Psyllid ID: psy69


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MAMSDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHccHHHEHHHHHHHHHHHHcHHHHHHHHHHHHHHEEEEcHHHccccccEEEcHHHHHHHHHccc
mamsdtplpifcyldrrIIYKQQVLFVAASLGvisnplgallsGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQgfsavllpqlhresshilvtpgeaswigkiss
MAMSDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESShilvtpgeaswigkiss
MAMSDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
*******LPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWI*****
*AMSDTPLPIFCYLDR*IIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
MAMSDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
***SDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMSDTPLPIFCYLDRRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLLPQLHRESSHILVTPGEASWIGKISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q9FRL3 487 Sugar transporter ERD6-li yes N/A 0.414 0.133 0.415 3e-06
Q93YP9 488 Sugar transporter ERD6-li no N/A 0.414 0.133 0.415 4e-06
Q94CI6 478 Sugar transporter ERD6-li no N/A 0.401 0.131 0.380 2e-05
Q94KE0 470 Sugar transporter ERD6-li no N/A 0.343 0.114 0.444 2e-05
Q8GXK5 482 Sugar transporter ERD6-li no N/A 0.426 0.139 0.358 3e-05
A9ZSY3 505 Facilitated trehalose tra N/A N/A 0.458 0.142 0.342 5e-05
B0WC46 517 Facilitated trehalose tra N/A N/A 0.433 0.131 0.323 5e-05
B4QBN3 488 Facilitated trehalose tra N/A N/A 0.401 0.129 0.333 0.0001
Q9M0Z9 478 Sugar transporter ERD6-li no N/A 0.426 0.140 0.358 0.0001
Q93Z80 458 Sugar transporter ERD6-li no N/A 0.369 0.126 0.396 0.0002
>sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 Back     alignment and function desciption
 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%)

Query: 27  VAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFIT 86
           V  SL  +   +GA+ SG I E  GRK +L +A+IP   GWL ++FA D   L +GR + 
Sbjct: 89  VFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLE 148

Query: 87  GVAIG 91
           G  +G
Sbjct: 149 GFGVG 153




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 Back     alignment and function description
>sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 Back     alignment and function description
>sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 Back     alignment and function description
>sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 Back     alignment and function description
>sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 Back     alignment and function description
>sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
328701837 496 PREDICTED: facilitated trehalose transpo 0.420 0.133 0.621 2e-16
91084359 484 PREDICTED: similar to AGAP007667-PA [Tri 0.407 0.132 0.492 2e-12
270008828 522 hypothetical protein TcasGA2_TC015433 [T 0.414 0.124 0.492 3e-12
357611704 583 hypothetical protein KGM_13558 [Danaus p 0.426 0.114 0.507 5e-11
242017426 515 conserved hypothetical protein [Pediculu 0.439 0.133 0.521 8e-11
383854850 532 PREDICTED: facilitated trehalose transpo 0.382 0.112 0.523 9e-10
380021871 559 PREDICTED: facilitated trehalose transpo 0.643 0.180 0.339 1e-09
340724199 537 PREDICTED: facilitated trehalose transpo 0.382 0.111 0.476 2e-09
322794505 513 hypothetical protein SINV_10456 [Solenop 0.382 0.116 0.476 2e-09
307202951 521 Solute carrier family 2, facilitated glu 0.382 0.115 0.492 2e-09
>gi|328701837|ref|XP_001944504.2| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%)

Query: 29  ASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGV 88
           ASLGVISNPLGAL+SG  M++ GRKTT+Q+ SIPF  GW+++  + D+  LC+GRFI+GV
Sbjct: 65  ASLGVISNPLGALMSGVFMQILGRKTTVQLTSIPFLIGWIIIGLSTDITLLCLGRFISGV 124

Query: 89  AIGKSE 94
           AIG S 
Sbjct: 125 AIGMSS 130




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91084359|ref|XP_973264.1| PREDICTED: similar to AGAP007667-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270008828|gb|EFA05276.1| hypothetical protein TcasGA2_TC015433 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357611704|gb|EHJ67616.1| hypothetical protein KGM_13558 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242017426|ref|XP_002429189.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514078|gb|EEB16451.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383854850|ref|XP_003702933.1| PREDICTED: facilitated trehalose transporter Tret1-2 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021871|ref|XP_003694780.1| PREDICTED: facilitated trehalose transporter Tret1-like [Apis florea] Back     alignment and taxonomy information
>gi|340724199|ref|XP_003400471.1| PREDICTED: facilitated trehalose transporter Tret1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322794505|gb|EFZ17558.1| hypothetical protein SINV_10456 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307202951|gb|EFN82171.1| Solute carrier family 2, facilitated glucose transporter member 6 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2016407 488 AT1G19450 [Arabidopsis thalian 0.617 0.198 0.313 1.9e-07
TAIR|locus:2025132 487 ERDL6 "ERD6-like 6" [Arabidops 0.414 0.133 0.415 2.4e-07
TAIR|locus:2138927 482 AT4G04750 [Arabidopsis thalian 0.573 0.186 0.304 5e-07
ZFIN|ZDB-GENE-030829-25 498 slc2a8 "solute carrier family 0.592 0.186 0.359 6.8e-07
UNIPROTKB|A9ZSY3 505 Tret1 "Facilitated trehalose t 0.458 0.142 0.342 8.9e-07
TAIR|locus:2146365 478 SFP2 [Arabidopsis thaliana (ta 0.401 0.131 0.380 1.3e-06
UNIPROTKB|B0WC46 517 Tret1 "Facilitated trehalose t 0.407 0.123 0.328 1.5e-06
ASPGD|ASPL0000044073 536 AN2466 [Emericella nidulans (t 0.343 0.100 0.388 1.6e-06
UNIPROTKB|A9ZSY2 502 Tret1 "Facilitated trehalose t 0.458 0.143 0.305 1.8e-06
UNIPROTKB|A5LGM7 504 Tret1 "Facilitated trehalose t 0.401 0.125 0.317 2.4e-06
TAIR|locus:2016407 AT1G19450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 1.9e-07, P = 1.9e-07
 Identities = 31/99 (31%), Positives = 52/99 (52%)

Query:    27 VAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFIT 86
             V  SL  +   +GA+ SG I E  GRK +L +A+IP   GWL ++FA D   L +GR + 
Sbjct:    90 VFGSLSNVGAMVGAIASGQIAEYVGRKGSLMIAAIPNIIGWLSISFAKDTSFLYMGRLLE 149

Query:    87 GVAIGKSELNHQLFMTALVVILMASL--SAHSVNMSIGM 123
             G  +G       +++  +    M     S + ++++IG+
Sbjct:   150 GFGVGIISYTVPVYIAEIAPQTMRGALGSVNQLSVTIGI 188




GO:0005215 "transporter activity" evidence=IEA
GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0022891 "substrate-specific transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
TAIR|locus:2025132 ERDL6 "ERD6-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138927 AT4G04750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030829-25 slc2a8 "solute carrier family 2 (facilitated glucose transporter), member 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
TAIR|locus:2146365 SFP2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044073 AN2466 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY2 Tret1 "Facilitated trehalose transporter Tret1" [Apis mellifera ligustica (taxid:7469)] Back     alignment and assigned GO terms
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 2e-05
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 2e-04
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 4e-04
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 0.004
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
 Score = 42.7 bits (101), Expect = 2e-05
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 37  PLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADD--VLQLCIGRFITGVAIG 91
            +G+L +G + + +GRK +L + ++ F  G LL  FA       L +GR I G+ +G
Sbjct: 60  LIGSLFAGKLGDRFGRKKSLLIGNVLFVIGALLQGFAKGKSFYMLIVGRVIVGLGVG 116


Length = 449

>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.77
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.72
KOG0569|consensus 485 99.72
TIGR00898 505 2A0119 cation transport protein. 99.72
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.71
KOG0254|consensus 513 99.69
KOG0255|consensus 521 99.69
PRK09705 393 cynX putative cyanate transporter; Provisional 99.68
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.67
PRK03545 390 putative arabinose transporter; Provisional 99.66
PRK12307 426 putative sialic acid transporter; Provisional 99.66
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.66
TIGR00891 405 2A0112 putative sialic acid transporter. 99.65
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.65
TIGR00893 399 2A0114 d-galactonate transporter. 99.64
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.64
KOG1330|consensus 493 99.64
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.64
PRK03633 381 putative MFS family transporter protein; Provision 99.63
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.62
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.62
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.62
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.62
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.61
TIGR00900 365 2A0121 H+ Antiporter protein. 99.61
PRK10091 382 MFS transport protein AraJ; Provisional 99.6
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.6
PRK11663 434 regulatory protein UhpC; Provisional 99.6
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.6
PRK03699 394 putative transporter; Provisional 99.6
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.6
PRK10642 490 proline/glycine betaine transporter; Provisional 99.59
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.59
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.58
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.58
PRK03893 496 putative sialic acid transporter; Provisional 99.58
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.58
PRK12382 392 putative transporter; Provisional 99.57
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.57
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.57
PRK10504 471 putative transporter; Provisional 99.57
PRK10133 438 L-fucose transporter; Provisional 99.57
TIGR00895 398 2A0115 benzoate transport. 99.57
PRK05122 399 major facilitator superfamily transporter; Provisi 99.56
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.56
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.56
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.56
KOG2615|consensus 451 99.55
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.55
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.55
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.54
PRK10054 395 putative transporter; Provisional 99.54
PRK09952 438 shikimate transporter; Provisional 99.54
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.54
PLN00028 476 nitrate transmembrane transporter; Provisional 99.53
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.53
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.53
PRK11043 401 putative transporter; Provisional 99.52
PRK15075 434 citrate-proton symporter; Provisional 99.51
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.5
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.48
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.44
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.44
TIGR00805 633 oat sodium-independent organic anion transporter. 99.44
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.44
KOG2532|consensus 466 99.43
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.42
KOG3764|consensus 464 99.42
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.41
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.41
PRK10642490 proline/glycine betaine transporter; Provisional 99.41
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.41
PRK10489 417 enterobactin exporter EntS; Provisional 99.39
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.39
PRK09874 408 drug efflux system protein MdtG; Provisional 99.39
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.37
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.36
PTZ00207 591 hypothetical protein; Provisional 99.35
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.32
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.3
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.3
TIGR00900365 2A0121 H+ Antiporter protein. 99.29
KOG0252|consensus 538 99.28
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.27
TIGR00891405 2A0112 putative sialic acid transporter. 99.26
TIGR00895398 2A0115 benzoate transport. 99.23
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.23
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.23
TIGR00901 356 2A0125 AmpG-related permease. 99.23
PRK15011393 sugar efflux transporter B; Provisional 99.23
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.22
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.22
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.21
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.18
PRK12382392 putative transporter; Provisional 99.17
PRK10489417 enterobactin exporter EntS; Provisional 99.17
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.17
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.16
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.16
PRK05122399 major facilitator superfamily transporter; Provisi 99.15
KOG0253|consensus 528 99.15
PRK09528420 lacY galactoside permease; Reviewed 99.14
PRK11902 402 ampG muropeptide transporter; Reviewed 99.13
KOG2533|consensus 495 99.1
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.1
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.1
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.09
PRK09952438 shikimate transporter; Provisional 99.07
PRK03893496 putative sialic acid transporter; Provisional 99.06
PRK11010 491 ampG muropeptide transporter; Validated 99.05
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.05
PRK15011 393 sugar efflux transporter B; Provisional 99.05
TIGR00893399 2A0114 d-galactonate transporter. 99.04
PRK03633381 putative MFS family transporter protein; Provision 99.02
PRK03545390 putative arabinose transporter; Provisional 99.01
PRK09874408 drug efflux system protein MdtG; Provisional 99.01
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.01
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.0
PRK03699394 putative transporter; Provisional 99.0
TIGR00901356 2A0125 AmpG-related permease. 99.0
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.99
PRK15075434 citrate-proton symporter; Provisional 98.99
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.99
PRK12307426 putative sialic acid transporter; Provisional 98.96
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.96
TIGR00896355 CynX cyanate transporter. This family of proteins 98.96
PRK10504471 putative transporter; Provisional 98.96
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.95
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.95
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 98.95
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 98.94
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.94
COG2270438 Permeases of the major facilitator superfamily [Ge 98.94
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.92
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.91
TIGR00897402 2A0118 polyol permease family. This family of prot 98.91
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.9
TIGR00898505 2A0119 cation transport protein. 98.9
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.88
PRK15402406 multidrug efflux system translocase MdfA; Provisio 98.88
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.87
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.87
PRK09705393 cynX putative cyanate transporter; Provisional 98.86
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.86
PRK09528 420 lacY galactoside permease; Reviewed 98.84
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.84
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.83
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.82
TIGR00881379 2A0104 phosphoglycerate transporter family protein 98.82
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.78
PRK09848448 glucuronide transporter; Provisional 98.78
PRK11195393 lysophospholipid transporter LplT; Provisional 98.77
KOG2504|consensus 509 98.77
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.74
PRK11663434 regulatory protein UhpC; Provisional 98.74
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.72
PRK10133438 L-fucose transporter; Provisional 98.72
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.71
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.71
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.7
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.69
PRK11646400 multidrug resistance protein MdtH; Provisional 98.68
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.68
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.68
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.68
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.67
PRK10091382 MFS transport protein AraJ; Provisional 98.66
PRK11010491 ampG muropeptide transporter; Validated 98.64
KOG2325|consensus 488 98.6
PRK09669 444 putative symporter YagG; Provisional 98.59
COG0477 338 ProP Permeases of the major facilitator superfamil 98.58
KOG2504|consensus509 98.56
PF13347428 MFS_2: MFS/sugar transport protein 98.56
PRK10054395 putative transporter; Provisional 98.55
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 98.54
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.54
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.53
PLN00028476 nitrate transmembrane transporter; Provisional 98.52
PRK10429473 melibiose:sodium symporter; Provisional 98.52
PRK11043401 putative transporter; Provisional 98.51
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.5
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.5
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.49
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.49
PRK10429 473 melibiose:sodium symporter; Provisional 98.48
PRK09669444 putative symporter YagG; Provisional 98.48
KOG0253|consensus528 98.48
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.47
KOG0569|consensus485 98.46
KOG4686|consensus459 98.44
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.43
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.38
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.37
PRK11652394 emrD multidrug resistance protein D; Provisional 98.37
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.37
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.36
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.34
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.28
PRK11902402 ampG muropeptide transporter; Reviewed 98.28
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.25
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.25
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.23
PF13347 428 MFS_2: MFS/sugar transport protein 98.19
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.19
PRK11462 460 putative transporter; Provisional 98.15
PRK11462460 putative transporter; Provisional 98.12
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.12
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.12
COG2211467 MelB Na+/melibiose symporter and related transport 98.08
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.07
PRK09848 448 glucuronide transporter; Provisional 98.04
KOG3762|consensus618 98.02
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.99
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.95
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.94
PF1283277 MFS_1_like: MFS_1 like family 97.81
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.81
COG2211 467 MelB Na+/melibiose symporter and related transport 97.81
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.81
KOG2816|consensus 463 97.72
KOG4686|consensus 459 97.68
KOG2563|consensus 480 97.64
KOG3764|consensus464 97.61
KOG0255|consensus521 97.58
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.54
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.53
KOG0254|consensus513 97.51
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.48
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 97.33
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.31
KOG2816|consensus463 97.19
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.15
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.14
KOG3098|consensus 461 97.11
PRK15403413 multidrug efflux system protein MdtM; Provisional 97.04
COG0738422 FucP Fucose permease [Carbohydrate transport and m 96.88
KOG2615|consensus451 96.81
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.81
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.77
KOG2533|consensus495 96.61
KOG2532|consensus466 96.59
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.54
KOG4332|consensus 454 96.49
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.31
COG2270 438 Permeases of the major facilitator superfamily [Ge 96.25
KOG3626|consensus 735 96.06
PTZ00207591 hypothetical protein; Provisional 96.02
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 95.98
KOG3762|consensus 618 95.97
KOG0252|consensus538 95.85
KOG0637|consensus 498 95.72
KOG3098|consensus461 95.0
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 94.68
KOG1479|consensus406 93.72
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 92.98
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 91.94
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 91.71
KOG3574|consensus 510 91.58
KOG1330|consensus493 90.16
KOG3880|consensus409 89.39
TIGR00805 633 oat sodium-independent organic anion transporter. 88.95
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 87.07
KOG0637|consensus498 85.32
KOG2563|consensus480 84.59
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 84.36
PRK03612 521 spermidine synthase; Provisional 83.35
KOG1237|consensus571 81.75
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
Probab=99.77  E-value=9.8e-18  Score=135.66  Aligned_cols=140  Identities=14%  Similarity=0.080  Sum_probs=119.2

Q ss_pred             cccccHHHHHHHHHHHHHHHHHHHHHhHHHHHhHhccchhhhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhhhhHH
Q psy69            16 RRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFADDVLQLCIGRFITGVAIGKSEL   95 (157)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~g~~i~~~~~g~l~d~~grk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~~~g~~~~   95 (157)
                      +++++..+. +++.+++.++.+++++++|+++||+|||+.++++.++..++.++..++++++.++++|++.|++.++..+
T Consensus       196 ~~gls~~~~-g~l~s~~~lG~iiG~li~G~LsDR~GRR~~lii~lil~~i~~ll~afa~s~~~llv~R~l~G~g~g~~~p  274 (742)
T TIGR01299       196 DLCIPDSGK-GMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIP  274 (742)
T ss_pred             HhCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHH
Confidence            467888899 9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh---------------------------------------hhccc
Q psy69            96 NHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVL---------------------------------------LPQLH  136 (157)
Q Consensus        96 ~~~~~~~~~~p~~~r~~~~~~~~~~~~~~~~~~~~~---------------------------------------~~~~~  136 (157)
                      ....++.|++|++.|++..+....+..+|..+++.+                                       ...+.
T Consensus       275 ~~~~~isE~~p~~~Rg~~~g~~~~~~~iG~ila~~la~~il~~~G~~~~~g~~~~~~gWR~l~~i~~lp~ll~ll~~~~l  354 (742)
T TIGR01299       275 IVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFM  354 (742)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhccccccccccHHHHHHHHHHHHHHHHHHHHHc
Confidence            999999999999999998887766665554444321                                       12235


Q ss_pred             cCCcccccCCCChhhhhhcc
Q psy69           137 RESSHILVTPGEASWIGKIS  156 (157)
Q Consensus       137 ~~~~~~~~~~~~~~w~~~~~  156 (157)
                      ||+|+|+..+++.+...+++
T Consensus       355 PESPrwL~~~gr~~eA~~iL  374 (742)
T TIGR01299       355 PESPRFFLENGKHDEAWMIL  374 (742)
T ss_pred             CCCHHHHHHCCCHHHHHHHH
Confidence            99999998887766665543



This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.

>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.82
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.68
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.65
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.61
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.61
2xut_A 524 Proton/peptide symporter family protein; transport 99.5
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.19
2cfq_A417 Lactose permease; transport, transport mechanism, 99.15
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.01
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.89
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.84
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.77
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.55
2xut_A524 Proton/peptide symporter family protein; transport 97.93
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.82  E-value=7.3e-20  Score=140.47  Aligned_cols=136  Identities=20%  Similarity=0.254  Sum_probs=116.4

Q ss_pred             ccHHHHHHHHHHHHHHHHHHHHHhHHHHHhHhccchhhhhhhHHHHHHHHHHH------------------HhcCHHHHH
Q psy69            19 IYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMA------------------FADDVLQLC   80 (157)
Q Consensus        19 ~~~~~~~~~~~~~~~~g~~i~~~~~g~l~d~~grk~~~~~~~~~~~~~~~~~~------------------~~~~~~~~~   80 (157)
                      .++.+. +++.+.+.+|..+|+++.|+++||+|||++++++.+++.++.++++                  ++++++.++
T Consensus        52 ~~~~~~-g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~a~~~~~~~~~~~~~~~~~~~a~~~~~l~  130 (491)
T 4gc0_A           52 AANSLL-GFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFV  130 (491)
T ss_dssp             HHHHHH-HHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHCTTTTTSCSSSSSSCCGGGGGCHHHHH
T ss_pred             cHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHhhhhhhhcchhHHHHHHhhhHHHHH
Confidence            345566 8999999999999999999999999999999999999999999888                  478999999


Q ss_pred             HHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-----------------------------
Q psy69            81 IGRFITGVAIGKSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVL-----------------------------  131 (157)
Q Consensus        81 ~~~~l~G~~~g~~~~~~~~~~~~~~p~~~r~~~~~~~~~~~~~~~~~~~~~-----------------------------  131 (157)
                      ++|++.|++.|...+..+.+++|..|+++|++..+..+.....|..++..+                             
T Consensus       131 ~~R~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (491)
T 4gc0_A          131 IYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPA  210 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhh
Confidence            999999999999999999999999999999999988777766554444322                             


Q ss_pred             -----hhccccCCcccccCCCChhhhhhc
Q psy69           132 -----LPQLHRESSHILVTPGEASWIGKI  155 (157)
Q Consensus       132 -----~~~~~~~~~~~~~~~~~~~w~~~~  155 (157)
                           .....||+|+|+..+++.++.++.
T Consensus       211 ~~~~~~~~~~peSp~~L~~~~~~~~a~~~  239 (491)
T 4gc0_A          211 LLFLMLLYTVPESPRWLMSRGKQEQAEGI  239 (491)
T ss_dssp             HHHHHHGGGSCCCHHHHHHTTCHHHHHHH
T ss_pred             hhhhhhhhcCCCChHHHHHcCchhHHHHh
Confidence                 233458999999988888776654



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.63
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.17
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.02
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.86
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.63  E-value=3.1e-16  Score=116.36  Aligned_cols=116  Identities=14%  Similarity=0.046  Sum_probs=104.1

Q ss_pred             cccccHHHHHHHHHHHHHHHHHHHHHhHHHHHhHhccchhhhhhhHHHHHHHHHHHHh----cCHHHHHHHHHHHHhhhh
Q psy69            16 RRIIYKQQVLFVAASLGVISNPLGALLSGTIMEVWGRKTTLQVASIPFFFGWLLMAFA----DDVLQLCIGRFITGVAIG   91 (157)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~g~~i~~~~~g~l~d~~grk~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~l~G~~~g   91 (157)
                      +.++++.|. +++.+.+.++..+++++.|+++||+|||+++..+.++..++.++.++.    ++++.+++.|++.|++.+
T Consensus        53 ~~g~s~~~~-g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~  131 (447)
T d1pw4a_          53 EQGFSRGDL-GFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQG  131 (447)
T ss_dssp             SSTTCSSCH-HHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHH
T ss_pred             HhCcCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhh
Confidence            368899999 999999999999999999999999999999999999988888877664    477889999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy69            92 KSELNHQLFMTALVVILMASLSAHSVNMSIGMCQGFSAVLL  132 (157)
Q Consensus        92 ~~~~~~~~~~~~~~p~~~r~~~~~~~~~~~~~~~~~~~~~~  132 (157)
                      ...+....++.|++|+++|++..+..+....+|..+++.+.
T Consensus       132 ~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~  172 (447)
T d1pw4a_         132 MGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLF  172 (447)
T ss_dssp             HTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHH
T ss_pred             hhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhh
Confidence            99999999999999999999999998888887766665543



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure