Psyllid ID: psy7005


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MGNIIPKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHFKQKKSKVVQDA
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccc
cccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHEccccccccHHHHHHHHHcccccEcccc
mgniipkgrgIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWlpetegktLHEIELHFKQKKSKVVQDA
mgniipkgrgiASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHfkqkkskvvqda
MGNIIPKGRGIASGlvatvayalafataktflDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHFKQKKSKVVQDA
*******GRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHF***********
MGNIIPKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIE**************
MGNIIPKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHF***********
*GNIIPKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHFKQKK*******
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNIIPKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHFKQKKSKVVQDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
B3NSE1856 Facilitated trehalose tra N/A N/A 0.840 0.086 0.426 8e-12
Q7PIR5793 Facilitated trehalose tra no N/A 0.840 0.093 0.4 8e-12
B4QBN2857 Facilitated trehalose tra N/A N/A 0.840 0.086 0.44 2e-11
B4HNS0857 Facilitated trehalose tra N/A N/A 0.840 0.086 0.426 2e-11
A1Z8N1857 Facilitated trehalose tra yes N/A 0.840 0.086 0.426 2e-11
B0WC46517 Facilitated trehalose tra N/A N/A 0.840 0.143 0.413 2e-11
B4P624856 Facilitated trehalose tra N/A N/A 0.840 0.086 0.413 3e-11
Q8MKK4488 Facilitated trehalose tra no N/A 0.840 0.151 0.44 4e-11
Q17NV8806 Facilitated trehalose tra N/A N/A 0.840 0.091 0.413 5e-11
B4HNS1488 Facilitated trehalose tra N/A N/A 0.840 0.151 0.44 6e-11
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1   MGNIIP-KGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLY 59
           MG I+P K RG A+ +     ++  F   KTF DL + +G HG F+L+G+    GL ++ 
Sbjct: 759 MGEILPAKIRGSAASVATAFNWSCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVI 818

Query: 60  IWLPETEGKTLHEIE 74
           I++PET+GKTL +IE
Sbjct: 819 IYVPETQGKTLEDIE 833




Low-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Drosophila erecta (taxid: 7220)
>sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 Back     alignment and function description
>sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 Back     alignment and function description
>sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 Back     alignment and function description
>sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 Back     alignment and function description
>sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 Back     alignment and function description
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
193669080 515 PREDICTED: facilitated trehalose transpo 0.875 0.149 0.493 4e-13
242013039 490 conserved hypothetical protein [Pediculu 0.943 0.169 0.464 1e-12
170043906 566 sugar transporter [Culex quinquefasciatu 0.909 0.141 0.4 2e-12
157125518 570 sugar transporter [Aedes aegypti] gi|108 0.909 0.140 0.4 4e-12
242003132 387 conserved hypothetical protein [Pediculu 0.931 0.211 0.439 8e-12
193669064 494 PREDICTED: facilitated trehalose transpo 0.943 0.168 0.440 1e-11
193664559 530 PREDICTED: facilitated trehalose transpo 0.795 0.132 0.507 2e-11
242020658 545 conserved hypothetical protein [Pediculu 0.852 0.137 0.493 2e-11
350397791 541 PREDICTED: facilitated trehalose transpo 0.909 0.147 0.456 4e-11
340724392 541 PREDICTED: facilitated trehalose transpo 0.909 0.147 0.456 5e-11
>gi|193669080|ref|XP_001943832.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 78.6 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 7   KGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETE 66
           +GRG ASG  A   Y +AF  +KT+L+L   + L+G FFLYG  +  G+I++Y  LPETE
Sbjct: 439 RGRGEASGACAATFYIIAFLVSKTWLNLQSSVELYGCFFLYGILAAIGIIFVYKCLPETE 498

Query: 67  GKTLHEIELHFKQKKSK 83
           GKTL EIE +F +K  +
Sbjct: 499 GKTLAEIEKNFTKKNVR 515




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242013039|ref|XP_002427227.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511535|gb|EEB14489.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170043906|ref|XP_001849608.1| sugar transporter [Culex quinquefasciatus] gi|167867183|gb|EDS30566.1| sugar transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157125518|ref|XP_001654366.1| sugar transporter [Aedes aegypti] gi|108873601|gb|EAT37826.1| AAEL010219-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242003132|ref|XP_002422622.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505423|gb|EEB09884.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193669064|ref|XP_001942711.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193664559|ref|XP_001946897.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242020658|ref|XP_002430769.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515966|gb|EEB18031.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350397791|ref|XP_003484994.1| PREDICTED: facilitated trehalose transporter Tret1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724392|ref|XP_003400566.1| PREDICTED: facilitated trehalose transporter Tret1-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
UNIPROTKB|B0WC46517 Tret1 "Facilitated trehalose t 0.840 0.143 0.36 6e-08
UNIPROTKB|Q7PIR5793 Tret1 "Facilitated trehalose t 0.840 0.093 0.346 1.4e-07
FB|FBgn0033644488 Tret1-2 "Trehalose transporter 0.840 0.151 0.373 1.5e-07
UNIPROTKB|B3NSE1856 Tret1 "Facilitated trehalose t 0.840 0.086 0.373 1.5e-07
FB|FBgn0050035857 Tret1-1 "Trehalose transporter 0.840 0.086 0.373 2e-07
UNIPROTKB|B4HNS0857 Tret1-1 "Facilitated trehalose 0.840 0.086 0.373 2e-07
UNIPROTKB|Q17NV8806 Tret1 "Facilitated trehalose t 0.840 0.091 0.36 3.8e-07
UNIPROTKB|B4HNS1488 Tret1-2 "Facilitated trehalose 0.840 0.151 0.373 4e-07
UNIPROTKB|B4P624856 Tret1 "Facilitated trehalose t 0.840 0.086 0.36 5.3e-07
UNIPROTKB|B4QBN3488 Tret1-2 "Facilitated trehalose 0.840 0.151 0.373 6.6e-07
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 6.0e-08, P = 6.0e-08
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query:     1 MGNIIP-KGRGIASGXXXXXXXXXXXXXXXXXXDLHMRIGLHGVFFLYGSCSVFGLIYLY 59
             MG I+P K RG A+                   D+   IG HG F+++GS  V GL+++ 
Sbjct:   420 MGEILPGKIRGSAASVATAFNWSCTFVVTKTFADIIASIGTHGAFWMFGSVCVVGLVFVI 479

Query:    60 IWLPETEGKTLHEIE 74
             +++PET+GK+L +IE
Sbjct:   480 MYVPETQGKSLEDIE 494




GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS
GO:0015771 "trehalose transport" evidence=ISS
GO:0044459 "plasma membrane part" evidence=ISS
UNIPROTKB|Q7PIR5 Tret1 "Facilitated trehalose transporter Tret1" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0033644 Tret1-2 "Trehalose transporter 1-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3NSE1 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
FB|FBgn0050035 Tret1-1 "Trehalose transporter 1-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS0 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|Q17NV8 Tret1 "Facilitated trehalose transporter Tret1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS1 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4P624 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN3 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 2e-06
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 4e-05
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 5e-04
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 43.1 bits (102), Expect = 2e-06
 Identities = 23/68 (33%), Positives = 34/68 (50%)

Query: 6   PKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPET 65
              R     +     +   F     F  +   IG+ GVF  +G  +V GLI++Y +LPET
Sbjct: 414 LSLRPKGISIAVAANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNVLGLIFVYFFLPET 473

Query: 66  EGKTLHEI 73
           +G+TL EI
Sbjct: 474 KGRTLEEI 481


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
KOG0569|consensus485 99.65
KOG0254|consensus513 99.4
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.38
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.35
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.33
KOG0252|consensus538 99.21
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.85
TIGR00898505 2A0119 cation transport protein. 98.63
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.63
PRK10489417 enterobactin exporter EntS; Provisional 98.53
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.49
KOG0253|consensus528 98.45
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.38
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.35
TIGR00893 399 2A0114 d-galactonate transporter. 98.33
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.27
PRK10642490 proline/glycine betaine transporter; Provisional 98.25
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.23
PRK03545 390 putative arabinose transporter; Provisional 98.21
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.21
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.19
PRK11663434 regulatory protein UhpC; Provisional 98.18
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.17
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.17
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.16
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.16
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.14
PRK11663 434 regulatory protein UhpC; Provisional 98.12
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.05
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.03
PRK10091 382 MFS transport protein AraJ; Provisional 98.02
TIGR00895 398 2A0115 benzoate transport. 97.98
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.93
TIGR00901 356 2A0125 AmpG-related permease. 97.93
KOG2532|consensus 466 97.92
PRK09874 408 drug efflux system protein MdtG; Provisional 97.92
PLN00028 476 nitrate transmembrane transporter; Provisional 97.91
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.88
KOG0255|consensus521 97.88
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.88
TIGR00900 365 2A0121 H+ Antiporter protein. 97.88
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.88
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.85
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.84
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.77
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.75
PRK11010 491 ampG muropeptide transporter; Validated 97.73
PRK10504 471 putative transporter; Provisional 97.71
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.71
PRK12307 426 putative sialic acid transporter; Provisional 97.66
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 97.66
PRK12382392 putative transporter; Provisional 97.65
PRK10077 479 xylE D-xylose transporter XylE; Provisional 97.64
KOG0255|consensus 521 97.64
PRK09705393 cynX putative cyanate transporter; Provisional 97.64
TIGR00891 405 2A0112 putative sialic acid transporter. 97.64
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.63
PRK10054 395 putative transporter; Provisional 97.63
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.61
TIGR00893399 2A0114 d-galactonate transporter. 97.6
PRK05122399 major facilitator superfamily transporter; Provisi 97.59
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.56
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.55
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.54
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.54
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.53
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.5
PRK03893 496 putative sialic acid transporter; Provisional 97.49
KOG1330|consensus 493 97.48
TIGR00892 455 2A0113 monocarboxylate transporter 1. 97.47
PRK11043 401 putative transporter; Provisional 97.45
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.43
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.43
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.39
PRK11902 402 ampG muropeptide transporter; Reviewed 97.37
PRK09952438 shikimate transporter; Provisional 97.37
PRK10642 490 proline/glycine betaine transporter; Provisional 97.36
PRK03545390 putative arabinose transporter; Provisional 97.36
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.34
KOG2533|consensus 495 97.33
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.31
PRK10207 489 dipeptide/tripeptide permease B; Provisional 97.3
PRK10489 417 enterobactin exporter EntS; Provisional 97.29
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.29
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 97.27
PRK12307426 putative sialic acid transporter; Provisional 97.27
PRK09528420 lacY galactoside permease; Reviewed 97.27
PRK15011 393 sugar efflux transporter B; Provisional 97.22
TIGR00898 505 2A0119 cation transport protein. 97.19
PRK03893496 putative sialic acid transporter; Provisional 97.18
PRK15075434 citrate-proton symporter; Provisional 97.17
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.16
KOG2816|consensus 463 97.14
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.14
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.1
PRK15075 434 citrate-proton symporter; Provisional 97.04
PRK15011393 sugar efflux transporter B; Provisional 97.0
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.0
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.96
PRK11195 393 lysophospholipid transporter LplT; Provisional 96.95
PRK03699 394 putative transporter; Provisional 96.95
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.94
PRK10406 432 alpha-ketoglutarate transporter; Provisional 96.93
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 96.92
TIGR00897402 2A0118 polyol permease family. This family of prot 96.88
PRK09874408 drug efflux system protein MdtG; Provisional 96.88
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.83
KOG3764|consensus 464 96.8
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.79
KOG0254|consensus 513 96.79
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.78
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.76
KOG2504|consensus 509 96.63
PF13347 428 MFS_2: MFS/sugar transport protein 96.61
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.57
PRK12382 392 putative transporter; Provisional 96.52
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 96.52
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.43
TIGR00897 402 2A0118 polyol permease family. This family of prot 96.43
PRK09705 393 cynX putative cyanate transporter; Provisional 96.39
PRK09952 438 shikimate transporter; Provisional 96.36
PTZ00207 591 hypothetical protein; Provisional 96.3
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.29
PRK11010491 ampG muropeptide transporter; Validated 96.21
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.16
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 96.15
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 96.11
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.11
TIGR00805 633 oat sodium-independent organic anion transporter. 96.05
PRK05122 399 major facilitator superfamily transporter; Provisi 96.04
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 96.02
PRK11462 460 putative transporter; Provisional 96.0
PRK09669 444 putative symporter YagG; Provisional 95.93
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 95.9
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 95.87
TIGR00896 355 CynX cyanate transporter. This family of proteins 95.85
TIGR00881379 2A0104 phosphoglycerate transporter family protein 95.74
TIGR00891405 2A0112 putative sialic acid transporter. 95.72
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.61
KOG2615|consensus 451 95.58
PRK03633381 putative MFS family transporter protein; Provision 95.57
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 95.34
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.28
TIGR00788 468 fbt folate/biopterin transporter. The only functio 95.25
PRK09528 420 lacY galactoside permease; Reviewed 95.12
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.12
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 95.07
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 95.0
KOG0569|consensus 485 94.94
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 94.92
COG2211 467 MelB Na+/melibiose symporter and related transport 94.75
PRK03699394 putative transporter; Provisional 94.7
TIGR00788468 fbt folate/biopterin transporter. The only functio 94.7
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 94.54
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 94.32
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 94.14
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 94.12
PRK11902402 ampG muropeptide transporter; Reviewed 94.07
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 94.01
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 93.98
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 93.93
PRK15402406 multidrug efflux system translocase MdfA; Provisio 93.91
PLN00028476 nitrate transmembrane transporter; Provisional 93.79
PRK10504471 putative transporter; Provisional 93.63
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 93.3
PRK10054395 putative transporter; Provisional 93.11
PRK11646400 multidrug resistance protein MdtH; Provisional 93.0
TIGR00900365 2A0121 H+ Antiporter protein. 92.45
PRK10091382 MFS transport protein AraJ; Provisional 92.36
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 92.36
KOG3762|consensus618 92.17
TIGR00902382 2A0127 phenyl proprionate permease family protein. 91.96
PRK10429 473 melibiose:sodium symporter; Provisional 91.69
PRK09848448 glucuronide transporter; Provisional 91.65
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 91.46
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 90.54
PRK03633 381 putative MFS family transporter protein; Provision 89.87
PRK09584500 tppB putative tripeptide transporter permease; Rev 89.61
PF10183105 ESSS: ESSS subunit of NADH:ubiquinone oxidoreducta 89.54
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 89.36
PRK10133 438 L-fucose transporter; Provisional 89.23
PRK10429473 melibiose:sodium symporter; Provisional 89.22
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 89.01
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 88.85
TIGR00895398 2A0115 benzoate transport. 88.14
KOG2532|consensus466 87.44
KOG2325|consensus 488 87.39
PRK15403413 multidrug efflux system protein MdtM; Provisional 86.98
PRK10473392 multidrug efflux system protein MdtL; Provisional 86.75
COG2807395 CynX Cyanate permease [Inorganic ion transport and 85.7
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 85.56
TIGR01272310 gluP glucose/galactose transporter. Disruption of 85.53
PRK11462460 putative transporter; Provisional 85.47
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 85.4
PRK11043401 putative transporter; Provisional 84.83
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 84.45
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 84.3
PRK10213394 nepI ribonucleoside transporter; Reviewed 83.54
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 83.52
PRK09669444 putative symporter YagG; Provisional 82.41
COG2270438 Permeases of the major facilitator superfamily [Ge 81.06
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 80.83
>KOG0569|consensus Back     alignment and domain information
Probab=99.65  E-value=1.4e-15  Score=99.28  Aligned_cols=78  Identities=31%  Similarity=0.447  Sum_probs=74.1

Q ss_pred             Cccc-hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHhccCCCCCHHHHHHHHhcC
Q psy7005           2 GNII-PKGRGIASGLVATVAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIELHFKQK   80 (88)
Q Consensus         2 ~E~~-~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~~~~~~~~~   80 (88)
                      +|+| +..|+.+++++...+|+.++++.+.+|++.+.+|. ..|.+|++.+++..++.++++||||||+.+|+.+.++++
T Consensus       394 aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~-~~filF~i~~~~~~i~~~~~lPETkgr~~~eI~~~~~~~  472 (485)
T KOG0569|consen  394 AELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGP-YVFILFVIPLAIFLIYLYRYLPETKGRTPYEIIEELEKR  472 (485)
T ss_pred             HHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc-hhhHHHHHHHHHHHHHHHHhCcccCCCCHHHHHHHHHhC
Confidence            7999 99999999999999999999999999999999996 799999999999999999999999999999998887655



>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF10183 ESSS: ESSS subunit of NADH:ubiquinone oxidoreductase (complex I) ; InterPro: IPR019329 NADH:ubiquinone oxidoreductase (complex I) (1 Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.78
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.21
2cfq_A417 Lactose permease; transport, transport mechanism, 98.1
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.88
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.87
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.82
2xut_A524 Proton/peptide symporter family protein; transport 97.49
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.44
2xut_A 524 Proton/peptide symporter family protein; transport 97.31
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 97.23
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 96.16
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 94.83
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 85.46
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.78  E-value=4.8e-19  Score=113.09  Aligned_cols=85  Identities=24%  Similarity=0.426  Sum_probs=69.9

Q ss_pred             Cccc-hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------hchHHHHHHHHHHHHHHHHHHHHHhccCCCCCHHHHH
Q psy7005           2 GNII-PKGRGIASGLVATVAYALAFATAKTFLDLHMR------IGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHEIE   74 (88)
Q Consensus         2 ~E~~-~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~~~   74 (88)
                      +|+| +++|++++|++.+.+|+++++.++++|.+.+.      .++.+.+++++++++++.++.++++|||||+++||+|
T Consensus       396 ~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLeei~  475 (491)
T 4gc0_A          396 SEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELE  475 (491)
T ss_dssp             HHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHHHHG
T ss_pred             HHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHHHHH
Confidence            6999 99999999999999999999999999987543      3445688999999999999999999999999999999


Q ss_pred             HHHhcCcchhhc
Q psy7005          75 LHFKQKKSKVVQ   86 (88)
Q Consensus        75 ~~~~~~~~~~~~   86 (88)
                      +.++++.+++++
T Consensus       476 ~~f~~~~~~~~~  487 (491)
T 4gc0_A          476 ALWEPETKKTQQ  487 (491)
T ss_dssp             GGTC--------
T ss_pred             HHhCCCCccccc
Confidence            999877665554



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.45
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.05
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.8
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 92.37
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
Probab=98.45  E-value=7e-07  Score=53.16  Aligned_cols=71  Identities=8%  Similarity=-0.017  Sum_probs=60.7

Q ss_pred             Cccc-hhhHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHhccCCCCCHHH
Q psy7005           2 GNII-PKGRGIASGLVAT-VAYALAFATAKTFLDLHMRIGLHGVFFLYGSCSVFGLIYLYIWLPETEGKTLHE   72 (88)
Q Consensus         2 ~E~~-~~~R~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~   72 (88)
                      +|.+ ++.|+++.++... .+.++..+.+.+.+.+.+..|++..+++.+++.++..++..+.+++++..+.++
T Consensus       338 ~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~G~l~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~r  410 (417)
T d1pv7a_         338 TSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLR  410 (417)
T ss_dssp             HHHSCGGGHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHSCCSSCTTHHH
T ss_pred             HHHCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHhhcCCCccchhH
Confidence            4678 8999999998654 566889999999999999999999999999999998888888888888777643



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure