Psyllid ID: psy6962


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MNNRINPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
cccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEEcccccccccEEEEEEccHHHHHHHHc
ccccccccccccEEEcccccccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEEEEEccccccccHHHHHHHHHHHHHHHcc
mnnrinplMFSLVCFrsmslpeqpdpdfIKMFVgqiprsmdeaDLTKMFSEYGRVYNINVLrdkvtgqskglkntsnitqdfstttig
MNNRINPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKvtgqskglkntsnitqdfstttig
MNNRINPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
******PLMFSLVCFRSMS*******DFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKV***********************
****************************IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
MNNRINPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
****INPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNRINPLMFSLVCFRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
O57406 489 CUGBP Elav-like family me N/A N/A 0.625 0.112 0.578 7e-13
Q28HE9 490 CUGBP Elav-like family me yes N/A 0.625 0.112 0.578 3e-12
Q92879 486 CUGBP Elav-like family me no N/A 0.579 0.104 0.603 5e-12
Q5R995 513 CUGBP Elav-like family me yes N/A 0.579 0.099 0.603 5e-12
A4IIM2 513 CUGBP Elav-like family me no N/A 0.568 0.097 0.634 6e-12
Q7ZXE2 536 CUGBP Elav-like family me N/A N/A 0.568 0.093 0.634 6e-12
P28659 486 CUGBP Elav-like family me no N/A 0.579 0.104 0.584 7e-12
Q4QQT3 487 CUGBP Elav-like family me no N/A 0.579 0.104 0.584 8e-12
Q5F3T7 489 CUGBP Elav-like family me yes N/A 0.625 0.112 0.578 2e-11
Q792H5 508 CUGBP Elav-like family me yes N/A 0.568 0.098 0.634 3e-11
>sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 2/57 (3%)

Query: 17 SMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG--QSKG 71
          +M  P+ PDPD IKMFVGQ+PRS  E +L ++F +YG VY INVLRD+     QSKG
Sbjct: 4  TMDHPDHPDPDSIKMFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKG 60




RNA-binding protein implicated in the regulation of several post-transcriptional events. May be involved in pre-mRNA alternative splicing, mRNA translation activation and stability (By similarity). Mediates the rapid and sequence-specific cytoplasmic deadenylation of EDEN-containing maternal mRNAs following fertilization. Binds to AU-rich sequences (AREs) of jun mRNA. Binds to the embryonic deadenylation element (EDEN) motif localized in the 3'-UTR of maternal mRNAs. Binds to RNA containing several repeats of the consensus sequence 5'-UGU-3'. EDEN-dependent deadenylation is enhanced by the presence of an additional cis element composed of three AUU repeats.
Xenopus laevis (taxid: 8355)
>sp|Q28HE9|CELF1_XENTR CUGBP Elav-like family member 1 OS=Xenopus tropicalis GN=celf1 PE=2 SV=1 Back     alignment and function description
>sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R995|CELF1_PONAB CUGBP Elav-like family member 1 OS=Pongo abelii GN=CELF1 PE=2 SV=1 Back     alignment and function description
>sp|A4IIM2|CELF2_XENTR CUGBP Elav-like family member 2 OS=Xenopus tropicalis GN=celf2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXE2|CELF2_XENLA CUGBP Elav-like family member 2 OS=Xenopus laevis GN=celf2 PE=1 SV=1 Back     alignment and function description
>sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 Back     alignment and function description
>sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 Back     alignment and function description
>sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 Back     alignment and function description
>sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
312384163 314 hypothetical protein AND_02458 [Anophele 0.590 0.165 0.730 3e-16
321460482 403 hypothetical protein DAPPUDRAFT_227924 [ 0.590 0.129 0.730 3e-16
405963038 647 CUG-BP- and ETR-3-like factor 2 [Crassos 0.545 0.074 0.795 4e-16
270013480 469 hypothetical protein TcasGA2_TC012080 [T 0.556 0.104 0.78 6e-16
443723647 461 hypothetical protein CAPTEDRAFT_144233 [ 0.556 0.106 0.795 7e-16
24202216873 conserved hypothetical protein [Pediculu 0.818 0.986 0.592 1e-15
158288351104 AGAP009474-PA [Anopheles gambiae str. PE 0.568 0.480 0.74 1e-15
91090137 494 PREDICTED: similar to arrest CG31762-PC 0.556 0.099 0.78 4e-15
291232672 500 PREDICTED: bruno-2-like [Saccoglossus ko 0.556 0.098 0.74 6e-15
157108557 201 hypothetical protein AaeL_AAEL000691 [Ae 0.568 0.248 0.72 9e-15
>gi|312384163|gb|EFR28956.1| hypothetical protein AND_02458 [Anopheles darlingi] Back     alignment and taxonomy information
 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%)

Query: 22  EQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLK 73
           +QPDPD+IKMFVGQ+PRSMDE  L +MF E+GRV+ INVLRDK +GQSKGL+
Sbjct: 163 DQPDPDYIKMFVGQVPRSMDEQQLKEMFEEFGRVHQINVLRDKTSGQSKGLE 214




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321460482|gb|EFX71524.1| hypothetical protein DAPPUDRAFT_227924 [Daphnia pulex] Back     alignment and taxonomy information
>gi|405963038|gb|EKC28647.1| CUG-BP- and ETR-3-like factor 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|270013480|gb|EFA09928.1| hypothetical protein TcasGA2_TC012080 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|443723647|gb|ELU11974.1| hypothetical protein CAPTEDRAFT_144233 [Capitella teleta] Back     alignment and taxonomy information
>gi|242022168|ref|XP_002431513.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516807|gb|EEB18775.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|158288351|ref|XP_559774.3| AGAP009474-PA [Anopheles gambiae str. PEST] gi|157019209|gb|EAL41386.3| AGAP009474-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91090137|ref|XP_976135.1| PREDICTED: similar to arrest CG31762-PC isoform 4 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291232672|ref|XP_002736280.1| PREDICTED: bruno-2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|157108557|ref|XP_001650283.1| hypothetical protein AaeL_AAEL000691 [Aedes aegypti] gi|108884043|gb|EAT48268.1| AAEL000691-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
FB|FBgn0000114 810 aret "arrest" [Drosophila mela 0.568 0.061 0.7 9e-14
UNIPROTKB|E9PKU1114 CELF1 "CUGBP Elav-like family 0.579 0.447 0.603 5e-12
UNIPROTKB|E9PQK487 CELF1 "CUGBP Elav-like family 0.579 0.586 0.603 5e-12
UNIPROTKB|E9PSH095 CELF1 "CUGBP Elav-like family 0.579 0.536 0.603 5e-12
UNIPROTKB|F5H0D8103 CELF1 "CUGBP Elav-like family 0.579 0.495 0.603 5e-12
UNIPROTKB|F5H4Y579 CELF1 "CUGBP Elav-like family 0.579 0.645 0.603 5e-12
UNIPROTKB|I3LCW775 I3LCW7 "Uncharacterized protei 0.579 0.68 0.603 5e-12
UNIPROTKB|E9PKA156 CELF1 "CUGBP Elav-like family 0.5 0.785 0.636 2.2e-11
UNIPROTKB|F1NZY6 484 CELF2 "CUGBP Elav-like family 0.568 0.103 0.634 4e-11
UNIPROTKB|F1ND14 485 CELF1 "CUGBP Elav-like family 0.579 0.105 0.622 4e-11
FB|FBgn0000114 aret "arrest" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 190 (71.9 bits), Expect = 9.0e-14, P = 9.0e-14
 Identities = 35/50 (70%), Positives = 43/50 (86%)

Query:    22 EQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 71
             ++PDPD IKMFVGQ+P+SMDE+ L +MF EYG V++INVLRDK TG SKG
Sbjct:   350 KEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKG 399




GO:0048477 "oogenesis" evidence=IMP
GO:0007286 "spermatid development" evidence=IMP
GO:0007319 "negative regulation of oskar mRNA translation" evidence=IDA;NAS;TAS
GO:0003729 "mRNA binding" evidence=ISS;NAS;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0030727 "germarium-derived female germ-line cyst formation" evidence=TAS
GO:0042078 "germ-line stem cell division" evidence=NAS
GO:0046011 "regulation of oskar mRNA translation" evidence=TAS
GO:0006378 "mRNA polyadenylation" evidence=TAS
GO:0003730 "mRNA 3'-UTR binding" evidence=IDA;TAS
GO:0017148 "negative regulation of translation" evidence=IMP
GO:0000166 "nucleotide binding" evidence=IEA
GO:0043186 "P granule" evidence=IDA
GO:0005634 "nucleus" evidence=IC
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0003723 "RNA binding" evidence=IDA
GO:0007281 "germ cell development" evidence=IMP
GO:0031536 "positive regulation of exit from mitosis" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|E9PKU1 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQK4 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSH0 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H0D8 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H4Y5 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCW7 I3LCW7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKA1 CELF1 "CUGBP Elav-like family member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZY6 CELF2 "CUGBP Elav-like family member 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND14 CELF1 "CUGBP Elav-like family member 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R995CELF1_PONABNo assigned EC number0.60370.57950.0994yesN/A
Q9Z0H4CELF2_MOUSENo assigned EC number0.63460.56810.0984yesN/A
Q5F3T7CELF1_CHICKNo assigned EC number0.57890.6250.1124yesN/A
Q792H5CELF2_RATNo assigned EC number0.63460.56810.0984yesN/A
O95319CELF2_HUMANNo assigned EC number0.63460.56810.0984yesN/A
Q28HE9CELF1_XENTRNo assigned EC number0.57890.6250.1122yesN/A
Q6P0B1CELF2_DANRENo assigned EC number0.61530.56810.0972yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 2e-20
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-19
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-18
smart0036073 smart00360, RRM, RNA recognition motif 8e-11
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 8e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-09
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-09
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 9e-09
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-08
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-08
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 3e-08
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 6e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 9e-08
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-07
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 1e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-07
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 4e-07
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-07
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-07
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 5e-07
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 6e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 7e-07
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 7e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 8e-07
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 9e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-06
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-06
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 2e-06
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-06
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 4e-06
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 5e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-06
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 6e-06
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 8e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 8e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-05
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 3e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 4e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 5e-05
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-05
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 6e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 9e-05
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-04
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-04
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 2e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-04
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 2e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 3e-04
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-04
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 4e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-04
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 5e-04
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 5e-04
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 5e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-04
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 5e-04
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 5e-04
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 6e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 6e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 6e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 7e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 8e-04
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 8e-04
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 8e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 8e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 0.001
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.001
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.001
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.001
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 0.001
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.001
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 0.001
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.001
cd12444112 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cy 0.001
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.002
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 0.002
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 0.002
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.002
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.002
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.002
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.002
cd1246279 cd12462, RRM_SCAF8, RNA recognition motif in SR-re 0.002
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.003
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 0.003
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.003
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 0.003
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 0.003
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.003
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 0.003
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 0.004
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.004
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.004
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 0.004
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.004
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.004
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.004
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.004
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
 Score = 77.1 bits (190), Expect = 2e-20
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)

Query: 29 IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG--QSKG 71
          IKMFVGQIPRS  E DL ++F +YG VY INVLRD+     QSKG
Sbjct: 2  IKMFVGQIPRSWSEKDLRELFEQYGAVYQINVLRDRSQNPPQSKG 46


This subgroup corresponds to the RRM1 of CELF-1, CELF-2 and Bruno protein. CELF-1 (also termed BRUNOL-2, or CUG-BP1, or EDEN-BP) and CELF-2 (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR) belong to the CUGBP1 and ETR-3-like factors (CELF) or BRUNOL (Bruno-like) family of RNA-binding proteins that have been implicated in regulation of pre-mRNA splicing, and control of mRNA translation and deadenylation. CELF-1 is strongly expressed in all adult and fetal tissues tested. The human CELF-1 is a nuclear and cytoplasmic RNA-binding protein that regulates multiple aspects of nuclear and cytoplasmic mRNA processing, with implications for onset of type 1 myotonic dystrophy (DM1), a neuromuscular disease associated with an unstable CUG triplet expansion in the 3'-UTR (3'-untranslated region) of the DMPK (myotonic dystrophy protein kinase) gene; it preferentially targets UGU-rich mRNA elements. It has been shown to bind to a Bruno response element, a cis-element involved in translational control of oskar mRNA in Drosophila, and share sequence similarity to Bruno, the Drosophila protein that mediates this process. The Xenopus homolog embryo deadenylation element-binding protein (EDEN-BP) mediates sequence-specific deadenylation of Eg5 mRNA. It binds specifically to the EDEN motif in the 3'-untranslated regions of maternal mRNAs and targets these mRNAs for deadenylation and translational repression. CELF-1 contain three highly conserved RNA recognition motifs (RRMs), also known as RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains): two consecutive RRMs (RRM1 and RRM2) situated in the N-terminal region followed by a linker region and the third RRM (RRM3) close to the C-terminus of the protein. The two N-terminal RRMs of EDEN-BP are necessary for the interaction with EDEN as well as a part of the linker region (between RRM2 and RRM3). Oligomerization of EDEN-BP is required for specific mRNA deadenylation and binding. CELF-2 is expressed in all tissues at some level, but highest in brain, heart, and thymus. It has been implicated in the regulation of nuclear and cytoplasmic RNA processing events, including alternative splicing, RNA editing, stability and translation. CELF-2 shares high sequence identity with CELF-1, but shows different binding specificity; it binds preferentially to sequences with UG repeats and UGUU motifs. It has been shown to bind to a Bruno response element, a cis-element involved in translational control of oskar mRNA in Drosophila, and share sequence similarity to Bruno, the Drosophila protein that mediates this process. It also binds to the 3'-UTR of cyclooxygenase-2 messages, affecting both translation and mRNA stability, and binds to apoB mRNA, regulating its C to U editing. CELF-2 also contains three highly conserved RRMs. It binds to RNA via the first two RRMs, which are also important for localization in the cytoplasm. The splicing activation or repression activity of CELF-2 on some specific substrates is mediated by RRM1/RRM2. Both, RRM1 and RRM2 of CELF-2, can activate cardiac troponin T (cTNT) exon 5 inclusion. In addition, CELF-2 possesses a typical arginine and lysine-rich nuclear localization signal (NLS) in the C-terminus, within RRM3. This subgroup also includes Drosophila melanogaster Bruno protein, which plays a central role in regulation of Oskar (Osk) expression in flies. It mediates repression by binding to regulatory Bruno response elements (BREs) in the Osk mRNA 3' UTR. The full-length Bruno protein contains three RRMs, two located in the N-terminal half of the protein and the third near the C-terminus, separated by a linker region. . Length = 84

>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.77
KOG0149|consensus 247 99.71
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.68
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.68
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.67
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.66
KOG0126|consensus 219 99.63
KOG0122|consensus270 99.63
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.63
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.61
KOG0144|consensus 510 99.58
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.58
KOG0121|consensus153 99.57
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.57
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.55
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.54
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.53
PLN03120 260 nucleic acid binding protein; Provisional 99.52
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.51
PLN03121 243 nucleic acid binding protein; Provisional 99.51
KOG0113|consensus 335 99.51
KOG0117|consensus 506 99.5
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.47
KOG0131|consensus 203 99.45
KOG0148|consensus 321 99.45
smart0036272 RRM_2 RNA recognition motif. 99.45
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.44
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.44
KOG0144|consensus 510 99.43
smart0036071 RRM RNA recognition motif. 99.41
KOG0127|consensus 678 99.39
PLN03213 759 repressor of silencing 3; Provisional 99.39
KOG0125|consensus 376 99.39
KOG0111|consensus 298 99.36
KOG0148|consensus 321 99.35
KOG0146|consensus 371 99.35
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.34
KOG0130|consensus170 99.34
KOG0107|consensus 195 99.33
KOG0124|consensus 544 99.32
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.31
KOG0145|consensus 360 99.29
KOG0108|consensus 435 99.29
KOG4207|consensus 256 99.27
KOG0114|consensus124 99.26
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.24
KOG4205|consensus 311 99.23
KOG0105|consensus 241 99.23
KOG0145|consensus 360 99.19
KOG4212|consensus 608 99.17
KOG0131|consensus203 99.17
KOG0123|consensus 369 99.16
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.14
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.14
KOG0147|consensus 549 99.14
KOG0146|consensus371 99.08
smart0036170 RRM_1 RNA recognition motif. 99.07
KOG0124|consensus 544 99.05
KOG0415|consensus 479 99.04
KOG0127|consensus 678 99.02
KOG0117|consensus 506 98.97
KOG4205|consensus 311 98.93
KOG4208|consensus 214 98.89
KOG0109|consensus 346 98.83
KOG0110|consensus725 98.82
KOG4661|consensus 940 98.82
KOG0123|consensus369 98.79
KOG0116|consensus419 98.79
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.71
KOG4206|consensus 221 98.64
KOG0132|consensus 894 98.62
KOG4212|consensus608 98.6
KOG4209|consensus231 98.59
KOG0533|consensus 243 98.59
KOG0153|consensus377 98.59
KOG0109|consensus 346 98.58
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.56
KOG0226|consensus290 98.51
KOG4454|consensus 267 98.51
KOG0110|consensus 725 98.49
KOG1457|consensus 284 98.29
KOG4660|consensus 549 98.28
KOG0106|consensus 216 98.24
KOG0151|consensus 877 98.16
KOG4211|consensus 510 98.13
KOG0147|consensus 549 98.1
KOG1548|consensus 382 98.06
KOG4849|consensus 498 98.01
KOG1457|consensus284 97.94
KOG0120|consensus 500 97.92
KOG0129|consensus 520 97.9
KOG4211|consensus 510 97.89
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.87
KOG4210|consensus285 97.85
KOG1995|consensus 351 97.82
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.53
KOG0129|consensus520 97.47
KOG4206|consensus221 97.42
KOG1855|consensus 484 97.37
KOG0128|consensus 881 97.29
KOG0128|consensus881 97.24
KOG1190|consensus 492 97.22
KOG1365|consensus 508 97.22
KOG2314|consensus 698 97.09
KOG0106|consensus216 97.03
KOG3152|consensus 278 96.92
KOG0105|consensus241 96.67
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.57
KOG4307|consensus944 96.48
KOG1365|consensus 508 96.41
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.4
KOG0115|consensus 275 96.2
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.19
KOG2416|consensus 718 95.6
KOG1190|consensus492 95.56
KOG4307|consensus 944 95.52
KOG1548|consensus382 95.47
KOG4676|consensus 479 95.3
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.15
KOG1456|consensus 494 94.85
KOG2193|consensus 584 94.83
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.56
KOG0112|consensus 975 94.28
KOG1456|consensus 494 93.83
KOG4483|consensus528 93.77
KOG0120|consensus500 93.64
KOG4210|consensus 285 93.46
KOG2591|consensus 684 92.84
KOG2068|consensus 327 92.78
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 90.98
KOG0112|consensus 975 90.62
KOG2253|consensus 668 90.04
PF03467 176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.92
KOG4410|consensus396 89.09
KOG1996|consensus378 87.24
KOG2202|consensus 260 87.23
PF15023166 DUF4523: Protein of unknown function (DUF4523) 84.32
KOG4285|consensus350 82.22
KOG4660|consensus549 82.21
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
Probab=99.77  E-value=5.8e-18  Score=100.46  Aligned_cols=63  Identities=27%  Similarity=0.452  Sum_probs=59.6

Q ss_pred             CCCCceEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCceeEEEEEeCCHHHHhchh
Q psy6962          25 DPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTI   87 (88)
Q Consensus        25 ~~~~~~l~v~nL~~~~~~~~l~~~f~~~g~v~~~~~~~~~~~g~~~g~~fv~f~~~~~a~~ai   87 (88)
                      .....+|||+|||+++++++|+++|.+||.|..+.++.++.+++++|||||+|.++++|+.||
T Consensus        31 ~~~~~~lfVgnL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kGfaFV~F~~~e~A~~Al   93 (144)
T PLN03134         31 RLMSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI   93 (144)
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEEecCCCCCcceEEEEEECCHHHHHHHH
Confidence            445678999999999999999999999999999999999999999999999999999999987



>KOG0149|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2dhs_A 187 Solution Structure Of Nucleic Acid Binding Protein 5e-13
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 4e-12
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 2e-11
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 3e-10
3nnc_A 175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-10
3nmr_A 175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-09
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 9e-06
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 9e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 3e-05
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 1e-04
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 2e-04
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 2e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 3e-04
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 3e-04
1sxl_A97 Resonance Assignments And Solution Structure Of The 3e-04
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 7e-04
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 7e-04
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Query: 17 SMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG--QSKGL 72 ++ P+QPD D IKMFVGQ+PR+ E DL ++F +YG VY INVLRD+ QSKG Sbjct: 4 TLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGC 61
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-21
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-15
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-15
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 8e-12
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-12
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-13
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-14
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-13
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-13
1x5o_A114 RNA binding motif, single-stranded interacting pro 9e-13
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-12
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-12
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-12
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-12
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 5e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-10
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 6e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 9e-12
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-11
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-11
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-11
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-11
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-11
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-11
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-11
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-11
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-11
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-11
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-11
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-11
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-11
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-05
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 8e-11
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-11
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-10
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-10
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-10
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-06
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-10
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-07
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-10
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-10
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-10
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-10
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 6e-10
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-07
2cph_A107 RNA binding motif protein 19; RNA recognition moti 6e-10
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 7e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 7e-10
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 9e-10
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-09
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-09
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-09
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-07
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-09
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 3e-09
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 6e-08
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-09
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-09
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 4e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-09
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-09
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-09
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-09
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 5e-09
2div_A99 TRNA selenocysteine associated protein; structural 5e-09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-09
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-08
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-08
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-08
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-08
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-08
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-08
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-08
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-07
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-07
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-07
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-07
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-07
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-07
2dnl_A114 Cytoplasmic polyadenylation element binding protei 5e-07
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-07
2f3j_A177 RNA and export factor binding protein 2; RRM domai 8e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 8e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-07
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-06
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-06
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-06
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 7e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 9e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-05
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 6e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 6e-05
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 9e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 9e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 6e-04
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
 Score = 78.5 bits (194), Expect = 6e-21
 Identities = 26/55 (47%), Positives = 37/55 (67%)

Query: 17 SMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 71
          S       D D IK+F+GQIPR++DE DL  +F E+G++Y + VL+D+ TG  KG
Sbjct: 2  SSGSSGMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKG 56


>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.84
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.82
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.81
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.79
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.79
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.79
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.79
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.79
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.79
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.79
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.79
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.78
2div_A99 TRNA selenocysteine associated protein; structural 99.78
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.78
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.78
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.78
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.78
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.78
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.78
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.78
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.78
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.78
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.78
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.78
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.78
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.77
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.77
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.77
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.77
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.77
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.77
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.76
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.76
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.76
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.76
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.76
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.76
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.76
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.76
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.76
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.76
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.76
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.76
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.76
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.76
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.76
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.76
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.76
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.76
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.76
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.75
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.75
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.75
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.75
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.75
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.75
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.75
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.75
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.75
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.74
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.74
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.74
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.74
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.74
2dis_A109 Unnamed protein product; structural genomics, RRM 99.74
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.74
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.74
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.74
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.73
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.73
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.73
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.73
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.73
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.73
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.73
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.73
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.73
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.73
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.72
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.72
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.72
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.71
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.71
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.71
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.71
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.71
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.71
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.7
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.7
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.69
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.69
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.69
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.68
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.68
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.5
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.67
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.66
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.66
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.66
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.66
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.66
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.66
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.65
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.65
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.64
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.64
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.64
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.64
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.64
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.64
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.64
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.64
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.63
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.63
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.63
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.63
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.62
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.62
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.62
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.61
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.61
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.61
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.61
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.6
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.6
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.6
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.59
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.59
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.59
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.58
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.58
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.58
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.58
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.57
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.57
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.56
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.56
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.55
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.55
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.55
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.54
1x5p_A97 Negative elongation factor E; structure genomics, 99.54
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.54
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.54
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.53
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.51
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.51
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.49
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.49
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.49
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.48
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.48
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.46
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.46
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.45
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.44
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.44
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.42
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.4
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.38
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.34
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.32
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.31
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.3
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.28
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.2
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.19
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.11
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.81
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.58
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.36
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.04
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 98.02
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.66
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.64
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.86
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.85
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.78
2kn4_A 158 Immunoglobulin G-binding protein G, splicing FACT 96.73
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.63
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.3
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 94.85
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 93.46
2i2y_A 150 Fusion protein consists of immunoglobin G- binding 85.99
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=2.2e-20  Score=103.68  Aligned_cols=62  Identities=27%  Similarity=0.437  Sum_probs=58.9

