [Culex qu 0.819 0.155 0.514 9e-24
195437460 5118 GK24450 [Drosophila willistoni] gi|19416 0.811 0.019 0.509 1e-22
195401052 5168 GJ16197 [Drosophila virilis] gi|19415600 0.836 0.019 0.452 1e-20
194855946 5150 GG24390 [Drosophila erecta] gi|190660515 0.811 0.019 0.470 2e-20
195160152 5086 GL16483 [Drosophila persimilis] gi|19411 0.811 0.019 0.470 2e-20
198475669 4959 GA17399 [Drosophila pseudoobscura pseudo 0.811 0.019 0.470 2e-20
195576483 3385 GD22718 [Drosophila simulans] gi|1941901 0.811 0.029 0.470 4e-20
>gi|242014336|ref|XP_002427847.1| protocadherin-16 precursor, putative [Pediculus humanus corporis] gi|212512316|gb|EEB15109.1| protocadherin-16 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 77/104 (74%), Gaps = 1/104 (0%)

Query: 18   VQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLV-AGDEGK 76
            V++ +LD+NDSPPSF +    Y++SED+PVG ++A + A+DPD  G I Y+LV  G E K
Sbjct: 1752 VRVNVLDKNDSPPSFKNTKLNYSVSEDLPVGHVIATINAVDPDTIGKITYNLVGGGGENK 1811

Query: 77   FVLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTIL 120
            F +ESSSG LKL D+LDRE KD Y++QVRA+DG+Q  D ++ I 
Sbjct: 1812 FEIESSSGILKLNDSLDRETKDSYQLQVRANDGIQYTDAIVKIF 1855

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189236209|ref|XP_971084.2| PREDICTED: similar to AGAP007924-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270006423|gb|EFA02871.1| cadherin-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170032325|ref|XP_001844032.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872318|gb|EDS35701.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195437460|ref|XP_002066658.1| GK24450 [Drosophila willistoni] gi|194162743|gb|EDW77644.1| GK24450 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195401052|ref|XP_002059128.1| GJ16197 [Drosophila virilis] gi|194156002|gb|EDW71186.1| GJ16197 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194855946|ref|XP_001968648.1| GG24390 [Drosophila erecta] gi|190660515|gb|EDV57707.1| GG24390 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195160152|ref|XP_002020940.1| GL16483 [Drosophila persimilis] gi|194117890|gb|EDW39933.1| GL16483 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198475669|ref|XP_001357109.2| GA17399 [Drosophila pseudoobscura pseudoobscura] gi|198137906|gb|EAL34175.2| GA17399 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195576483|ref|XP_002078105.1| GD22718 [Drosophila simulans] gi|194190114|gb|EDX03690.1| GD22718 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
FB|FBgn0001075 5147 ft "fat" [Drosophila melanogas 0.836 0.019 0.470 4.9e-20
UNIPROTKB|F1NLP0 4964 FAT4 "Uncharacterized protein" 0.852 0.020 0.405 5.4e-12
MGI|MGI:3045256 4981 Fat4 "FAT tumor suppressor hom 0.852 0.020 0.414 5.4e-12
RGD|1564291 4981 Fat4 "FAT tumor suppressor hom 0.852 0.020 0.405 6.9e-12
UNIPROTKB|Q96JQ0 3298 DCHS1 "Protocadherin-16" [Homo 0.803 0.029 0.41 1.5e-11
UNIPROTKB|E1B949 4983 FAT4 "Uncharacterized protein" 0.852 0.020 0.387 1.8e-11
UNIPROTKB|Q6V0I7 4981 FAT4 "Protocadherin Fat 4" [Ho 0.852 0.020 0.378 2.3e-11
UNIPROTKB|E2RR85 4982 FAT4 "Uncharacterized protein" 0.852 0.020 0.378 2.3e-11
UNIPROTKB|I3LUS1 3297 DCHS1 "Uncharacterized protein 0.836 0.030 0.384 3.2e-11
ZFIN|ZDB-GENE-980526-242 950 pcdh8 "protocadherin 8" [Danio 0.762 0.097 0.39 3.2e-11
FB|FBgn0001075 ft "fat" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 4.9e-20, P = 4.9e-20
 Identities = 48/102 (47%), Positives = 70/102 (68%)

Query:    18 VQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDEGKF 77
             V++ +LD+NDSPP F D    Y +SED+ +G  ++ ++A DPD  G++ + L+ G +GKF
Sbjct:  1809 VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKF 1868

Query:    78 VLESSSGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTI 119
             +LE S+G L L DTLDRE K KY +++R SDGVQ  +   TI
Sbjct:  1869 LLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATI 1910
GO:0005887 "integral to plasma membrane" evidence=ISS;NAS
GO:0000904 "cell morphogenesis involved in differentiation" evidence=IMP
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS;NAS
GO:0008283 "cell proliferation" evidence=IMP
GO:0007446 "imaginal disc growth" evidence=IMP
GO:0018149 "peptide cross-linking" evidence=IPI
GO:0016021 "integral to membrane" evidence=TAS
GO:0007156 "homophilic cell adhesion" evidence=IEA;ISS
GO:0050839 "cell adhesion molecule binding" evidence=ISS;IDA
GO:0004872 "receptor activity" evidence=ISS
GO:0045571 "negative regulation of imaginal disc growth" evidence=IMP;TAS
GO:0045317 "equator specification" evidence=IMP;NAS
GO:0042067 "establishment of ommatidial planar polarity" evidence=IGI;IMP;TAS
GO:0016318 "ommatidial rotation" evidence=TAS
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP;TAS
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0007164 "establishment of tissue polarity" evidence=IMP;NAS
GO:0030178 "negative regulation of Wnt receptor signaling pathway" evidence=TAS
GO:0005886 "plasma membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0040008 "regulation of growth" evidence=IGI;IMP
GO:0045926 "negative regulation of growth" evidence=IMP
GO:0001736 "establishment of planar polarity" evidence=IGI;IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0048105 "establishment of body hair planar orientation" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0008285 "negative regulation of cell proliferation" evidence=IMP
GO:0035329 "hippo signaling cascade" evidence=IGI
GO:0046620 "regulation of organ growth" evidence=IGI
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0090176 "microtubule cytoskeleton organization involved in establishment of planar polarity" evidence=IMP
UNIPROTKB|F1NLP0 FAT4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:3045256 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564291 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96JQ0 DCHS1 "Protocadherin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1B949 FAT4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR85 FAT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUS1 DCHS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-242 pcdh8 "protocadherin 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-22
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-17
smart0011281 smart00112, CA, Cadherin repeats 2e-11
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 83.1 bits (206), Expect = 3e-22
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 8/91 (8%)

Query: 38  EYTISEDVPVGTLVAKVKAIDPDLP--GTIAYSLVAGDE-GKFVLESSSGNLKLKDTLDR 94
           E ++ E+ P GT+V  V A DPD    G + YS+V+G+E G F ++ S+G +     LDR
Sbjct: 3   EVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTAKPLDR 62

Query: 95  EQKDKYRVQVRASDGVQ-----SADVVLTIL 120
           E++  Y + V A+DG       +A V +T+L
Sbjct: 63  EEQSSYTLTVTATDGGGPPLSSTATVTITVL 93

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.89
KOG4289|consensus 2531 99.89
KOG1219|consensus 4289 99.89
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.87
KOG4289|consensus 2531 99.86
KOG1219|consensus 4289 99.85
cd00031 199 CA Cadherin repeat domain; Cadherins are glycoprot 99.71
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.54
KOG1834|consensus 952 99.41
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 98.45
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 98.39
KOG1834|consensus 952 97.89
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.86
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 96.79
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 93.26
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 92.76
KOG3597|consensus 442 87.07
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 84.76
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 83.97
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 81.97
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information 
Probab=99.89  E-value=3.2e-21  Score=131.40  Aligned_cols=96  Identities=35%  Similarity=0.641  Sum_probs=90.6

Q ss_pred             EEEEEEEecCCCCCcccCCceEEEEeCCCCCCcEEEEEEEECCCC--CCcEEEEEEcCCC-CcEEEECCccEEEEcccCC
Q psy6837          17 CVQLRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDL--PGTIAYSLVAGDE-GKFVLESSSGNLKLKDTLD   93 (122)
Q Consensus        17 ~v~i~V~dvNdn~P~f~~~~~~~~v~E~~~~g~~v~~~~a~D~D~--~~~i~y~l~~~~~-~~f~i~~~~G~i~~~~~Ld   93 (122)
                      .+.|.|.|+|||+|.|....|.+.++|+.++|+.++++.|.|+|.  ++.++|+|.++.. ++|.|++.+|.|.+.+.||
T Consensus        87 ~v~I~V~d~Nd~~P~~~~~~~~~~v~e~~~~~~~i~~~~a~D~D~~~~~~~~y~l~~~~~~~~f~i~~~~G~i~~~~~ld  166 (199)
T cd00031          87 TVTVTVLDVNDNPPVFEQSSYEASVPENAPPGTVVGTVTATDADSGENAKLTYSILSGNDKELFSIDPNTGIITLAKPLD  166 (199)
T ss_pred             EEEEEEccCCCCCCcccccceEEEEeCCCCCCCEEEEEEEEcCCCCCCccEEEEEeCCCCCCEEEEeCCceEEEeCCccC
Confidence            899999999999999998999999999999999999999999998  6999999998765 8999999999999999999


Q ss_pred             ccCCCEEEEEEEEEeCCCC
Q psy6837          94 REQKDKYRVQVRASDGVQS  112 (122)
Q Consensus        94 ~e~~~~~~l~v~a~D~g~~  112 (122)
                      +|....|.+.|.|.|.+.|
T Consensus       167 ~e~~~~~~l~v~a~D~~~~  185 (199)
T cd00031         167 REEKSSYELTVVATDGGGP  185 (199)
T ss_pred             CccCceEEEEEEEEECCCC
Confidence            9999999999999997643

>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>KOG3597|consensus Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 5e-07
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 1e-06
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 1e-06
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 1e-06
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 1e-06
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 3e-06
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 7e-06
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 2e-05
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 8e-05
1l3w_A 546 C-Cadherin Ectodomain Length = 546 2e-04
2wbx_A102 Crystal Structure Of Mouse Cadherin-23 Ec1 Length = 2e-04
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 2e-04
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 3e-04
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 6e-04
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 7e-04
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 7e-04
1q1p_A212 E-Cadherin Activation Length = 212 7e-04
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 7e-04
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 7e-04
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 7e-04
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 7e-04
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 7e-04
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 8e-04
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 8e-04
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
Query: 24  DRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDL--PGTIAYSLVAGDEGKFVLES 81
           D ND+PP FA     +++ EDV +GT + +VKA D D+      +Y ++ GD G  + E 
Sbjct: 207 DVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGD-GTALFEI 265
Query: 82  SS------GNLKLKDTLDREQKDKYRVQVRASD 108
           +S      G ++L+  LD E K  Y ++V A++
Sbjct: 266 TSDAQAQDGVIRLRKPLDFETKKSYTLKVEAAN 298
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|2WBX|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1 Length = 102 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 7e-25
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-22
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 4e-24
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-11
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 7e-24
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-19
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-18
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 8e-07
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 5e-23
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 3e-14
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 8e-23
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 2e-19
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-07
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 2e-22
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 6e-16
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 7e-22
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 2e-15
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 1e-20
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 2e-20
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 5e-15
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 1e-20
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-14
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-20
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-18
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 1e-17
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-13
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-12
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 2e-20
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 4e-20
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-13
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-20
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-18
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-17
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-13
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-12
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-19
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-19
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-18
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-17
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-15
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-19
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-18
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-17
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 9e-15
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-11
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 3e-18
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-14
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 6e-15
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 1e-14
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 3e-14
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 8e-14
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 1e-13
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 4e-13
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 8e-13
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 3e-11
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 5e-04
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
 Score = 92.7 bits (231), Expect = 7e-25
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 4/97 (4%)

Query: 26  NDSPPSFAD--FHTEYTISEDVPVGTLVAKVKAIDPDLPGTIAYSLVAGDE-GKFVLESS 82
            +  P F +  F T   ISED PVG+ V ++ A D D    + + +   +    F +E  
Sbjct: 2   VNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDN-DPLVFGVSGEEASRFFAVEPD 60

Query: 83  SGNLKLKDTLDREQKDKYRVQVRASDGVQSADVVLTI 119
           +G + L+  LDRE K ++ V+   SD        + I
Sbjct: 61  TGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI 97
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.97
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.97
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.96
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.96
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.96
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.96
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.95
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.95
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.95
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.94
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 99.93
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.93
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.93
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.93
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.92
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.92
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.92
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.92
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.92
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.92
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.91
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.9
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.89
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.89
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.86
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 99.85
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.85
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.85
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.84
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.84
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.83
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.83
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.81
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.72
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 99.72
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.7
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 99.7
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.69
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.66
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 99.64
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.62
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.57
4apx_B 242 Protocadherin-15, otocadherin; cell adhesion, hear 99.23
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 97.99
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 96.51
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 95.93
2jtd_A142 Myomesin-1, skelemin; immunoglobulin domain, muscl 84.71
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 83.06
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=1.4e-31  Score=168.80  Aligned_cols=103  Identities=30%  Similarity=0.453  Sum_probs=92.5

Q ss_pred             EEEEecCCCCCcccCCceEEEEeCCCCCCcEEEEEEEECCCC--CCcEEEEEEcC----CCCcEEEECCccEEEEcccCC
Q psy6837          20 LRILDRNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDL--PGTIAYSLVAG----DEGKFVLESSSGNLKLKDTLD   93 (122)
Q Consensus        20 i~V~dvNdn~P~f~~~~~~~~v~E~~~~g~~v~~~~a~D~D~--~~~i~y~l~~~----~~~~f~i~~~~G~i~~~~~Ld   93 (122)
                      |+|.|+|||+|.|.+..|.+.|+|++++|+.++++.|+|+|.  |+.++|+|.+.    ..++|.|++.+|.|++.++||
T Consensus         2 ~~V~DvNDn~P~F~~~~y~~~v~En~~~Gt~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~~~~~F~Id~~tG~I~~~~~LD   81 (114)
T 2ee0_A            2 SSGSSGNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLD   81 (114)
T ss_dssp             CCCCCCCCCCCCCSCSEEEEEEETTCCTTCEEEECCCCSCSSCCCSCCEEEECSSCCHHHHHHEEECTTTCEEEECSCCC
T ss_pred             CeEeeCCCCCCCcCCCcEEEEEECCCCCCCEEEEEEEEeCCCCCCcEEEEEEccCCCCCccceEEEeCCeeEEEECccCC
Confidence            568999999999999999999999999999999999999998  88999999863    246899999999999999999


Q ss_pred             ccCCCEEEEEEEEEeCCCCcee---EEEEEcC
Q psy6837          94 REQKDKYRVQVRASDGVQSADV---VLTILNC  122 (122)
Q Consensus        94 ~e~~~~~~l~v~a~D~g~~~~~---~v~I~d~  122 (122)
                      ||....|.|.|.|+|+|.|+.+   +|+|.|+
T Consensus        82 ~E~~~~y~l~V~A~D~g~~~~~~~v~I~V~Dv  113 (114)
T 2ee0_A           82 REETAIHKVTVLASDGSSTPARATVTINVTDV  113 (114)
T ss_dssp             TTTCSEEEEEEEEESSSSSCEEEEEEEEEECC
T ss_pred             cccCcEEEEEEEEEECCCCceEEEEEEEEEEC
Confidence            9999999999999997776533   6666664
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>2jtd_A Myomesin-1, skelemin; immunoglobulin domain, muscle protein, thick filament, immune system, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 2e-10
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 2e-09
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 1e-08
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 2e-08
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 8e-08
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 9e-08
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 1e-07
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 3e-07
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 3e-05
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 3e-04
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 51.9 bits (123), Expect = 2e-10
 Identities = 21/102 (20%), Positives = 39/102 (38%), Gaps = 9/102 (8%)

Query: 27  DSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDLP--GTIAYSLVAGDEGKFVLESSSG 84
           +  P F    +   +SED+  G  +  + A DPD      ++Y +         +   +G
Sbjct: 1   NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGNDPARWLTVNKDNG 60

Query: 85  NLKLKDTLDRE----QKDKYRVQVRASDG---VQSADVVLTI 119
            +     LDRE    + + Y V +  +D    V +    L +
Sbjct: 61  IVTGNGNLDRESEYVKNNTYTVIMLVTDDGVSVGTGTGTLIL 102
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.93
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.93
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.92
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.91
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.88
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.85
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.77
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.74
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.72
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.71
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 95.89
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 90.68
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.93  E-value=6.1e-26  Score=140.85  Aligned_cols=97  Identities=30%  Similarity=0.440  Sum_probs=84.0

Q ss_pred             cCCCCCcccCCceEEEEeCCCCCCcEEEEEEEECCCC-----CCcEEEEEEcCC-----CCcEEEECCccEEEEc-ccCC
Q psy6837          25 RNDSPPSFADFHTEYTISEDVPVGTLVAKVKAIDPDL-----PGTIAYSLVAGD-----EGKFVLESSSGNLKLK-DTLD   93 (122)
Q Consensus        25 vNdn~P~f~~~~~~~~v~E~~~~g~~v~~~~a~D~D~-----~~~i~y~l~~~~-----~~~f~i~~~~G~i~~~-~~Ld   93 (122)
                      .|||+|.|.+..|.+.|+|++++|+.++++.|.|+|.     |+.+.|+|..+.     .++|.|++.+|.|++. +.||
T Consensus         1 eNDn~P~F~~~~y~~~V~En~~~gt~v~~v~A~D~D~~~~~~n~~i~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~LD   80 (113)
T d1l3wa2           1 QNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFTINRETGVISLIGTGLD   80 (113)
T ss_dssp             CSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSCCSCSCSEEECTTTCEEEECSCCCC
T ss_pred             CCCCCCccCCCeEEEEEECCCCCCCEEEEEEeecccccccccceEEEEEEecCCCCccccceeeeeecceeEEEeccccC
Confidence            4999999999999999999999999999999999996     567999997653     2689999999999885 5799


Q ss_pred             ccCCCEEEEEEEEEeCCCCcee-----EEEEEc
Q psy6837          94 REQKDKYRVQVRASDGVQSADV-----VLTILN  121 (122)
Q Consensus        94 ~e~~~~~~l~v~a~D~g~~~~~-----~v~I~d  121 (122)
                      ||....|.|.|.|+|+|.|+.+     .|+|.|
T Consensus        81 ~E~~~~y~l~V~a~D~~~~~~~~~~~v~I~V~D  113 (113)
T d1l3wa2          81 REKFPEYTLTVQATDLEGAGLSVEGKAIIQITD  113 (113)
T ss_dssp             TTTCCEEEEEEEEEHHHHTSCEEECCEEEEEEC
T ss_pred             cccCCEEEEEEEEEECCCCCcEEEEEEEEEEEC
Confidence            9999999999999996665443     555554
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure