Psyllid ID: psy683

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSMPIP
cEEEccEEEEEEEEEEccccccEEEEcccccEEEccEEEccccccEEEEEccEEEEEEEEEEEcccccEEEEcccccEEEccEEEEcccccEEEEEcccEEEEccEEEccccccEEEEccccEEEEcEEEEcccccc
cccccccEEEEEcEEEcccccEEEEEcccccEEEEEEEEcccccEEEEEccccEEEEEcEEEcccccEEEEEcccccEEEEcEEEcccccEEEEEccccEEEEEcEEEcccccEEEEEcccccEEEEcEEccccccc
MARQKGKAQVLMMVHCGNALAgiqirtssdpivrhnkihhgqhggvyvhekgvglieENEVYANTLAGVWittgsapvlrrnrihsgkqvgvyfydnghgkledndifnhlysgvqisnettatldacglrrsmpip
MARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKihhgqhggvYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQisnettatldacglrrsmpip
MARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSMPIP
********QVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACG********
MARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRS****
********QVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSMPIP
****KGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSMP**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSMPIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q86XK2 927 F-box only protein 11 OS= yes N/A 0.737 0.108 0.881 4e-48
Q7TPD1 843 F-box only protein 11 OS= yes N/A 0.737 0.119 0.881 4e-48
Q7TSL3 843 F-box only protein 11 OS= yes N/A 0.737 0.119 0.881 5e-48
Q9UK96 956 F-box only protein 10 OS= no N/A 0.715 0.102 0.37 4e-13
Q7TQF2 950 F-box only protein 10 OS= no N/A 0.715 0.103 0.36 7e-13
>sp|Q86XK2|FBX11_HUMAN F-box only protein 11 OS=Homo sapiens GN=FBXO11 PE=1 SV=3 Back     alignment and function desciption
 Score =  189 bits (481), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%)

Query: 17  GNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSA 76
           GNALAGIQIRT+S PIVRHNKIH GQHGG+YVHEKG G+IEENEVY+NTLAGVW+TTGS 
Sbjct: 568 GNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGST 627

Query: 77  PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI 117
           PVLRRNRIHSGKQVGVYFYDNGHG LEDNDI+NH+YSGVQI
Sbjct: 628 PVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQI 668
Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.
Homo sapiens (taxid: 9606)
>sp|Q7TPD1|FBX11_MOUSE F-box only protein 11 OS=Mus musculus GN=Fbxo11 PE=2 SV=2 Back     alignment and function description
>sp|Q7TSL3|FBX11_RAT F-box only protein 11 OS=Rattus norvegicus GN=Fbxo11 PE=2 SV=1 Back     alignment and function description
>sp|Q9UK96|FBX10_HUMAN F-box only protein 10 OS=Homo sapiens GN=FBXO10 PE=2 SV=3 Back     alignment and function description
>sp|Q7TQF2|FBX10_MOUSE F-box only protein 10 OS=Mus musculus GN=Fbxo10 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
312384491 1991 hypothetical protein AND_02054 [Anophele 0.737 0.050 0.960 8e-52
347966462 1335 AGAP001731-PA [Anopheles gambiae str. PE 0.737 0.075 0.960 3e-51
157107840 1058 f-box only protein [Aedes aegypti] gi|10 0.737 0.095 0.960 4e-51
270010664 915 hypothetical protein TcasGA2_TC010102 [T 0.686 0.102 0.960 4e-51
170032817 1099 f-box only protein [Culex quinquefasciat 0.737 0.091 0.960 4e-51
328704120 921 PREDICTED: f-box only protein 11-like is 0.737 0.109 0.950 4e-51
189239600 882 PREDICTED: similar to AGAP001731-PA [Tri 0.686 0.106 0.960 4e-51
195108847 1189 GI23313 [Drosophila mojavensis] gi|19391 0.737 0.084 0.950 5e-51
195390610 1167 GJ24169 [Drosophila virilis] gi|19415204 0.737 0.086 0.950 5e-51
110756745 951 PREDICTED: f-box only protein 11-like [A 0.737 0.106 0.960 5e-51
>gi|312384491|gb|EFR29210.1| hypothetical protein AND_02054 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%)

Query: 17   GNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSA 76
            GNALAGIQIRT+SDPIVRHNKIHHGQHGG+YVHEKG GLIEENEVYANTLAGVWITTGS 
Sbjct: 1632 GNALAGIQIRTTSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYANTLAGVWITTGST 1691

Query: 77   PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI 117
            PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI
Sbjct: 1692 PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI 1732

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347966462|ref|XP_321355.5| AGAP001731-PA [Anopheles gambiae str. PEST] gi|333470049|gb|EAA01825.5| AGAP001731-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157107840|ref|XP_001649962.1| f-box only protein [Aedes aegypti] gi|108879483|gb|EAT43708.1| AAEL004875-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270010664|gb|EFA07112.1| hypothetical protein TcasGA2_TC010102 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170032817|ref|XP_001844276.1| f-box only protein [Culex quinquefasciatus] gi|167873233|gb|EDS36616.1| f-box only protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328704120|ref|XP_003242410.1| PREDICTED: f-box only protein 11-like isoform 2 [Acyrthosiphon pisum] gi|328704124|ref|XP_003242411.1| PREDICTED: f-box only protein 11-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189239600|ref|XP_967912.2| PREDICTED: similar to AGAP001731-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195108847|ref|XP_001999004.1| GI23313 [Drosophila mojavensis] gi|193915598|gb|EDW14465.1| GI23313 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195390610|ref|XP_002053961.1| GJ24169 [Drosophila virilis] gi|194152047|gb|EDW67481.1| GJ24169 [Drosophila virilis] Back     alignment and taxonomy information
>gi|110756745|ref|XP_395525.3| PREDICTED: f-box only protein 11-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
FB|FBgn0037760 1182 FBX011 "FBX011 ortholog" [Dros 0.737 0.085 0.950 2.4e-49
UNIPROTKB|E1B9Q3707 FBXO11 "Uncharacterized protei 0.737 0.142 0.881 8.5e-47
MGI|MGI:2147134 843 Fbxo11 "F-box protein 11" [Mus 0.737 0.119 0.881 3.7e-46
RGD|727935 843 Fbxo11 "F-box protein 11" [Rat 0.737 0.119 0.881 3.7e-46
UNIPROTKB|Q7TSL3 843 Fbxo11 "F-box only protein 11" 0.737 0.119 0.881 3.7e-46
UNIPROTKB|F1PLE4 872 FBXO11 "Uncharacterized protei 0.737 0.115 0.881 4.3e-46
ZFIN|ZDB-GENE-061103-70 879 fbxo11a "F-box protein 11a" [D 0.737 0.114 0.881 4.4e-46
UNIPROTKB|F1NV53 879 FBXO11 "Uncharacterized protei 0.737 0.114 0.881 4.4e-46
UNIPROTKB|Q86XK2 927 FBXO11 "F-box only protein 11" 0.737 0.108 0.881 5.4e-46
UNIPROTKB|I3LN00 928 FBXO11 "Uncharacterized protei 0.737 0.108 0.881 5.4e-46
FB|FBgn0037760 FBX011 "FBX011 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 2.4e-49, P = 2.4e-49
 Identities = 96/101 (95%), Positives = 99/101 (98%)

Query:    17 GNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSA 76
             GNALAGIQIRT+SDPIVRHNKIHHGQHGG+YVHEKG GLIEENEVY+NTLAGVWITTGS 
Sbjct:   823 GNALAGIQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGST 882

Query:    77 PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI 117
             PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI
Sbjct:   883 PVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQI 923
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0070923 "siRNA loading onto RISC involved in chromatin silencing by small RNA" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0060966 "regulation of gene silencing by RNA" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
UNIPROTKB|E1B9Q3 FBXO11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2147134 Fbxo11 "F-box protein 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|727935 Fbxo11 "F-box protein 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TSL3 Fbxo11 "F-box only protein 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLE4 FBXO11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-70 fbxo11a "F-box protein 11a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV53 FBXO11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XK2 FBXO11 "F-box only protein 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN00 FBXO11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86XK2FBX11_HUMANNo assigned EC number0.88110.73720.1089yesN/A
Q7TSL3FBX11_RATNo assigned EC number0.88110.73720.1198yesN/A
Q7TPD1FBX11_MOUSENo assigned EC number0.88110.73720.1198yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
pfam13229157 pfam13229, Beta_helix, Right handed beta helix reg 3e-15
pfam13229157 pfam13229, Beta_helix, Right handed beta helix reg 2e-11
pfam13229157 pfam13229, Beta_helix, Right handed beta helix reg 1e-10
pfam13229157 pfam13229, Beta_helix, Right handed beta helix reg 4e-08
pfam05048238 pfam05048, NosD, Periplasmic copper-binding protei 5e-05
>gnl|CDD|221993 pfam13229, Beta_helix, Right handed beta helix region Back     alignment and domain information 
 Score = 67.5 bits (165), Expect = 3e-15
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 21  AGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLR 80
           +GI I  SS+  + +N I +    G+Y+       IE N +  N   G++I +GS   + 
Sbjct: 1   SGILINGSSNVTIENNTISNNGGNGIYIGGSSNITIENNTITNNGGYGIYI-SGSNNTIS 59

Query: 81  RNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATL 125
            N I +    G+Y   + +  +E+N I N+   G+ +SN +  T+
Sbjct: 60  NNTISNNGGGGIYLRGSSNNTIENNTIENNGGYGIYLSNSSNNTI 104

This region contains a parallel beta helix region that shares some similarity with Pectate lyases. Length = 157
>gnl|CDD|221993 pfam13229, Beta_helix, Right handed beta helix region Back     alignment and domain information
>gnl|CDD|221993 pfam13229, Beta_helix, Right handed beta helix region Back     alignment and domain information
>gnl|CDD|221993 pfam13229, Beta_helix, Right handed beta helix region Back     alignment and domain information
>gnl|CDD|218400 pfam05048, NosD, Periplasmic copper-binding protein (NosD) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
KOG1777|consensus 625 99.93
KOG1777|consensus 625 99.9
PF13229158 Beta_helix: Right handed beta helix region; PDB: 2 99.74
PF13229158 Beta_helix: Right handed beta helix region; PDB: 2 99.72
PF05048236 NosD: Periplasmic copper-binding protein (NosD); I 99.56
TIGR03805 314 beta_helix_1 parallel beta-helix repeat-containing 99.54
PF05048236 NosD: Periplasmic copper-binding protein (NosD); I 99.53
TIGR03805314 beta_helix_1 parallel beta-helix repeat-containing 99.5
TIGR03808 455 RR_plus_rpt_1 twin-arg-translocated uncharacterize 99.4
TIGR03808 455 RR_plus_rpt_1 twin-arg-translocated uncharacterize 99.2
COG3420 408 NosD Nitrous oxidase accessory protein [Inorganic 98.86
PF07602246 DUF1565: Protein of unknown function (DUF1565); In 98.75
COG3420 408 NosD Nitrous oxidase accessory protein [Inorganic 98.65
PF07602246 DUF1565: Protein of unknown function (DUF1565); In 98.48
TIGR0380444 para_beta_helix parallel beta-helix repeat (two co 98.25
TIGR0380444 para_beta_helix parallel beta-helix repeat (two co 98.21
PF12708225 Pectate_lyase_3: Pectate lyase superfamily protein 97.67
PF12708225 Pectate_lyase_3: Pectate lyase superfamily protein 97.66
smart00722146 CASH Domain present in carbohydrate binding protei 97.29
smart00722146 CASH Domain present in carbohydrate binding protei 97.09
PLN02218431 polygalacturonase ADPG 97.09
PLN03003 456 Probable polygalacturonase At3g15720 96.87
PLN02188404 polygalacturonase/glycoside hydrolase family prote 96.85
PF00295326 Glyco_hydro_28: Glycosyl hydrolases family 28; Int 96.8
PLN02793 443 Probable polygalacturonase 96.76
PF01696 386 Adeno_E1B_55K: Adenovirus EB1 55K protein / large 96.74
PF14592 425 Chondroitinas_B: Chondroitinase B; PDB: 1OFM_A 1OF 96.63
PLN02218 431 polygalacturonase ADPG 96.57
PLN02155394 polygalacturonase 96.55
PF08480198 Disaggr_assoc: Disaggregatase related; InterPro: I 96.5
PF14592425 Chondroitinas_B: Chondroitinase B; PDB: 1OFM_A 1OF 96.41
PF08480198 Disaggr_assoc: Disaggregatase related; InterPro: I 96.3
PLN03010 409 polygalacturonase 96.27
smart00656190 Amb_all Amb_all domain. 96.21
PLN02793 443 Probable polygalacturonase 95.96
PLN03003 456 Probable polygalacturonase At3g15720 95.86
PLN02155 394 polygalacturonase 95.76
PLN03010 409 polygalacturonase 95.69
COG5434 542 PGU1 Endopygalactorunase [Cell envelope biogenesis 95.67
PLN02480343 Probable pectinesterase 95.52
PLN02188 404 polygalacturonase/glycoside hydrolase family prote 95.23
PF00295 326 Glyco_hydro_28: Glycosyl hydrolases family 28; Int 95.21
PLN02480 343 Probable pectinesterase 95.15
PF01696 386 Adeno_E1B_55K: Adenovirus EB1 55K protein / large 95.03
PF00544200 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe 93.58
PRK10531422 acyl-CoA thioesterase; Provisional 92.95
smart00656190 Amb_all Amb_all domain. 92.58
PLN02773317 pectinesterase 92.46
smart0071026 PbH1 Parallel beta-helix repeats. The tertiary str 92.23
PF12541277 DUF3737: Protein of unknown function (DUF3737) ; I 91.64
COG5434 542 PGU1 Endopygalactorunase [Cell envelope biogenesis 91.63
PRK09752 1250 adhesin; Provisional 91.49
PLN02665366 pectinesterase family protein 90.93
PF01095298 Pectinesterase: Pectinesterase; InterPro: IPR00007 90.8
PLN02682369 pectinesterase family protein 90.16
PLN02671359 pectinesterase 89.94
PLN02708553 Probable pectinesterase/pectinesterase inhibitor 89.55
PLN02665366 pectinesterase family protein 88.43
PRK10531422 acyl-CoA thioesterase; Provisional 88.37
PLN02634359 probable pectinesterase 88.23
PLN02916502 pectinesterase family protein 87.75
PF00544200 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe 87.64
PLN02745596 Putative pectinesterase/pectinesterase inhibitor 87.09
PRK09752 1250 adhesin; Provisional 87.0
PLN02484587 probable pectinesterase/pectinesterase inhibitor 86.48
PLN02773 317 pectinesterase 85.89
PLN03043538 Probable pectinesterase/pectinesterase inhibitor; 85.78
PLN02201520 probable pectinesterase/pectinesterase inhibitor 85.69
PLN02217 670 probable pectinesterase/pectinesterase inhibitor 85.45
PF01095 298 Pectinesterase: Pectinesterase; InterPro: IPR00007 85.43
PLN02488509 probable pectinesterase/pectinesterase inhibitor 85.38
PLN02432293 putative pectinesterase 85.11
PLN02995539 Probable pectinesterase/pectinesterase inhibitor 84.43
PLN02634359 probable pectinesterase 84.27
PLN02933530 Probable pectinesterase/pectinesterase inhibitor 84.13
PLN02682369 pectinesterase family protein 83.96
PLN02314586 pectinesterase 83.59
PLN02698497 Probable pectinesterase/pectinesterase inhibitor 83.35
PLN02990572 Probable pectinesterase/pectinesterase inhibitor 82.87
PLN02995539 Probable pectinesterase/pectinesterase inhibitor 82.81
PLN02176340 putative pectinesterase 82.22
PLN02170529 probable pectinesterase/pectinesterase inhibitor 81.43
PLN02506537 putative pectinesterase/pectinesterase inhibitor 81.21
PLN02713566 Probable pectinesterase/pectinesterase inhibitor 80.99
COG3866345 PelB Pectate lyase [Carbohydrate transport and met 80.97
PLN02304379 probable pectinesterase 80.9
PLN02432293 putative pectinesterase 80.16
PLN02301548 pectinesterase/pectinesterase inhibitor 80.01
>KOG1777|consensus Back     alignment and domain information 
Probab=99.93  E-value=3.7e-27  Score=188.92  Aligned_cols=132  Identities=40%  Similarity=0.658  Sum_probs=128.4

Q ss_pred             ceecceEEEEeeEEEcCccCCEEEecCCCcEEeccEEEcCCCCcEEEEeCceeEEEeeEEEeCCcCcEEEccCCccEEEe
Q psy683            2 ARQKGKAQVLMMVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRR   81 (137)
Q Consensus         2 ~~~~g~g~i~~c~I~~~~~~GI~v~~~a~~~i~~n~I~~~~~~GI~v~~~~~~~i~~n~I~~n~~~Gv~v~~~a~~~i~~   81 (137)
                      +|++|+|.|+.++++++..+||++..++.|.|+.|+|+...+.|||+++.+.+++|+|+|..+..+||.++.+|+|.+++
T Consensus       354 vHr~gkGLieenkvy~n~lagi~vtTGstP~lR~n~ihSGkq~GVyFydng~glle~ndi~~~~ysgvqirtGsNP~i~~  433 (625)
T KOG1777|consen  354 VHRKGKGLIEENKVYGNTLAGIWVTTGSTPDLRANRIHSGKQVGVYFYDNGHGLLEQNDIRNHKYSGVQIRTGSNPKIRR  433 (625)
T ss_pred             EehhcccceecchHhhhhhheeEecCCCCHhHhhhcccccceeEEEEEeCCcchhhhhhhhhccccceEeecCCCCeeee
Confidence            68899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEcCCcccEEEEeCCeeEEEccEEEccccCcEEEecCCCeEEeceEEecCc
Q psy683           82 NRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRSM  134 (137)
Q Consensus        82 n~I~~~~~~GI~v~~~~~g~ie~n~I~~n~~~Gi~v~~~a~p~l~~n~I~~~~  134 (137)
                      |+|+.++ .||+|..++.|.||+|+|++|+.+|||+++.++|+||+|+|+++.
T Consensus       434 NkIWggq-NGvLVyn~G~Gc~E~NeIFDNaMagVwIKTds~PtlrRNKI~dgR  485 (625)
T KOG1777|consen  434 NKIWGGQ-NGVLVYNGGLGCLEDNEIFDNAMAGVWIKTDSNPTLRRNKIYDGR  485 (625)
T ss_pred             cceecCc-ccEEEEcCcccccccccchhhhhcceEEecCCCcceeecceecCC
Confidence            9999996 689999999999999999999999999999999999999999874

>KOG1777|consensus Back     alignment and domain information
>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A Back     alignment and domain information
>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A Back     alignment and domain information
>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O Back     alignment and domain information
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein Back     alignment and domain information
>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O Back     alignment and domain information
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein Back     alignment and domain information
>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein Back     alignment and domain information
>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein Back     alignment and domain information
>COG3420 NosD Nitrous oxidase accessory protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07602 DUF1565: Protein of unknown function (DUF1565); InterPro: IPR011459 These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans Back     alignment and domain information
>COG3420 NosD Nitrous oxidase accessory protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07602 DUF1565: Protein of unknown function (DUF1565); InterPro: IPR011459 These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans Back     alignment and domain information
>TIGR03804 para_beta_helix parallel beta-helix repeat (two copies) Back     alignment and domain information
>TIGR03804 para_beta_helix parallel beta-helix repeat (two copies) Back     alignment and domain information
>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A Back     alignment and domain information
>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A Back     alignment and domain information
>smart00722 CASH Domain present in carbohydrate binding proteins and sugar hydrolses Back     alignment and domain information
>smart00722 CASH Domain present in carbohydrate binding proteins and sugar hydrolses Back     alignment and domain information
>PLN02218 polygalacturonase ADPG Back     alignment and domain information
>PLN03003 Probable polygalacturonase At3g15720 Back     alignment and domain information
>PLN02188 polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information
>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02793 Probable polygalacturonase Back     alignment and domain information
>PF01696 Adeno_E1B_55K: Adenovirus EB1 55K protein / large t-antigen; InterPro: IPR002612 This family consists of adenovirus E1B 55 kDa protein or large t-antigen Back     alignment and domain information
>PF14592 Chondroitinas_B: Chondroitinase B; PDB: 1OFM_A 1OFL_A 1DBO_A 1DBG_A Back     alignment and domain information
>PLN02218 polygalacturonase ADPG Back     alignment and domain information
>PLN02155 polygalacturonase Back     alignment and domain information
>PF08480 Disaggr_assoc: Disaggregatase related; InterPro: IPR013687 The members of this family are disaggregatases and several hypothetical proteins of the archaeal genus Methanosarcina Back     alignment and domain information
>PF14592 Chondroitinas_B: Chondroitinase B; PDB: 1OFM_A 1OFL_A 1DBO_A 1DBG_A Back     alignment and domain information
>PF08480 Disaggr_assoc: Disaggregatase related; InterPro: IPR013687 The members of this family are disaggregatases and several hypothetical proteins of the archaeal genus Methanosarcina Back     alignment and domain information
>PLN03010 polygalacturonase Back     alignment and domain information
>smart00656 Amb_all Amb_all domain Back     alignment and domain information
>PLN02793 Probable polygalacturonase Back     alignment and domain information
>PLN03003 Probable polygalacturonase At3g15720 Back     alignment and domain information
>PLN02155 polygalacturonase Back     alignment and domain information
>PLN03010 polygalacturonase Back     alignment and domain information
>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02480 Probable pectinesterase Back     alignment and domain information
>PLN02188 polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information
>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02480 Probable pectinesterase Back     alignment and domain information
>PF01696 Adeno_E1B_55K: Adenovirus EB1 55K protein / large t-antigen; InterPro: IPR002612 This family consists of adenovirus E1B 55 kDa protein or large t-antigen Back     alignment and domain information
>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4 Back     alignment and domain information
>PRK10531 acyl-CoA thioesterase; Provisional Back     alignment and domain information
>smart00656 Amb_all Amb_all domain Back     alignment and domain information
>PLN02773 pectinesterase Back     alignment and domain information
>smart00710 PbH1 Parallel beta-helix repeats Back     alignment and domain information
>PF12541 DUF3737: Protein of unknown function (DUF3737) ; InterPro: IPR022208 This family of proteins is found in bacteria, archaea and eukaryotes Back     alignment and domain information
>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09752 adhesin; Provisional Back     alignment and domain information
>PLN02665 pectinesterase family protein Back     alignment and domain information
>PF01095 Pectinesterase: Pectinesterase; InterPro: IPR000070 Pectinesterase 3 Back     alignment and domain information
>PLN02682 pectinesterase family protein Back     alignment and domain information
>PLN02671 pectinesterase Back     alignment and domain information
>PLN02708 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02665 pectinesterase family protein Back     alignment and domain information
>PRK10531 acyl-CoA thioesterase; Provisional Back     alignment and domain information
>PLN02634 probable pectinesterase Back     alignment and domain information
>PLN02916 pectinesterase family protein Back     alignment and domain information
>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4 Back     alignment and domain information
>PLN02745 Putative pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PRK09752 adhesin; Provisional Back     alignment and domain information
>PLN02484 probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02773 pectinesterase Back     alignment and domain information
>PLN03043 Probable pectinesterase/pectinesterase inhibitor; Provisional Back     alignment and domain information
>PLN02201 probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02217 probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PF01095 Pectinesterase: Pectinesterase; InterPro: IPR000070 Pectinesterase 3 Back     alignment and domain information
>PLN02488 probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02432 putative pectinesterase Back     alignment and domain information
>PLN02995 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02634 probable pectinesterase Back     alignment and domain information
>PLN02933 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02682 pectinesterase family protein Back     alignment and domain information
>PLN02314 pectinesterase Back     alignment and domain information
>PLN02698 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02990 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02995 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02176 putative pectinesterase Back     alignment and domain information
>PLN02170 probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02506 putative pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>PLN02713 Probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02304 probable pectinesterase Back     alignment and domain information
>PLN02432 putative pectinesterase Back     alignment and domain information
>PLN02301 pectinesterase/pectinesterase inhibitor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
2pyg_A377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 2e-05
2pyg_A377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 2e-05
2inu_A 410 Insulin fructotransferase; right-handed parallel b 7e-05
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Length = 377 Back     alignment and structure
 Score = 41.7 bits (97), Expect = 2e-05
 Identities = 17/117 (14%), Positives = 36/117 (30%), Gaps = 17/117 (14%)

Query: 25  IRTSSDPIVRHNKIHHGQHGGVYVHEKGVGLIEENEVYANTLAGVWITTGSAPVLRRNRI 84
           +   S+ ++     +     GV +       ++  +++ N  +GV +       +  N+I
Sbjct: 231 LALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQI 290

Query: 85  HSGKQVGVY-----------------FYDNGHGKLEDNDIFNHLYSGVQISNETTAT 124
           H   Q                     +Y   + ++E N I     S   I      T
Sbjct: 291 HDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGT 347
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Length = 377 Back     alignment and structure
>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* Length = 410 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
2pyg_A377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 99.31
1ru4_A 400 Pectate lyase, PEL9A; parallel beta-helix; 1.60A { 99.28
2pyg_A 377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 99.21
1ru4_A 400 Pectate lyase, PEL9A; parallel beta-helix; 1.60A { 99.17
2inu_A 410 Insulin fructotransferase; right-handed parallel b 99.05
2inu_A410 Insulin fructotransferase; right-handed parallel b 98.97
1dbg_A 506 Chondroitinase B; beta helix, polysaccharide lyase 98.6
1dbg_A 506 Chondroitinase B; beta helix, polysaccharide lyase 98.58
1rmg_A 422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 98.13
1bhe_A376 PEHA, polygalacturonase; family 28 glycosyl hydrol 98.11
1ia5_A339 Polygalacturonase; glycosylhydrolase, hydrolase; H 98.07
2iq7_A339 Endopolygalacturonase; parallel beta helix, hydrol 98.05
1hg8_A349 Endopolygalacturonase; hydrolase, pectin degradati 97.95
1nhc_A336 Polygalacturonase I; beta-helix, hydrolase; HET: M 97.87
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 97.84
1czf_A362 Polygalacturonase II; beta helix, hydrolase; HET: 97.82
2iq7_A 339 Endopolygalacturonase; parallel beta helix, hydrol 97.75
1rmg_A 422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 97.75
1bhe_A376 PEHA, polygalacturonase; family 28 glycosyl hydrol 97.75
1ia5_A 339 Polygalacturonase; glycosylhydrolase, hydrolase; H 97.74
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 97.72
1hg8_A 349 Endopolygalacturonase; hydrolase, pectin degradati 97.7
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 97.68
3jur_A448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 97.63
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 97.5
1nhc_A 336 Polygalacturonase I; beta-helix, hydrolase; HET: M 97.48
1k5c_A335 Endopolygalacturonase; beta helical structure, gly 97.45
3jur_A 448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 97.38
1czf_A 362 Polygalacturonase II; beta helix, hydrolase; HET: 97.3
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 97.29
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 97.21
1gq8_A 319 Pectinesterase; hydrolase, carboxylic ester hydrol 97.2
1xg2_A 317 Pectinesterase 1; protein-protein complex, beta he 97.01
1gq8_A319 Pectinesterase; hydrolase, carboxylic ester hydrol 96.97
1k5c_A 335 Endopolygalacturonase; beta helical structure, gly 96.94
1xg2_A317 Pectinesterase 1; protein-protein complex, beta he 96.93
1idk_A 359 Pectin lyase A; signal, glycoprotein, multigene fa 96.91
1qcx_A 359 Pectin lyase B; beta-helix protein, plant cell WAL 96.59
1pxz_A346 Major pollen allergen JUN A 1; parallel beta-helix 96.55
1idk_A359 Pectin lyase A; signal, glycoprotein, multigene fa 96.48
3zsc_A340 Pectate trisaccharide-lyase; hydrolase; HET: ADA A 96.47
1qcx_A359 Pectin lyase B; beta-helix protein, plant cell WAL 96.43
3uw0_A 364 Pectinesterase; right-handed beta-helix, carbohydr 96.32
1pxz_A346 Major pollen allergen JUN A 1; parallel beta-helix 96.14
3zsc_A 340 Pectate trisaccharide-lyase; hydrolase; HET: ADA A 96.14
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 95.99
2qy1_A330 Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca 95.7
2nsp_A342 Pectinesterase A; michaelis complex, hydrolase; HE 95.53
3uw0_A364 Pectinesterase; right-handed beta-helix, carbohydr 95.38
2nsp_A 342 Pectinesterase A; michaelis complex, hydrolase; HE 95.37
1ogo_X 574 Dextranase; hydrolase, dextran degradation, glycos 95.08
1dab_A 539 P.69 pertactin; pertussis beta helix, cell adhesio 95.01
1ogo_X 574 Dextranase; hydrolase, dextran degradation, glycos 94.78
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 94.52
3vmv_A326 Pectate lyase; polysaccharide lyase family 1, beta 94.46
1x0c_A 549 Isopullulanase; glycoside hydrolase family 49, gly 94.35
2qy1_A330 Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca 94.29
1pcl_A 355 Pectate lyase E; lyase (acting on polysaccharides) 94.03
3vmv_A326 Pectate lyase; polysaccharide lyase family 1, beta 93.49
1dab_A 539 P.69 pertactin; pertussis beta helix, cell adhesio 93.49
1air_A353 Pectate lyase C, PELC; pectate cleavage, pectinoly 93.48
3grh_A422 YBHC, acyl-COA thioester hydrolase YBGC; beta-heli 92.04
1x0c_A 549 Isopullulanase; glycoside hydrolase family 49, gly 91.87
1air_A353 Pectate lyase C, PELC; pectate cleavage, pectinoly 91.07
1h80_A 464 IOTA-carrageenase; hydrolase, IOTA-carrageenan dou 89.82
2o04_A399 Pectate lyase, PL; hexasaccharide compound II, cal 88.94
1vbl_A 416 Pectate lyase 47; PL 47, thermostable, bacillus su 88.55
1pe9_A 361 Pectate lyase A; parallel beta helix; 1.60A {Erwin 87.64
3grh_A422 YBHC, acyl-COA thioester hydrolase YBGC; beta-heli 86.66
1pcl_A 355 Pectate lyase E; lyase (acting on polysaccharides) 83.34
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Back     alignment and structure
Probab=99.31  E-value=4.1e-11  Score=94.63  Aligned_cols=121  Identities=17%  Similarity=0.188  Sum_probs=72.5

Q ss_pred             eEEEcCccCCEEEecCCCcEEeccEEEcCCCCcEEEEe-CceeEEEeeEEEeCCcCcEEE-------ccCCccEEEeeEE
Q psy683           13 MVHCGNALAGIQIRTSSDPIVRHNKIHHGQHGGVYVHE-KGVGLIEENEVYANTLAGVWI-------TTGSAPVLRRNRI   84 (137)
Q Consensus        13 c~I~~~~~~GI~v~~~a~~~i~~n~I~~~~~~GI~v~~-~~~~~i~~n~I~~n~~~Gv~v-------~~~a~~~i~~n~I   84 (137)
                      |.+..+...||++..+...++++|++.+....||.+.. +...+|++|.++++...++.+       ....+.++++|.+
T Consensus       165 ~~~~~~~~dGI~~~~s~~~~i~~N~~~~~~~~GI~~~~~s~~v~I~nN~i~~~~~g~~~~~~g~~~~~~s~nv~i~~N~~  244 (377)
T 2pyg_A          165 SVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAY  244 (377)
T ss_dssp             CEEESCSSCSEEEESEEEEEEESCEEESCSSCSEEEETTCEEEEEESCEEESCSSCSEEEECCSSCCCCCEEEEEESCEE
T ss_pred             EEeecCCCCceeEeccCCcEEECcEEEccccCcEEEEeccCCeEEECCEEECccCceEEEeccccCCCCCccEEEECCEE
Confidence            33333344444444334445555655555556666655 444566666666654433332       3344556666766


Q ss_pred             EcCCcccEEEEeCCeeEEEccEEEccccCcEEEecCCCeEEeceEEecC
Q psy683           85 HSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQISNETTATLDACGLRRS  133 (137)
Q Consensus        85 ~~~~~~GI~v~~~~~g~ie~n~I~~n~~~Gi~v~~~a~p~l~~n~I~~~  133 (137)
                      +.+...||.+......++++|+|.++...||++....+.++++|+|.++
T Consensus       245 ~~n~~~Gi~~~~~~~v~i~~N~i~~~~~~GI~i~g~~~~~i~~N~i~~n  293 (377)
T 2pyg_A          245 YDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDN  293 (377)
T ss_dssp             ESCSSCSEEEEEEEEEEEESCEEESCSSCSEEEEEEEEEEEESCEEESC
T ss_pred             EcCccCceEeccccCeEEECCEEECCCCceEEEecCCCcEEECcEEECC
Confidence            6666667777666666777777777766777777766777777777654
>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Back     alignment and structure
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Back     alignment and structure
>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Back     alignment and structure
>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* Back     alignment and structure
>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* Back     alignment and structure
>1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* Back     alignment and structure
>1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Back     alignment and structure
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Back     alignment and structure
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Back     alignment and structure
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Back     alignment and structure
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>1gq8_A Pectinesterase; hydrolase, carboxylic ester hydrolase; 1.75A {Daucus carota} SCOP: b.80.1.5 Back     alignment and structure
>1xg2_A Pectinesterase 1; protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex; 1.90A {Solanum lycopersicum} Back     alignment and structure
>1gq8_A Pectinesterase; hydrolase, carboxylic ester hydrolase; 1.75A {Daucus carota} SCOP: b.80.1.5 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Back     alignment and structure
>1xg2_A Pectinesterase 1; protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex; 1.90A {Solanum lycopersicum} Back     alignment and structure
>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A Back     alignment and structure
>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2 Back     alignment and structure
>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1 Back     alignment and structure
>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A Back     alignment and structure
>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima} Back     alignment and structure
>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2 Back     alignment and structure
>3uw0_A Pectinesterase; right-handed beta-helix, carbohydrate esterase, hydrolase; 3.50A {Yersinia enterocolitica subsp} Back     alignment and structure
>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1 Back     alignment and structure
>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima} Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A Back     alignment and structure
>2nsp_A Pectinesterase A; michaelis complex, hydrolase; HET: M8C ADA; 1.70A {Erwinia chrysanthemi} PDB: 2nst_A* 2nt6_A* 2nt9_A* 2ntp_A* 2ntb_A* 2ntq_A* 1qjv_A Back     alignment and structure
>3uw0_A Pectinesterase; right-handed beta-helix, carbohydrate esterase, hydrolase; 3.50A {Yersinia enterocolitica subsp} Back     alignment and structure
>2nsp_A Pectinesterase A; michaelis complex, hydrolase; HET: M8C ADA; 1.70A {Erwinia chrysanthemi} PDB: 2nst_A* 2nt6_A* 2nt9_A* 2ntp_A* 2ntb_A* 2ntq_A* 1qjv_A Back     alignment and structure
>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* Back     alignment and structure
>1dab_A P.69 pertactin; pertussis beta helix, cell adhesion; 2.50A {Bordetella pertussis} SCOP: b.80.1.7 PDB: 2iou_G Back     alignment and structure
>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A* Back     alignment and structure
>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* Back     alignment and structure
>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A Back     alignment and structure
>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 Back     alignment and structure
>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A* Back     alignment and structure
>1dab_A P.69 pertactin; pertussis beta helix, cell adhesion; 2.50A {Bordetella pertussis} SCOP: b.80.1.7 PDB: 2iou_G Back     alignment and structure
>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A* Back     alignment and structure
>3grh_A YBHC, acyl-COA thioester hydrolase YBGC; beta-helix, periplasmic, lipoprotein, outer membrane, carbohydrate esterase family 8; 1.70A {Escherichia coli k-12} Back     alignment and structure
>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* Back     alignment and structure
>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A* Back     alignment and structure
>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Back     alignment and structure
>2o04_A Pectate lyase, PL; hexasaccharide compound II, calciums; HET: ADA; 1.70A {Bacillus subtilis} PDB: 2nzm_A* 2o0v_A* 2o0w_A 2o17_A* 2o1d_A* 2bsp_A 1bn8_A 3krg_A* Back     alignment and structure
>1vbl_A Pectate lyase 47; PL 47, thermostable, bacillus subtilis, pectin, calcium ION; 1.91A {Bacillus SP} Back     alignment and structure
>1pe9_A Pectate lyase A; parallel beta helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1ooc_A 1jta_A 1jrg_A Back     alignment and structure
>3grh_A YBHC, acyl-COA thioester hydrolase YBGC; beta-helix, periplasmic, lipoprotein, outer membrane, carbohydrate esterase family 8; 1.70A {Escherichia coli k-12} Back     alignment and structure
>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1ofla_ 481 Chondroitinase B {Pedobacter heparinus [TaxId: 984 98.2
d1ru4a_ 400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 98.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 97.95
d1ofla_ 481 Chondroitinase B {Pedobacter heparinus [TaxId: 984 97.94
d1ru4a_ 400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 97.78
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 97.59
d1ia5a_339 Polygalacturonase {Fungus (Aspergillus aculeatus) 97.29
d1czfa_335 Polygalacturonase {Fungus (Aspergillus niger), end 97.02
d1hg8a_349 Polygalacturonase {Fusarium moniliforme [TaxId: 11 96.96
d1nhca_336 Polygalacturonase {Fungus (Aspergillus niger), end 96.91
d1k5ca_333 Polygalacturonase {Fungus (Stereum purpureum), end 96.81
d1rmga_ 422 Rhamnogalacturonase A {Aspergillus aculeatus [TaxI 96.33
d1hg8a_ 349 Polygalacturonase {Fusarium moniliforme [TaxId: 11 96.27
d1idka_ 359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 96.13
d1rmga_ 422 Rhamnogalacturonase A {Aspergillus aculeatus [TaxI 96.07
d1pxza_346 Major pollen allergen Jun a 1 {Ozark white cedar ( 95.99
d1nhca_ 336 Polygalacturonase {Fungus (Aspergillus niger), end 95.87
d1ia5a_ 339 Polygalacturonase {Fungus (Aspergillus aculeatus) 95.79
d1pxza_346 Major pollen allergen Jun a 1 {Ozark white cedar ( 95.7
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 95.66
d1czfa_ 335 Polygalacturonase {Fungus (Aspergillus niger), end 95.19
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 94.35
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 94.35
d1ogmx2 373 Dextranase, catalytic domain {Penicillium miniolut 94.28
d1o88a_ 353 Pectate lyase {Erwinia chrysanthemi, type C [TaxId 93.38
d1k5ca_ 333 Polygalacturonase {Fungus (Stereum purpureum), end 93.03
d1o88a_353 Pectate lyase {Erwinia chrysanthemi, type C [TaxId 92.15
d1ogmx2 373 Dextranase, catalytic domain {Penicillium miniolut 91.81
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 91.49
d1bn8a_ 399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 91.0
d1gq8a_319 Pectin methylesterase PemA {Carrot (Daucus carota) 87.91
d1qjva_342 Pectin methylesterase PemA {Erwinia chrysanthemi [ 85.92
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 85.17
d1qjva_ 342 Pectin methylesterase PemA {Erwinia chrysanthemi [ 82.19
d1gq8a_ 319 Pectin methylesterase PemA {Carrot (Daucus carota) 80.56
>d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Chondroitinase B
domain: Chondroitinase B
species: Pedobacter heparinus [TaxId: 984]

Probab=98.20  E-value=8e-06  Score=63.90  Aligned_cols=124  Identities=13%  Similarity=0.088  Sum_probs=80.6

Q ss_pred             EEEEeeEEEcCccCCEEEecCC---------------CcEEeccEEEc-----CCCCcEEEE----eCceeEEEeeEEEe
Q psy683            8 AQVLMMVHCGNALAGIQIRTSS---------------DPIVRHNKIHH-----GQHGGVYVH----EKGVGLIEENEVYA   63 (137)
Q Consensus         8 g~i~~c~I~~~~~~GI~v~~~a---------------~~~i~~n~I~~-----~~~~GI~v~----~~~~~~i~~n~I~~   63 (137)
                      .+|++|.|.+....|+.+....               ...+.+|.+.+     +...++.+.    ..+..++++|.+++
T Consensus       135 ~~I~~n~~~~~~~~G~~i~~~~~~~~~~~~~~~~~~~~~~I~~n~~~~~~~~gn~~~~i~~G~s~~~~sn~~v~nN~~~~  214 (481)
T d1ofla_         135 CRIDHCSFTDKITFDQVINLNNTARAIKDGSVGGPAMYHRVDHCFFSNPQKPGNAGGGIRIGYYRNDIGRCLVDSNLFMR  214 (481)
T ss_dssp             CEEESCEEECCCSSSCSEEECSSCCCSCCCSCCCCCCCCEEESCEEEECCCSSSCCCSEEECSSTTCBCCCEEESCEEEE
T ss_pred             eEEECceEecCCCCccEEEecCCCceeecCcccccccccEEEeeEecCccccCCceeEEEeeeEeeccCCEEEEeeeEEc
Confidence            3667777776666665443211               12344444433     223344431    23356788888877


Q ss_pred             CCc-CcEEEccCCccEEEeeEEEcCCcccEEEEeCCeeEEEccEEEcccc----CcEEEecCCCeEEeceEEecC
Q psy683           64 NTL-AGVWITTGSAPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLY----SGVQISNETTATLDACGLRRS  133 (137)
Q Consensus        64 n~~-~Gv~v~~~a~~~i~~n~I~~~~~~GI~v~~~~~g~ie~n~I~~n~~----~Gi~v~~~a~p~l~~n~I~~~  133 (137)
                      +.. .++......+.+|++|.+++++ .|+++..+...++++|.|.+|..    .||.+. ....++++|.+++.
T Consensus       215 ~~g~~~ii~~~s~~n~I~nN~~~~~~-ggi~~~~g~~~~i~~N~~~~n~~~~~~gGi~v~-~~~~~I~nN~~~~~  287 (481)
T d1ofla_         215 QDSEAEIITSKSQENVYYGNTYLNCQ-GTMNFRHGDHQVAINNFYIGNDQRFGYGGMFVW-GSRHVIACNYFELS  287 (481)
T ss_dssp             ECSSSEEEEEESBTCEEESCEEESCS-SEEEEEECSSCEEESCEEEECSSSSCBCCEEEC-SBSCEEESCEEEES
T ss_pred             cCCceEEEEecCCCcEEeeeEEecCc-ceEEEccccCcEEECCEEECCCCcCccceEEEE-cCCeEEECcEEECC
Confidence            553 5566667788889999988886 58888888888899999988854    378875 45678888888764
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Back     information, alignment and structure
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]} Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Back     information, alignment and structure
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]} Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Back     information, alignment and structure
>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gq8a_ b.80.1.5 (A:) Pectin methylesterase PemA {Carrot (Daucus carota) [TaxId: 4039]} Back     information, alignment and structure
>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1qjva_ b.80.1.5 (A:) Pectin methylesterase PemA {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gq8a_ b.80.1.5 (A:) Pectin methylesterase PemA {Carrot (Daucus carota) [TaxId: 4039]} Back     information, alignment and structure