Q ss_pred             CCCceEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCceeEEEEEeCCHHHHhchh
Q psy6962          26 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTI   87 (88)
Q Consensus        26 ~~~~~l~v~nL~~~~~~~~l~~~f~~~g~v~~~~~~~~~~~g~~~g~~fv~f~~~~~a~~ai   87 (88)
                      .+..+|||+|||+++++++|+++|++||.|..++++.++.+|+++|||||+|.++++|+.||
T Consensus        17 ~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai   78 (99)
T 4fxv_A           17 FQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAI   78 (99)
T ss_dssp             CCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHH
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHH
Confidence            34578999999999999999999999999999999999989999999999999999999987



>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 7e-06
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-06
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-04
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-04
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-04
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-04
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 5e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 5e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 6e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 0.001
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 0.002
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.002
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.6 bits (104), Expect = 1e-07
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 21 PEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 71
          PEQ      K+F+G +     +  L   F ++G + +  V+RD  T +S+G
Sbjct: 3  PEQLR----KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG 49


>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.86
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.85
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.84
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.84
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.83
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.83
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.83
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.82
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.82
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.82
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.81
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.81
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.79
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.79
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.78
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.77
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.76
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.74
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.72
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.72
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.71
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.71
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.7
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.7
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.7
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.69
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.68
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d1u1qa_ 183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.67
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.65
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.65
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.64
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.64
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.64
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.62
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.62
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.59
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.58
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.58
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.56
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.55
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.5
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.49
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.38
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.33
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.04
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.92
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.08
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.23
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 90.26
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: TAR DNA-binding protein 43, TDP-43
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=1.5e-21  Score=105.59  Aligned_cols=62  Identities=26%  Similarity=0.372  Sum_probs=58.9

Q ss_pred             CCCceEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCceeEEEEEeCCHHHHhchh
Q psy6962          26 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGLKNTSNITQDFSTTTI   87 (88)
Q Consensus        26 ~~~~~l~v~nL~~~~~~~~l~~~f~~~g~v~~~~~~~~~~~g~~~g~~fv~f~~~~~a~~ai   87 (88)
                      +...+|||+|||+++++++|+++|+.||.|..+.++.++.+|+++|||||.|.++++|+.||
T Consensus         6 ~~~~~lfV~nLp~~~te~~l~~~F~~~G~i~~v~i~~d~~tg~srG~aFV~f~~~~~a~~al   67 (90)
T d2cqga1           6 QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVM   67 (90)
T ss_dssp             CCCCCEEEESCCSSCCHHHHHHHHGGGSCEEEEEEEECSSSCSEEEEEEEEESSHHHHHHHH
T ss_pred             cCCCeEEEECCCCCCCHHHHHHHHHhhcccceeeeccCCCCcccCCEEEEEECCHHHHHHHH
Confidence            45578999999999999999999999999999999999989999999999999999999986



>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure