Psyllid ID: psy6877


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MLTLKCEAMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
ccHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHc
cccccccEEEEccccHHHHHHHHHHHHHHccccccEEcHHHHHHHHHHHcccHHHHHHHHHHHcccccccEcHHHHHHHHHHHHHHHHHHHHHHcccccccEcHHHHHHHHHHHcccccHHHHHHHHHHHcccccccEcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc
MLTLKCEAMLKLKLPQEDEERLEKLFVALdtdgngkidIHDLSKALKDFGVHSLYAQKFlersdsnrsgdisLAEFIHYVKEHEKHLrlgfshldknqdgkIDLQELQKAFQELGIDIDENEAKKLLKRMdkdgsleisFNEWRDfllycpfsdireqnvSAQKTWKLIFH
mltlkceamlklklpqedeERLEKLFVAldtdgngkIDIHDLSKALKDFGVHSLYAQKFlersdsnrsgDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFsdireqnvsaqktwklifh
MLTLKCEAMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
*********************LEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLE*******GDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDID******LL*****DGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLI**
*******************ERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
MLTLKCEAMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
*****CEAMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTLKCEAMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDxxxxxxxxxxxxxxxxxxxxxKLLKRMDKDGSLEISFNEWRDFLLYCPFSDIREQNVSAQKTWKLIFH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q7ZYD5 514 Calcium-binding mitochond N/A N/A 0.824 0.274 0.440 1e-30
Q5XH95 513 Calcium-binding mitochond yes N/A 0.824 0.274 0.447 3e-29
O18757 475 Calcium-binding mitochond yes N/A 0.824 0.296 0.405 8e-28
Q6NUK1 477 Calcium-binding mitochond yes N/A 0.824 0.295 0.398 2e-27
Q8BMD8 475 Calcium-binding mitochond yes N/A 0.824 0.296 0.398 5e-27
A5PJZ1 477 Calcium-binding mitochond yes N/A 0.824 0.295 0.398 7e-27
Q7ZY36 473 Calcium-binding mitochond N/A N/A 0.801 0.289 0.410 4e-26
Q7T0U6 473 Calcium-binding mitochond N/A N/A 0.824 0.298 0.405 5e-26
Q5XHA0 473 Calcium-binding mitochond no N/A 0.801 0.289 0.410 8e-26
Q628Z2 532 Probable calcium-binding N/A N/A 0.877 0.281 0.348 3e-24
>sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (332), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/143 (44%), Positives = 95/143 (66%), Gaps = 2/143 (1%)

Query: 17  EDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVH--SLYAQKFLERSDSNRSGDISLA 74
           E E RL+ LF  LD + +G I I+DL+  LK  GVH   L  +K ++  D ++ G +   
Sbjct: 56  EHERRLQILFQELDVNKDGAICINDLAVGLKRLGVHRTELELRKIVKAGDKDQDGQLDFD 115

Query: 75  EFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDG 134
           EF+HY+++HEK LRL F  LDK  DG+ID QE+ ++ ++LG++I E +A+K+LK MDK+G
Sbjct: 116 EFVHYLRDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVNISEQQAEKILKSMDKNG 175

Query: 135 SLEISFNEWRDFLLYCPFSDIRE 157
           ++ I +NEWRD+ L     +I E
Sbjct: 176 TMTIDWNEWRDYHLLHSAENIPE 198




Calcium-dependent mitochondrial solute carrier.
Xenopus laevis (taxid: 8355)
>sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 Back     alignment and function description
>sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 Back     alignment and function description
>sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 Back     alignment and function description
>sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=2 SV=1 Back     alignment and function description
>sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 Back     alignment and function description
>sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 Back     alignment and function description
>sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 Back     alignment and function description
>sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
345484379 486 PREDICTED: calcium-binding mitochondrial 0.847 0.298 0.731 3e-55
380019307 476 PREDICTED: calcium-binding mitochondrial 0.836 0.300 0.727 3e-54
340715690 476 PREDICTED: LOW QUALITY PROTEIN: calcium- 0.830 0.298 0.725 6e-54
195435830 601 GK20580 [Drosophila willistoni] gi|19416 0.877 0.249 0.646 6e-54
383853046 477 PREDICTED: calcium-binding mitochondrial 0.836 0.299 0.734 9e-54
195160615 637 GL24959 [Drosophila persimilis] gi|19411 0.877 0.235 0.626 1e-53
198464859 635 GA16682 [Drosophila pseudoobscura pseudo 0.877 0.236 0.626 1e-53
332024246 467 Calcium-binding mitochondrial carrier pr 0.836 0.306 0.713 1e-53
66565157173 PREDICTED: calcium-binding mitochondrial 0.836 0.826 0.727 1e-53
194747111 596 GF24982 [Drosophila ananassae] gi|190623 0.918 0.263 0.624 3e-53
>gi|345484379|ref|XP_001603181.2| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform 1 [Nasonia vitripennis] gi|345484381|ref|XP_003425019.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (85%)

Query: 13  KLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNRSGDIS 72
           +LP +DEERL +LF  LD DGNG+ID+HDLSKAL + GVH  YAQKFL RSD  +SGDIS
Sbjct: 29  ELPAQDEERLGRLFKKLDLDGNGRIDVHDLSKALHEAGVHERYAQKFLARSDQTKSGDIS 88

Query: 73  LAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDK 132
           LAEFIHYV+EHEK+LRL F+ LDKN+DGKIDL+EL KAF+ELGI+++  EAKKLL+RMDK
Sbjct: 89  LAEFIHYVREHEKNLRLQFTDLDKNKDGKIDLEELIKAFKELGIEMERAEAKKLLQRMDK 148

Query: 133 DGSLEISFNEWRDFLLYCPFSDIRE 157
           DGSL ISFNEWRDFLLY P +DI E
Sbjct: 149 DGSLNISFNEWRDFLLYAPTTDIHE 173




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380019307|ref|XP_003693551.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like [Apis florea] Back     alignment and taxonomy information
>gi|340715690|ref|XP_003396342.1| PREDICTED: LOW QUALITY PROTEIN: calcium-binding mitochondrial carrier protein SCaMC-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195435830|ref|XP_002065882.1| GK20580 [Drosophila willistoni] gi|194161967|gb|EDW76868.1| GK20580 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|383853046|ref|XP_003702035.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195160615|ref|XP_002021170.1| GL24959 [Drosophila persimilis] gi|194118283|gb|EDW40326.1| GL24959 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198464859|ref|XP_001353392.2| GA16682 [Drosophila pseudoobscura pseudoobscura] gi|198149911|gb|EAL30899.2| GA16682 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|332024246|gb|EGI64450.1| Calcium-binding mitochondrial carrier protein SCaMC-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|66565157|ref|XP_395663.2| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-B-like, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|194747111|ref|XP_001955996.1| GF24982 [Drosophila ananassae] gi|190623278|gb|EDV38802.1| GF24982 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0052103 583 CG32103 [Drosophila melanogast 0.877 0.257 0.626 9.5e-50
ZFIN|ZDB-GENE-060526-340 524 slc25a25b "solute carrier fami 0.824 0.269 0.433 6.9e-28
UNIPROTKB|F1NYW3 505 F1NYW3 "Uncharacterized protei 0.824 0.279 0.426 7.2e-28
UNIPROTKB|Q6NUK1 477 SLC25A24 "Calcium-binding mito 0.824 0.295 0.398 3.9e-27
UNIPROTKB|C8C417 501 SLC25A25 "Solute carrier famil 0.801 0.273 0.417 4.2e-27
RGD|1311982 475 Slc25a24 "solute carrier famil 0.824 0.296 0.405 6.5e-27
UNIPROTKB|E2RSL0 502 SLC25A25 "Uncharacterized prot 0.801 0.272 0.410 9.3e-27
UNIPROTKB|A5PJZ1 477 SLC25A24 "Calcium-binding mito 0.824 0.295 0.398 1.1e-26
MGI|MGI:1917160 475 Slc25a24 "solute carrier famil 0.824 0.296 0.398 1.4e-26
UNIPROTKB|E1BW83 475 SLC25A24 "Uncharacterized prot 0.871 0.313 0.363 9.1e-26
FB|FBgn0052103 CG32103 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 518 (187.4 bits), Expect = 9.5e-50, P = 9.5e-50
 Identities = 94/150 (62%), Positives = 126/150 (84%)

Query:     8 AMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYAQKFLERSDSNR 67
             ++L  ++P EDEERLE++F  LD DG+G+IDIHDLS AL +FG+ S+YA+KFL++SD ++
Sbjct:   103 SILPTEIPIEDEERLERIFNKLDRDGDGRIDIHDLSAALHEFGLSSVYAEKFLQQSDKDQ 162

Query:    68 SGDISLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLL 127
             SG++  AEF+HYV+EHEK+L L FSHLDKN+DGK+DL+EL  AF++LG+DID +EA+ LL
Sbjct:   163 SGNVGFAEFLHYVREHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEARNLL 222

Query:   128 KRMDKDGSLEISFNEWRDFLLYCPFSDIRE 157
              RMDKDGSL ISFNEWRDF+L  P +DI +
Sbjct:   223 TRMDKDGSLNISFNEWRDFMLLAPSTDIHD 252




GO:0005778 "peroxisomal membrane" evidence=ISS
GO:0022857 "transmembrane transporter activity" evidence=ISS
GO:0006810 "transport" evidence=ISS
GO:0005740 "mitochondrial envelope" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005743 "mitochondrial inner membrane" evidence=IEA
ZFIN|ZDB-GENE-060526-340 slc25a25b "solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYW3 F1NYW3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NUK1 SLC25A24 "Calcium-binding mitochondrial carrier protein SCaMC-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C8C417 SLC25A25 "Solute carrier family 25 member 25" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311982 Slc25a24 "solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSL0 SLC25A25 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJZ1 SLC25A24 "Calcium-binding mitochondrial carrier protein SCaMC-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1917160 Slc25a24 "solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW83 SLC25A24 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-15
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-12
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 2e-11
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 1e-08
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-06
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 4e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 1e-04
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 3e-04
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
 Score = 69.3 bits (170), Expect = 2e-15
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 9/144 (6%)

Query: 14  LPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFG--VHSLYAQKFLERSDSNRSGDI 71
           L +E  + L++ F   D D +G ID ++L K L+  G         K  E  D+     +
Sbjct: 14  LTEEQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDAGN-ETV 72

Query: 72  SLAEFIHYV------KEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKK 125
              EF+  +       + E+ LR  F   DK+ DG I + EL++  + LG  + + E +K
Sbjct: 73  DFPEFLTVMSVKLKRGDKEEELREAFKLFDKDHDGYISIGELRRVLKSLGERLSDEEVEK 132

Query: 126 LLKRMDKDGSLEISFNEWRDFLLY 149
           LLK  D+DG  EI + E++  +  
Sbjct: 133 LLKEYDEDGDGEIDYEEFKKLIKD 156


Length = 160

>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.97
KOG0027|consensus151 99.95
PTZ00183158 centrin; Provisional 99.92
PTZ00184149 calmodulin; Provisional 99.91
KOG0028|consensus172 99.91
KOG0031|consensus171 99.9
KOG0030|consensus152 99.9
KOG0034|consensus187 99.86
KOG0037|consensus221 99.84
KOG0036|consensus 463 99.82
KOG0044|consensus193 99.79
PLN02964 644 phosphatidylserine decarboxylase 99.49
KOG4223|consensus325 99.49
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.49
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.44
KOG0038|consensus189 99.4
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.39
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.34
KOG0377|consensus631 99.32
KOG0027|consensus151 99.32
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.31
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.3
KOG0037|consensus221 99.3
PTZ00183158 centrin; Provisional 99.29
KOG4223|consensus325 99.29
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.28
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.27
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.26
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.25
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.23
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.22
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 99.21
cd0005267 EH Eps15 homology domain; found in proteins implic 99.2
PTZ00184149 calmodulin; Provisional 99.18
KOG0044|consensus193 99.16
cd0005267 EH Eps15 homology domain; found in proteins implic 99.16
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.15
KOG0040|consensus2399 99.15
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.14
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.12
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 99.12
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 99.11
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.09
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.08
KOG0028|consensus172 99.07
PLN02964 644 phosphatidylserine decarboxylase 99.07
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.06
KOG0041|consensus244 99.06
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 99.02
KOG2643|consensus489 99.01
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.01
PF1465866 EF-hand_9: EF-hand domain 99.0
KOG0031|consensus171 99.0
KOG2643|consensus489 99.0
KOG4251|consensus362 98.98
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.97
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.96
KOG0034|consensus187 98.89
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.87
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.84
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.8
KOG2562|consensus493 98.79
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.78
KOG0041|consensus244 98.71
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.69
PF1465866 EF-hand_9: EF-hand domain 98.61
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.61
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.57
KOG1029|consensus 1118 98.56
KOG0036|consensus 463 98.55
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.53
KOG0751|consensus 694 98.52
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.47
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.45
KOG0030|consensus152 98.45
KOG0751|consensus 694 98.43
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 98.36
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.34
KOG1707|consensus 625 98.31
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.25
KOG0169|consensus 746 98.16
PRK12309391 transaldolase/EF-hand domain-containing protein; P 98.12
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 98.1
KOG0040|consensus2399 98.09
KOG4666|consensus412 98.02
KOG2562|consensus 493 98.0
KOG0046|consensus 627 97.96
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.92
KOG0377|consensus631 97.88
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.86
KOG0038|consensus189 97.86
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.8
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.78
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 97.72
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.72
KOG0046|consensus 627 97.59
KOG4251|consensus 362 97.29
KOG0998|consensus 847 97.14
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 97.07
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 97.05
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 97.01
KOG4065|consensus144 96.97
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 96.88
KOG1955|consensus 737 96.87
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 96.82
KOG4666|consensus412 96.61
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 96.52
KOG1955|consensus 737 96.33
PLN02952 599 phosphoinositide phospholipase C 96.25
KOG3555|consensus 434 96.22
KOG1029|consensus 1118 96.11
KOG0998|consensus 847 96.03
KOG4065|consensus144 95.99
KOG0042|consensus680 95.7
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 95.45
KOG0035|consensus890 95.44
KOG3555|consensus434 95.24
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 95.12
KOG0169|consensus 746 94.48
KOG3866|consensus442 94.36
KOG2243|consensus 5019 94.16
KOG0042|consensus680 93.6
KOG4578|consensus421 93.19
KOG4578|consensus421 93.14
KOG3866|consensus442 93.14
KOG0035|consensus890 93.1
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 92.86
KOG1265|consensus 1189 92.57
KOG2243|consensus 5019 92.26
KOG4347|consensus671 91.82
KOG1707|consensus 625 91.71
PF0004657 Homeobox: Homeobox domain not present here.; Inter 91.26
cd0008659 homeodomain Homeodomain; DNA binding domains invol 89.69
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 89.01
PLN02222 581 phosphoinositide phospholipase C 2 88.13
PF14513138 DAG_kinase_N: Diacylglycerol kinase N-terminus; PD 88.02
KOG4347|consensus671 87.63
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 87.52
PF08414100 NADPH_Ox: Respiratory burst NADPH oxidase; InterPr 87.31
PLN02228 567 Phosphoinositide phospholipase C 86.44
PF14513138 DAG_kinase_N: Diacylglycerol kinase N-terminus; PD 86.32
cd07313104 terB_like_2 tellurium resistance terB-like protein 85.38
KOG3449|consensus112 84.33
KOG0039|consensus 646 84.16
PLN02230 598 phosphoinositide phospholipase C 4 84.14
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 83.74
KOG1264|consensus 1267 82.36
PF0730868 DUF1456: Protein of unknown function (DUF1456); In 81.98
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 81.67
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 81.52
TIGR01848107 PHA_reg_PhaR polyhydroxyalkanoate synthesis repres 81.01
PLN02952 599 phosphoinositide phospholipase C 80.45
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
Probab=99.97  E-value=1.6e-28  Score=163.07  Aligned_cols=143  Identities=30%  Similarity=0.553  Sum_probs=133.6

Q ss_pred             HHhhcCCCHHHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHcCC--CHHHHHHHHHhhcCCCCCcccHHHHHHHHHH---
Q psy6877           8 AMLKLKLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGV--HSLYAQKFLERSDSNRSGDISLAEFIHYVKE---   82 (171)
Q Consensus         8 ~~~~~~l~~~~~~~~~~~F~~~d~~~~g~i~~~e~~~~l~~~~~--~~~~~~~~~~~~d~~~~~~i~~~eF~~~~~~---   82 (171)
                      +...++|+++++++++++|..+|++++|.|+..+|..+++.+|.  +...+..++..++. +++.|+|.+|+.++..   
T Consensus         8 ~~~~~~~t~~qi~~lkeaF~l~D~d~~G~I~~~el~~ilr~lg~~~s~~ei~~l~~~~d~-~~~~idf~~Fl~~ms~~~~   86 (160)
T COG5126           8 LLTFTQLTEEQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDA-GNETVDFPEFLTVMSVKLK   86 (160)
T ss_pred             hhhcccCCHHHHHHHHHHHHHhCcCCCCCCcHHHHHHHHHHcCCCCcHHHHHHHHHhccC-CCCccCHHHHHHHHHHHhc
Confidence            56778999999999999999999999999999999999999994  45677999999999 8899999999999975   


Q ss_pred             ---HHHHHHHHhhhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHHHcCCCCccccHHHHHHHHHhCC
Q psy6877          83 ---HEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLLYCP  151 (171)
Q Consensus        83 ---~~~~~~~~F~~~D~~~~g~I~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~I~~~ef~~~l~~~~  151 (171)
                         ..++++.+|+.||.+++|+|+..+++.+++.+|..+++++++.++..++.+++|.|+|++|...+...|
T Consensus        87 ~~~~~Eel~~aF~~fD~d~dG~Is~~eL~~vl~~lge~~~deev~~ll~~~d~d~dG~i~~~eF~~~~~~~~  158 (160)
T COG5126          87 RGDKEEELREAFKLFDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGEIDYEEFKKLIKDSP  158 (160)
T ss_pred             cCCcHHHHHHHHHHhCCCCCceecHHHHHHHHHhhcccCCHHHHHHHHHhcCCCCCceEeHHHHHHHHhccC
Confidence               468899999999999999999999999999999999999999999999999999999999999987654



>KOG0027|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A Back     alignment and domain information
>cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 Back     alignment and domain information
>KOG3449|consensus Back     alignment and domain information
>KOG0039|consensus Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PF07308 DUF1456: Protein of unknown function (DUF1456); InterPro: IPR009921 This domain occurs in several hypothetical bacterial proteins of around 150 residues in length Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>TIGR01848 PHA_reg_PhaR polyhydroxyalkanoate synthesis repressor PhaR Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1y1x_A191 Structural Analysis Of A Homolog Of Programmed Cell 3e-11
1s6i_A188 Ca2+-Regulatory Region (Cld) From Soybean Calcium-D 1e-09
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 7e-08
2aao_A166 Regulatory Apparatus Of Calcium Dependent Protein K 8e-08
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 8e-08
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 1e-07
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 1e-07
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 1e-07
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 1e-07
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 1e-07
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 1e-07
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 2e-07
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 2e-07
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 2e-07
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 2e-07
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-07
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 2e-07
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 2e-07
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 2e-07
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 3e-07
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 3e-07
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 3e-07
1up5_B148 Chicken Calmodulin Length = 148 3e-07
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 3e-07
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 3e-07
2ygg_B150 Complex Of Cambr And Cam Length = 150 3e-07
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 3e-07
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 3e-07
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 3e-07
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 3e-07
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 3e-07
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 3e-07
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 3e-07
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-07
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 4e-07
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-07
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 4e-07
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 5e-07
2obh_A143 Centrin-Xpc Peptide Length = 143 5e-07
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 5e-07
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 5e-07
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 5e-07
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 6e-07
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 6e-07
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 6e-07
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 7e-07
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 7e-07
3sib_A220 Crystal Structure Of Ure3-Binding Protein, Wild-Typ 8e-07
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 8e-07
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 9e-07
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 9e-07
3pm8_A197 Cad Domain Of Pff0520w, Calcium Dependent Protein K 1e-06
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 1e-06
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 1e-06
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 2e-06
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 2e-06
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 2e-06
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 3e-06
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 3e-06
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 3e-06
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 3e-06
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 3e-06
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 3e-06
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 3e-06
2ami_A96 Solution Structure Of The Calcium-Loaded N-Terminal 3e-06
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 3e-06
2jc2_A198 The Crystal Structure Of The Natural F112l Human So 3e-06
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 4e-06
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 4e-06
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 5e-06
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 6e-06
2jtz_A161 Solution Structure And Chemical Shift Assignments O 8e-06
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 9e-06
1juo_A198 Crystal Structure Of Calcium-Free Human Sorcin: A M 9e-06
2bl0_B145 Physarum Polycephalum Myosin Ii Regulatory Domain L 1e-05
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 1e-05
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 2e-05
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 3e-05
3k21_A191 Crystal Structure Of Carboxy-Terminus Of Pfc0420w L 3e-05
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 4e-05
3o4y_A196 Crystal Structure Of Cad Domain Of The Plasmodium V 5e-05
2opo_A86 Crystal Structure Of The Calcium-Binding Pollen All 6e-05
1h4b_A84 Solution Structure Of The Birch Pollen Allergen Bet 8e-05
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-04
1gjy_A167 The X-Ray Structure Of The Sorcin Calcium Binding D 1e-04
2lvi_A77 Solution Structure Of Apo-phl P 7 Length = 77 1e-04
1k9u_A78 Crystal Structure Of The Calcium-Binding Pollen All 1e-04
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-04
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-04
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 2e-04
1zmz_A98 Solution Structure Of The N-Terminal Domain (M1-S98 2e-04
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 2e-04
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-04
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 2e-04
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 2e-04
3ox6_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 3e-04
2joj_A77 Nmr Solution Structure Of N-Terminal Domain Of Eupl 3e-04
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 3e-04
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 4e-04
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 4e-04
1fi5_A81 Nmr Structure Of The C Terminal Domain Of Cardiac T 4e-04
3fwb_A161 Sac3:sus1:cdc31 Complex Length = 161 4e-04
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 5e-04
1ozs_A73 C-Domain Of Human Cardiac Troponin C In Complex Wit 5e-04
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-04
1ih0_A71 Structure Of The C-Domain Of Human Cardiac Troponin 5e-04
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 5e-04
3ctn_A76 Structure Of Calcium-Saturated Cardiac Troponin C, 6e-04
3mse_B180 Crystal Structure Of C-Terminal Domain Of Pf110239 7e-04
>pdb|1Y1X|A Chain A, Structural Analysis Of A Homolog Of Programmed Cell Death 6 Protein From Leishmania Major Friedlin Length = 191 Back     alignment and structure

Iteration: 1

Score = 64.3 bits (155), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 46/162 (28%), Positives = 82/162 (50%), Gaps = 17/162 (10%) Query: 18 DEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYA--QKFLERSDSNRSGDISLAE 75 D + L + F A+DTDG+G I + +L+ AL GV A +K L D N SG+I+ E Sbjct: 25 DNQELMEWFRAVDTDGSGAISVPELNAALSSAGVPFSLATTEKLLHMYDKNHSGEITFDE 84 Query: 76 FI---HYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDK 132 F H++ +R GF D + DG++D E++ A G + E + L+++ D+ Sbjct: 85 FKDLHHFILS----MREGFRKRDSSGDGRLDSNEVRAALLSSGYQVSEQTFQALMRKFDR 140 Query: 133 DGSLEISFNEWRDFLLYCPFSDIREQNVSA----QKTWKLIF 170 + F+++ + ++ R +NV A ++T ++ F Sbjct: 141 QRRGSLGFDDYVELSIFV----CRVRNVFAFYDRERTGQVTF 178
>pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|3SIB|A Chain A, Crystal Structure Of Ure3-Binding Protein, Wild-Type Length = 220 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|2JC2|A Chain A, The Crystal Structure Of The Natural F112l Human Sorcin Mutant Length = 198 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1JUO|A Chain A, Crystal Structure Of Calcium-Free Human Sorcin: A Member Of The Penta-Ef-Hand Protein Family Length = 198 Back     alignment and structure
>pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 Back     alignment and structure
>pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Che A 3 Length = 86 Back     alignment and structure
>pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet V 4 Length = 84 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|1GJY|A Chain A, The X-Ray Structure Of The Sorcin Calcium Binding Domain (Scbd) Provides Insight Into The Phosphorylation And Calcium Dependent Processess Length = 167 Back     alignment and structure
>pdb|2LVI|A Chain A, Solution Structure Of Apo-phl P 7 Length = 77 Back     alignment and structure
>pdb|1K9U|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Phl P 7 (Polcalcin) At 1.75 Angstroem Length = 78 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|2JOJ|A Chain A, Nmr Solution Structure Of N-Terminal Domain Of Euplotes Octocarinatus Centrin Length = 77 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|1FI5|A Chain A, Nmr Structure Of The C Terminal Domain Of Cardiac Troponin C Bound To The N Terminal Domain Of Cardiac Troponin I. Length = 81 Back     alignment and structure
>pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|1IH0|A Chain A, Structure Of The C-Domain Of Human Cardiac Troponin C In Complex With Ca2+ Sensitizer Emd 57033 Length = 71 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 Back     alignment and structure
>pdb|3MSE|B Chain B, Crystal Structure Of C-Terminal Domain Of Pf110239 Length = 180 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-32
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-08
1y1x_A191 Leishmania major homolog of programmed cell death 1e-23
1y1x_A191 Leishmania major homolog of programmed cell death 5e-09
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-23
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 5e-23
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-21
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-15
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-22
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 4e-22
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 5e-22
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-21
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 4e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-21
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-21
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-21
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-09
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 5e-21
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-21
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 8e-21
3akb_A166 Putative calcium binding protein; EF-hand, metal b 5e-07
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-20
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-20
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-07
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-20
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-20
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-08
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-20
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-20
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 5e-20
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 7e-20
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-07
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 8e-20
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 9e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-07
1exr_A148 Calmodulin; high resolution, disorder, metal trans 8e-20
3fwb_A161 Cell division control protein 31; gene gating, com 1e-19
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-19
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-19
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-19
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-19
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-08
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-19
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-09
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 8e-19
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-04
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-18
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-11
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-18
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-18
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-18
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-17
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-07
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-17
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-17
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 5e-17
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 1e-16
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-16
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-16
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 5e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 4e-16
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-16
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-14
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-04
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 1e-15
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 3e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 3e-15
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 4e-15
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 5e-15
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 7e-15
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-09
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 8e-15
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-06
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 8e-15
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-14
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-14
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 9e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 3e-14
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 5e-14
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 9e-14
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-13
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 2e-13
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 3e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 7e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-13
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-04
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 1e-12
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-12
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-12
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 3e-12
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 5e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-12
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-06
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-12
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 5e-12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 4e-11
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 8e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 1e-11
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 1e-04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-11
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-11
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-07
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 3e-11
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 8e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 3e-11
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-05
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-11
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 2e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 7e-11
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 6e-04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 9e-11
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-10
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 9e-11
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-04
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 1e-10
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-10
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 8e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-10
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 7e-05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-10
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 3e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-10
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-05
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-10
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 2e-10
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 5e-04
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-10
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 6e-05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-10
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 3e-10
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-10
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 4e-10
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 4e-05
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 4e-10
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 4e-10
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 8e-06
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 4e-10
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 5e-10
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 4e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 7e-10
1avs_A90 Troponin C; muscle contraction, calcium-activated, 9e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 1e-09
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 2e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 4e-09
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 5e-09
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 5e-09
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 3e-07
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 6e-09
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-05
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 4e-05
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 8e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 2e-08
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-08
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-08
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 6e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 5e-08
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 5e-06
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 9e-08
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-07
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 3e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 6e-07
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 7e-07
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 1e-06
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 2e-06
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 7e-04
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-06
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 8e-06
1qjt_A99 EH1, epidermal growth factor receptor substrate su 1e-05
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 2e-05
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 3e-05
3a4u_B143 Multiple coagulation factor deficiency protein 2; 1e-04
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-04
1nub_A229 Basement membrane protein BM-40; extracellular mod 2e-04
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
 Score =  114 bits (288), Expect = 1e-32
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 4/132 (3%)

Query: 14  LPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVH-SL-YAQKFLERSDSNRSGDI 71
           +P +   R+ + F+ +D D +G ++I++L       G+  S   A + +   D++ +G I
Sbjct: 45  IPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHI 104

Query: 72  SLAEFIHYVKEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMD 131
           S  EF+   K  E      F    + + G ++  E+  A Q+LG  I++     LL R+ 
Sbjct: 105 SFYEFMAMYKFMEL-AYNLFVMNARARSGTLEPHEILPALQQLGFYINQ-RTSLLLHRLF 162

Query: 132 KDGSLEISFNEW 143
             G      N W
Sbjct: 163 ARGMAFCDLNCW 174


>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.97
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.96
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.96
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.96
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.96
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.96
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.96
3fwb_A161 Cell division control protein 31; gene gating, com 99.96
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.96
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.95
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.95
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.95
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.95
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.95
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.95
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.95
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.95
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.95
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.95
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.94
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.94
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.94
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.94
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.94
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.94
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.94
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.93
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.93
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.93
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.93
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.93
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.93
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.93
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.93
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.93
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.93
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.93
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.93
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.92
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.92
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.92
1y1x_A191 Leishmania major homolog of programmed cell death 99.92
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.92
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.91
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.91
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.91
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.91
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.91
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.91
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.91
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.91
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.91
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.9
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.9
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.9
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.9
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.9
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.9
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.9
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.9
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.9
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.9
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.89
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.89
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.89
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.89
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.89
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.88
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.88
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.88
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.88
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.88
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.88
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.88
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.88
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.87
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.87
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.87
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.87
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.87
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.86
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.86
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.86
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.86
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.86
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.86
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.85
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.84
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.79
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.78
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.77
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.77
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.77
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.76
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.76
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.76
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.76
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.75
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.75
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.73
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.72
1y1x_A191 Leishmania major homolog of programmed cell death 99.72
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.71
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.7
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.68
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.68
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.66
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.65
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.65
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.65
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.64
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.64
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.63
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.62
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.61
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.61
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.61
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.6
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.6
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.59
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.58
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.57
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.56
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.55
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.53
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.53
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.53
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.52
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.51
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.51
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.5
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.49
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.49
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.49
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.48
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.48
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.48
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.48
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.47
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.47
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.47
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.47
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.47
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.47
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.47
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.47
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.47
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.47
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.46
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.46
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.45
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.45
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.45
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.45
1c07_A95 Protein (epidermal growth factor receptor pathway 99.45
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.44
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.44
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.44
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.44
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.44
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.44
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.43
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.42
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.42
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.42
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.42
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.42
3li6_A66 Calcium-binding protein; calcium signaling protein 99.42
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.42
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.42
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.41
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.41
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.41
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.41
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.41
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.41
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.4
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.4
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.4
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.4
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.39
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.39
3fwb_A161 Cell division control protein 31; gene gating, com 99.39
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.38
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.38
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.38
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.38
1c07_A95 Protein (epidermal growth factor receptor pathway 99.38
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.38
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.38
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.38
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.38
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.37
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.37
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.36
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.36
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.36
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.36
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.36
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.36
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.36
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.35
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.35
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.35
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.35
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.35
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.35
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.35
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.34
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.34
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.33
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.33
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.33
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.33
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.33
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.33
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.33
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.33
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.32
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.32
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.32
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.32
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.32
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.31
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.31
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.31
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.31
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.3
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.3
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.3
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.3
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.3
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.3
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.3
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.3
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.3
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.29
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.29
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.29
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.29
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.29
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.28
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.28
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.28
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.27
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.27
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.27
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.27
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.27
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.27
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.27
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.26
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.26
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.26
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.26
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.26
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.25
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.25
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.24
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.24
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.23
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.23
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.23
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.22
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.22
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.2
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.2
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.2
3li6_A66 Calcium-binding protein; calcium signaling protein 99.2
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.2
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.19
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.19
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.19
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.19
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.19
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.19
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.18
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.18
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.17
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.17
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.16
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.16
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.16
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.14
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.14
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.14
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.14
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.13
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.12
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.12
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.1
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.09
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.09
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.08
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.05
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.03
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.01
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.01
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.01
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.98
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.93
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.91
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.89
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.77
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.63
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.6
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.55
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.52
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.47
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.15
1nub_A229 Basement membrane protein BM-40; extracellular mod 98.03
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 98.02
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.94
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.77
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.68
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 97.15
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.0
2jrf_A184 Tubulin polymerization-promoting protein family me 96.52
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 96.45
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 96.29
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 96.0
2jrf_A184 Tubulin polymerization-promoting protein family me 95.58
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 95.38
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 95.29
3kev_A 199 Galieria sulfuraria DCUN1 domain-containing prote; 94.31
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 94.0
4gba_A 221 DCN1-like protein 3; E3 ligase, ligase-peptide com 93.85
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 93.6
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 92.84
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 92.38
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 92.31
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 92.16
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 92.0
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 91.68
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 91.48
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 90.58
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 89.83
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 89.48
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 89.05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 87.93
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 87.55
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 86.15
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 85.63
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 85.54
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 84.88
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 84.62
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 84.55
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 84.5
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 84.49
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 83.96
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 83.66
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 83.18
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 83.06
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 82.79
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 82.73
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 82.68
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 82.49
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 82.32
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 81.8
3uo9_A 534 Glutaminase kidney isoform, mitochondrial; hydrola 81.72
3a02_A60 Homeobox protein aristaless; homeodomain, developm 81.42
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 81.36
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 81.27
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 81.13
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 80.99
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 80.96
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 80.69
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 80.69
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 80.68
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 80.59
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 80.32
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 80.1
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
Probab=99.97  E-value=1e-29  Score=171.90  Aligned_cols=143  Identities=18%  Similarity=0.328  Sum_probs=126.3

Q ss_pred             cCCCHHHHHHHHHHHHhhcC--CCCCcccHHHHHHHHHHcCCC--HHHHHHHHHhhcCCCCCcccHHHHHHHHHH-----
Q psy6877          12 LKLPQEDEERLEKLFVALDT--DGNGKIDIHDLSKALKDFGVH--SLYAQKFLERSDSNRSGDISLAEFIHYVKE-----   82 (171)
Q Consensus        12 ~~l~~~~~~~~~~~F~~~d~--~~~g~i~~~e~~~~l~~~~~~--~~~~~~~~~~~d~~~~~~i~~~eF~~~~~~-----   82 (171)
                      ++||++++.+++++|..+|.  +++|.|+..||..+++.+|+.  ..++..++. .+.+++|.|+|.+|+.++..     
T Consensus         1 sqLt~eqi~elre~F~~fD~~~d~dG~I~~~El~~~lr~lG~~~t~~el~~~~~-~d~~~~g~i~f~eFl~~~~~~~~~~   79 (159)
T 3i5g_C            1 SQLTKDEIEEVREVFDLFDFWDGRDGDVDAAKVGDLLRCLGMNPTEAQVHQHGG-TKKMGEKAYKLEEILPIYEEMSSKD   79 (159)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHTTSSSCEEGGGHHHHHHHTTCCCCHHHHHTTTC-CSSTTSCEECHHHHHHHHHHHTTCC
T ss_pred             CCCCHHHHHHHHHHHHHHCcCCCCCCeECHHHHHHHHHHcCCCCCHHHHHHHHc-ccccCCCcccHHHHHHHHHHhhccc
Confidence            47999999999999999995  889999999999999999954  455555543 36667899999999998864     


Q ss_pred             ---HHHHHHHHhhhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHHHcC--CCCccccHHHHHHHHHhCCcccH
Q psy6877          83 ---HEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDK--DGSLEISFNEWRDFLLYCPFSDI  155 (171)
Q Consensus        83 ---~~~~~~~~F~~~D~~~~g~I~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~--~~~g~I~~~ef~~~l~~~~~~~~  155 (171)
                         ....++.+|+.||++++|+|+.+||++++..+|.++++++++.++..+|.  |++|.|+|++|+++|+..|.|+.
T Consensus        80 ~~~~~~~l~~aF~~fD~d~~G~I~~~el~~~l~~~g~~ls~~e~~~l~~~~D~~~d~dG~I~~~EF~~~m~~~p~pd~  157 (159)
T 3i5g_C           80 TGTAADEFMEAFKTFDREGQGLISSAEIRNVLKMLGERITEDQCNDIFTFCDIREDIDGNIKYEDLMKKVMAGPFPDK  157 (159)
T ss_dssp             TTCCHHHHHHHHHHHCTTSSSEECHHHHHHHHHHSSSCCCHHHHHHHHHHTTCCCCSSCCEEHHHHHHHHHHCSCCC-
T ss_pred             ccchHHHHHHHHHHHhcCCCCcCcHHHHHHHHHHhCCCCCHHHHHHHHHHhCcCCCCCCeEeHHHHHHHHHCCCCCCC
Confidence               24678999999999999999999999999999999999999999999985  78999999999999999888874



>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-14
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-14
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 4e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-14
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-05
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 3e-12
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 7e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-12
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-12
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-12
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-04
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 1e-11
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 3e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 7e-11
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-07
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-10
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 2e-10
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-10
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-10
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-06
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 6e-10
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 1e-09
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-09
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 0.002
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 2e-09
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-07
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 3e-09
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 3e-09
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-09
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 4e-09
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-06
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 4e-09
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-09
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 8e-06
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 6e-09
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 9e-04
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-09
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 7e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-08
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-08
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 7e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 1e-08
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 1e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-08
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-08
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 7e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-08
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-06
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-08
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 1e-04
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 3e-08
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.001
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 3e-08
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.002
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 7e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 4e-08
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 0.002
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 5e-08
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-08
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-06
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 7e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 8e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-07
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 9e-08
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 9e-08
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 1e-07
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.001
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 7e-07
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.002
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 8e-07
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 7e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 9e-07
d1ij5a_ 321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 6e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 1e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.003
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 1e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.001
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 4e-06
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 3e-04
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 5e-06
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 7e-04
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 8e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 1e-05
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 3e-05
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 7e-05
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 1e-04
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 2e-04
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 4e-04
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 8e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 9e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.002
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 8e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 0.001
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 9e-04
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 0.001
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 0.001
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 0.001
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.001
d1sraa_151 a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR 0.002
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.003
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 64.6 bits (156), Expect = 2e-14
 Identities = 32/140 (22%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 16  QEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFGVHSLYA--QKFLERSDSNRSGDISL 73
           +E ++ + + F   D DG G ID+ +L  A++  G        +K +   D   +G ++ 
Sbjct: 2   EEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNF 61

Query: 74  AEFIHYV------KEHEKHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLL 127
            +F+  +      K+ ++ +   F   D ++ GKI  + L++  +ELG ++ + E ++++
Sbjct: 62  GDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMI 121

Query: 128 KRMDKDGSLEISFNEWRDFL 147
              D+DG  E+S  E+   +
Sbjct: 122 DEADRDGDGEVSEQEFLRIM 141


>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.96
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.95
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.95
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.95
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.94
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.94
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.94
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.93
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.92
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.92
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.91
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.91
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.91
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.91
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.91
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.9
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.89
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.89
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.88
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.88
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.87
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.87
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.87
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.87
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.86
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.86
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.86
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.86
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.85
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.84
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.81
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.8
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.8
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.73
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.72
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.68
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.67
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.67
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.65
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.64
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.64
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.64
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.64
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.63
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.63
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.61
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.61
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.61
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.6
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.6
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.6
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.58
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.57
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.56
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.55
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.53
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.52
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.5
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.5
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.49
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.48
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.48
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.47
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.46
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.46
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.43
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.42
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.4
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.38
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.37
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.34
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.32
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.31
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.31
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.3
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.3
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.3
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.29
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.29
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.28
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.27
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.26
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.25
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.24
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.24
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.24
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.24
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.24
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.24
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.23
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.22
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.22
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.21
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.21
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.18
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.17
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.14
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.14
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.14
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 99.13
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.11
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.1
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.07
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.07
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.05
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.05
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.03
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.03
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.01
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.01
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 99.0
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.0
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.99
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.99
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.98
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.97
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.96
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.95
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.93
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.91
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.84
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.79
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.78
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.75
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 98.74
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.66
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.56
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.56
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.55
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.54
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.53
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.37
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.36
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.32
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.26
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.05
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 97.51
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.39
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.24
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 96.3
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 96.24
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 96.19
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 95.87
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 95.14
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 94.21
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 93.77
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 93.36
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 92.75
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 92.44
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 92.39
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 91.58
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 91.57
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 91.14
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 91.12
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 91.08
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 91.02
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 90.97
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 90.79
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 90.51
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 90.46
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 90.39
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 90.16
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 89.98
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 89.53
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 89.31
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 88.98
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 88.82
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 88.09
d1eg3a1125 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 87.71
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 87.47
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 86.92
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 86.81
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 86.44
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 85.09
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 84.92
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 84.86
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 84.68
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 81.94
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 81.73
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]
Probab=99.96  E-value=9.7e-28  Score=158.27  Aligned_cols=136  Identities=24%  Similarity=0.522  Sum_probs=127.3

Q ss_pred             CCCHHHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHcC--CCHHHHHHHHHhhcCCCCCcccHHHHHHHHHH------HH
Q psy6877          13 KLPQEDEERLEKLFVALDTDGNGKIDIHDLSKALKDFG--VHSLYAQKFLERSDSNRSGDISLAEFIHYVKE------HE   84 (171)
Q Consensus        13 ~l~~~~~~~~~~~F~~~d~~~~g~i~~~e~~~~l~~~~--~~~~~~~~~~~~~d~~~~~~i~~~eF~~~~~~------~~   84 (171)
                      +||++++.+++++|..+|++++|.|+..+|..++...+  .+...+..++..+|.+++|.|+|.+|...+..      ..
T Consensus         2 ~lt~~e~~~l~~~F~~~D~~~~G~Is~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~   81 (146)
T d1exra_           2 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSE   81 (146)
T ss_dssp             CCCHHHHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHTCCCCHHHHHHHHHHHCTTCSSSEEHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCCCHHHHHHHHHhcCCCCCCcccHHHHHHHHHHHhhccChH
Confidence            68999999999999999999999999999999999988  55677899999999999999999999998743      35


Q ss_pred             HHHHHHhhhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHHHcCCCCccccHHHHHHHHH
Q psy6877          85 KHLRLGFSHLDKNQDGKIDLQELQKAFQELGIDIDENEAKKLLKRMDKDGSLEISFNEWRDFLL  148 (171)
Q Consensus        85 ~~~~~~F~~~D~~~~g~I~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~I~~~ef~~~l~  148 (171)
                      ..++.+|+.+|.+++|+|+..|++.++..+|..++++++..++..+|.|++|.|+|++|+++|+
T Consensus        82 ~~~~~~F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~i~~~~D~d~dG~i~~~eF~~~l~  145 (146)
T d1exra_          82 EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMV  145 (146)
T ss_dssp             HHHHHHHHHHSTTCSSCBCHHHHHHHHHHTTCCCCHHHHHHHHHHHCSSSSSSBCHHHHHHHHH
T ss_pred             HHHHHHHHHhCCCCCCcCCHHHHHHHHHHHhhcCCHHHHHHHHHHhCCCCCCeEeHHHHHHHhc
Confidence            6788999999999999999999999999999999999999999999999999999999999985



>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure