Psyllid ID: psy6890

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRRRNKKPWYPPSNPSVKRL
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHcHHHHHHccHHHHHHHHHHHHHHccccccccccccccHcccccccccc
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFfilnlipsicspcetkihpgiFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYcgeknrrrnkkpwyppsnpsvkrl
mltrhgrillleqkaTKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYcgeknrrrnkkpwyppsnpsvkrl
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRRRNKKPWYPPSNPSVKRL
*****GRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGE*********************
***************TKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYC***********************
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRRRNKKPWYP*********
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCG**********************
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRRRNKKPWYPPSNPSVKRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q8UUG8471 5-hydroxytryptamine recep N/A N/A 0.793 0.195 0.456 4e-21
P50128471 5-hydroxytryptamine recep yes N/A 0.75 0.184 0.478 4e-21
P28223471 5-hydroxytryptamine recep yes N/A 0.75 0.184 0.478 4e-21
P50129470 5-hydroxytryptamine recep yes N/A 0.75 0.185 0.478 7e-21
O46635470 5-hydroxytryptamine recep yes N/A 0.75 0.185 0.489 7e-21
P18599471 5-hydroxytryptamine recep yes N/A 0.75 0.184 0.468 1e-20
P14842471 5-hydroxytryptamine recep yes N/A 0.75 0.184 0.468 1e-20
P35363471 5-hydroxytryptamine recep yes N/A 0.75 0.184 0.468 2e-20
Q75Z89470 5-hydroxytryptamine recep yes N/A 0.75 0.185 0.478 2e-20
Q02152479 5-hydroxytryptamine recep no N/A 0.862 0.208 0.43 3e-20
>sp|Q8UUG8|5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis GN=htr2b PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 62/92 (67%)

Query: 1   MLTRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATW 60
           M  +  + L  EQ+A+KVLG+VF  FV++W PFFI N+  ++C PC+  I   + E+ +W
Sbjct: 292 MGKKSMQTLTNEQRASKVLGIVFLLFVVMWCPFFITNITSALCGPCDANIIGRLMEIFSW 351

Query: 61  LGYASSMVNPIFYTIFNKVFRTAFKKVLLCRY 92
           +GY SS +NP+ YT+FNK FR AF + + C Y
Sbjct: 352 VGYVSSGINPLVYTLFNKTFRQAFTRYITCNY 383
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Tetraodon fluviatilis (taxid: 47145)
>sp|P50128|5HT2A_MACMU 5-hydroxytryptamine receptor 2A OS=Macaca mulatta GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P28223|5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens GN=HTR2A PE=1 SV=2 Back     alignment and function description
>sp|P50129|5HT2A_PIG 5-hydroxytryptamine receptor 2A OS=Sus scrofa GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|O46635|5HT2A_CANFA 5-hydroxytryptamine receptor 2A OS=Canis familiaris GN=HTR2A PE=2 SV=2 Back     alignment and function description
>sp|P18599|5HT2A_CRIGR 5-hydroxytryptamine receptor 2A OS=Cricetulus griseus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P14842|5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus GN=Htr2a PE=2 SV=1 Back     alignment and function description
>sp|P35363|5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus GN=Htr2a PE=2 SV=1 Back     alignment and function description
>sp|Q75Z89|5HT2A_BOVIN 5-hydroxytryptamine receptor 2A OS=Bos taurus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|Q02152|5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus GN=Htr2b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
322789406 553 hypothetical protein SINV_08806 [Solenop 0.844 0.177 0.726 2e-39
195111751 942 GI22528 [Drosophila mojavensis] gi|19391 0.844 0.104 0.704 4e-39
442617996 947 CG42796, isoform E [Drosophila melanogas 0.905 0.110 0.700 6e-39
195572521 621 GD18555 [Drosophila simulans] gi|1942001 0.775 0.144 0.788 7e-39
198453018 918 GA20762 [Drosophila pseudoobscura pseudo 0.775 0.098 0.788 8e-39
320542529 904 CG42796, isoform D [Drosophila melanogas 0.775 0.099 0.788 1e-38
194745536 945 GF18663 [Drosophila ananassae] gi|190628 0.775 0.095 0.788 2e-38
328698045 1098 PREDICTED: hypothetical protein LOC10057 0.913 0.096 0.657 3e-38
194903831 749 GG11177 [Drosophila erecta] gi|190652650 0.775 0.120 0.788 3e-38
195395979 926 GJ10131 [Drosophila virilis] gi|19414332 0.862 0.107 0.72 4e-38
>gi|322789406|gb|EFZ14711.1| hypothetical protein SINV_08806 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/106 (72%), Positives = 88/106 (83%), Gaps = 8/106 (7%)

Query: 3   TRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLG 62
           +RHGRI+ LEQKATKVLGVVFFTFVILWAPFF+LNL+P++C  CE +I   IF++ TWLG
Sbjct: 456 SRHGRIIRLEQKATKVLGVVFFTFVILWAPFFVLNLVPAVCPDCERRIDRKIFDLVTWLG 515

Query: 63  YASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRRRNKKPWYPP 108
           YASSMVNPIFYTIFNKVFR AFKKVLLCRY       RN++ W PP
Sbjct: 516 YASSMVNPIFYTIFNKVFRQAFKKVLLCRY-------RNQE-WRPP 553

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195111751|ref|XP_002000441.1| GI22528 [Drosophila mojavensis] gi|193917035|gb|EDW15902.1| GI22528 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|442617996|ref|NP_001262373.1| CG42796, isoform E [Drosophila melanogaster] gi|440217199|gb|AGB95755.1| CG42796, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195572521|ref|XP_002104244.1| GD18555 [Drosophila simulans] gi|194200171|gb|EDX13747.1| GD18555 [Drosophila simulans] Back     alignment and taxonomy information
>gi|198453018|ref|XP_001359030.2| GA20762 [Drosophila pseudoobscura pseudoobscura] gi|198132179|gb|EAL28173.2| GA20762 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|320542529|ref|NP_649806.2| CG42796, isoform D [Drosophila melanogaster] gi|318068736|gb|AAN13390.2| CG42796, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194745536|ref|XP_001955243.1| GF18663 [Drosophila ananassae] gi|190628280|gb|EDV43804.1| GF18663 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|328698045|ref|XP_003240524.1| PREDICTED: hypothetical protein LOC100575043 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194903831|ref|XP_001980947.1| GG11177 [Drosophila erecta] gi|190652650|gb|EDV49905.1| GG11177 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195395979|ref|XP_002056611.1| GJ10131 [Drosophila virilis] gi|194143320|gb|EDW59723.1| GJ10131 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
FB|FBgn0261929778 CG42796 [Drosophila melanogast 0.775 0.115 0.788 7.4e-36
UNIPROTKB|E1BVI5468 HTR2A "5-hydroxytryptamine (Se 0.732 0.181 0.511 2e-21
UNIPROTKB|Q8UUG8471 htr2b "5-hydroxytryptamine rec 0.698 0.171 0.493 4.4e-21
UNIPROTKB|F1P316271 Gga.320 "Uncharacterized prote 0.793 0.339 0.445 4.9e-21
ZFIN|ZDB-GENE-070912-500402 htr2a "5-hydroxytryptamine (se 0.732 0.211 0.505 7.5e-21
FB|FBgn0087012930 5-HT2 "Serotonin receptor 2" [ 0.724 0.090 0.551 1.2e-20
UNIPROTKB|F1NU82430 Gga.320 "Uncharacterized prote 0.793 0.213 0.445 1.4e-20
ZFIN|ZDB-GENE-120215-60458 si:dkey-276l13.4 "si:dkey-276l 0.732 0.185 0.511 2.3e-20
UNIPROTKB|Q75Z89470 HTR2A "5-hydroxytryptamine rec 0.75 0.185 0.478 2.6e-20
UNIPROTKB|O46635470 HTR2A "5-hydroxytryptamine rec 0.75 0.185 0.489 2.6e-20
FB|FBgn0261929 CG42796 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 7.4e-36, P = 7.4e-36
 Identities = 71/90 (78%), Positives = 82/90 (91%)

Query:     3 TRHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLG 62
             +RHGRI+ LEQKATKVLGVVFFTFVILW+PFF+LNL+P++C+ CE +I   +F+V TWLG
Sbjct:   679 SRHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLG 738

Query:    63 YASSMVNPIFYTIFNKVFRTAFKKVLLCRY 92
             YASSMVNPIFYTIFNKVFR AFKKVLLCRY
Sbjct:   739 YASSMVNPIFYTIFNKVFRQAFKKVLLCRY 768
GO:0007210 "serotonin receptor signaling pathway" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS
GO:0004993 "serotonin receptor activity" evidence=ISS
UNIPROTKB|E1BVI5 HTR2A "5-hydroxytryptamine (Serotonin) receptor 2A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8UUG8 htr2b "5-hydroxytryptamine receptor 2B" [Tetraodon fluviatilis (taxid:47145)] Back     alignment and assigned GO terms
UNIPROTKB|F1P316 Gga.320 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-500 htr2a "5-hydroxytryptamine (serotonin) receptor 2A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0087012 5-HT2 "Serotonin receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NU82 Gga.320 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-60 si:dkey-276l13.4 "si:dkey-276l13.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q75Z89 HTR2A "5-hydroxytryptamine receptor 2A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O46635 HTR2A "5-hydroxytryptamine receptor 2A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 3e-15
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 68.5 bits (168), Expect = 3e-15
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 12  EQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPI 71
           E+KA K+L VV   FV+ W P+ I+ L+ S+C     ++ P    +  WL Y +S +NPI
Sbjct: 190 ERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIWRLLPTALLITLWLAYVNSCLNPI 249

Query: 72  FY 73
            Y
Sbjct: 250 IY 251

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG4219|consensus423 99.85
PHA03234338 DNA packaging protein UL33; Provisional 99.84
PHA03235409 DNA packaging protein UL33; Provisional 99.79
KOG4220|consensus503 99.78
PHA02834323 chemokine receptor-like protein; Provisional 99.77
PHA02638417 CC chemokine receptor-like protein; Provisional 99.77
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.68
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.42
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 99.02
KOG2087|consensus363 98.82
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.51
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 97.88
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 97.78
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 97.56
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.3
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 96.7
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 96.64
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.63
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 95.82
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 95.74
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 95.01
PF03125365 Sre: C. elegans Sre G protein-coupled chemorecepto 93.43
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 92.53
KOG2575|consensus 510 89.5
KOG4564|consensus473 88.36
PF10319310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 88.22
PF02118275 Srg: Srg family chemoreceptor; InterPro: IPR000609 87.82
PF0988959 DUF2116: Uncharacterized protein containing a Zn-r 86.74
KOG4193|consensus610 85.5
PF10624164 TraS: Plasmid conjugative transfer entry exclusion 83.94
>KOG4219|consensus Back     alignment and domain information 
Probab=99.85  E-value=2.8e-21  Score=132.91  Aligned_cols=87  Identities=26%  Similarity=0.486  Sum_probs=76.4

Q ss_pred             hhhhhhhHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhCCC-CCcchHHHHHHHHHHHHhhhhhhHHHHHhccHHHHHHH
Q psy6890           6 GRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPC-ETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAF   84 (116)
Q Consensus         6 ~~~~~~~~k~~k~~~~iv~~f~i~~~P~~v~~l~~~~~~~~-~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~   84 (116)
                      .++.+.++|+.||+++|+++|.+||+||+++.++.....+. +......++....||+.+|+|+||+||++.|++||.++
T Consensus       250 ~~~~kak~K~vkmliiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~gf  329 (423)
T KOG4219|consen  250 HEQLKAKKKVVKMLIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGGF  329 (423)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHHH
Confidence            45678899999999999999999999999999998765532 23456678999999999999999999999999999999


Q ss_pred             HHhHhhhh
Q psy6890          85 KKVLLCRY   92 (116)
Q Consensus        85 ~~~~~~~~   92 (116)
                      ++.++|..
T Consensus       330 ~~~fr~cp  337 (423)
T KOG4219|consen  330 RRAFRWCP  337 (423)
T ss_pred             hhhhheee
Confidence            99998764

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF03125 Sre: C Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2575|consensus Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>PF10624 TraS: Plasmid conjugative transfer entry exclusion protein TraS; InterPro: IPR018898 Entry exclusion (Eex) is a process which prevents redundant transfer of DNA between donor cells Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 5e-16
4daj_A479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-12
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 3e-11
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-10
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 3e-10
3p0g_A501 Structure Of A Nanobody-Stabilized Active State Of 2e-09
2rh1_A500 High Resolution Crystal Structure Of Human B2-Adren 2e-09
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 4e-09
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-09
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 5e-09
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 6e-09
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 3e-08
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-08
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 3e-08
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-08
4grv_A510 The Crystal Structure Of The Neurotensin Receptor N 4e-05
4eiy_A447 Crystal Structure Of The Chimeric Protein Of A2aar- 7e-05
2ks9_A364 Solution Conformation Of Substance P In Water Compl 7e-05
3eml_A488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 2e-04
3v2w_A520 Crystal Structure Of A Lipid G Protein-Coupled Rece 3e-04
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure 
Iteration: 1

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
Query: 10  LLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVN 69
           L E+KAT+++ +V   F++ W PFF+ +++ + C  C   + P ++   TWLGY +S +N
Sbjct: 394 LREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCH--VSPELYSATTWLGYVNSALN 451
Query: 70  PIFYTIFNKVFRTAFKKVLLC 90
           P+ YT FN  FR AF K+L C
Sbjct: 452 PVIYTTFNIEFRKAFLKILSC 472
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|4GRV|A Chain A, The Crystal Structure Of The Neurotensin Receptor Nts1 In Complex With Neurotensin (8-13) Length = 510 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At 3.35a Length = 520 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 3e-29
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 1e-28
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 3e-28
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 2e-27
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 1e-26
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 2e-26
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-26
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-22
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-21
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 4e-19
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 6e-18
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 6e-15
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-14
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 7e-14
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 2e-08
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
 Score =  108 bits (270), Expect = 3e-29
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 2/96 (2%)

Query: 4   RHGRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGY 63
               + L E+KAT+++ +V   F++ W PFF+ +++ + C  C   + P ++   TWLGY
Sbjct: 388 DAYGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTC--HVSPELYSATTWLGY 445

Query: 64  ASSMVNPIFYTIFNKVFRTAFKKVLLCRYCGEKNRR 99
            +S +NP+ YT FN  FR AF K+L C    E   +
Sbjct: 446 VNSALNPVIYTTFNIEFRKAFLKILSCGRPLEVLFQ 481
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.92
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.88
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.87
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.86
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.86
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.85
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.85
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.84
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.84
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.84
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.83
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.83
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.83
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.8
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.8
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.79
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.78
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.75
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 99.29
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 98.94
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 88.59
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 81.02
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.92  E-value=5.5e-26  Score=162.43  Aligned_cols=92  Identities=26%  Similarity=0.431  Sum_probs=65.6

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhCCCCCc-----chHHHHHHHHHHHHhhhhhhHHHHHhccHHHH
Q psy6890           7 RILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETK-----IHPGIFEVATWLGYASSMVNPIFYTIFNKVFR   81 (116)
Q Consensus         7 ~~~~~~~k~~k~~~~iv~~f~i~~~P~~v~~l~~~~~~~~~~~-----~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fr   81 (116)
                      ...++|+|++||+++|+++|++||+||+++.++..+.+.....     ....++.++.+|+|+|||+||+||+++|++||
T Consensus       399 ~~~~~erk~~k~L~iVv~~F~iCWlPf~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~Y~NS~iNPiIY~~~n~~FR  478 (510)
T 4grv_A          399 GSVQALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANFR  478 (510)
T ss_dssp             STTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHH
Confidence            3456789999999999999999999999999998876532221     23446778999999999999999999999999


Q ss_pred             HHHHHhHhhhhcCCcCc
Q psy6890          82 TAFKKVLLCRYCGEKNR   98 (116)
Q Consensus        82 ~~~~~~~~~~~~~~~~~   98 (116)
                      ++++++++|+|...+.+
T Consensus       479 ~aFk~iL~C~C~~~r~R  495 (510)
T 4grv_A          479 QVFLSTLACLCPGWRHR  495 (510)
T ss_dssp             CC---------------
T ss_pred             HHHHHHHhhcCCCCCCC
Confidence            99999998765444333
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 5e-14
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 64.2 bits (155), Expect = 5e-14
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 2/90 (2%)

Query: 12  EQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPI 71
           E++ T+++ ++   F+I W P+  +          +    P    +  +    S++ NP+
Sbjct: 247 EKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSD--FGPIFMTIPAFFAKTSAVYNPV 304

Query: 72  FYTIFNKVFRTAFKKVLLCRYCGEKNRRRN 101
            Y + NK FR      L C      +   +
Sbjct: 305 IYIMMNKQFRNCMVTTLCCGKNPLGDDEAS 334

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 92.11
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.86  E-value=3.9e-21  Score=128.88  Aligned_cols=90  Identities=19%  Similarity=0.398  Sum_probs=75.1

Q ss_pred             hhhhhhhHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhCCCCCcchHHHHHHHHHHHHhhhhhhHHHHHhccHHHHHHHH
Q psy6890           6 GRILLLEQKATKVLGVVFFTFVILWAPFFILNLIPSICSPCETKIHPGIFEVATWLGYASSMVNPIFYTIFNKVFRTAFK   85 (116)
Q Consensus         6 ~~~~~~~~k~~k~~~~iv~~f~i~~~P~~v~~l~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~   85 (116)
                      .+..++++|++|++++++++|++||+||.++.++.....  .......+..++.+++++||++||+||++++++||++++
T Consensus       241 ~~~~~~~~~~~~~~~~i~~~f~~~~~P~~i~~~~~~~~~--~~~~~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~~  318 (348)
T d1u19a_         241 ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQ--GSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMV  318 (348)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT--TSCCCHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHHH
T ss_pred             hhhHHHHhhHhheEEEeehHHHHHhhHHHhhhheeeccC--CccccHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHH
Confidence            345678899999999999999999999999988877655  333445667888999999999999999999999999999


Q ss_pred             HhHhhhhcCCcC
Q psy6890          86 KVLLCRYCGEKN   97 (116)
Q Consensus        86 ~~~~~~~~~~~~   97 (116)
                      ++++|++....+
T Consensus       319 ~~l~c~~~~~~~  330 (348)
T d1u19a_         319 TTLCCGKNPLGD  330 (348)
T ss_dssp             HHHTSSCCCTTT
T ss_pred             HHhCCCCCCCCC
Confidence            999765543333
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure