Psyllid ID: psy7014
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 500 | 2.2.26 [Sep-21-2011] | |||||||
| A0A1F4 | 2176 | Protein eyes shut OS=Dros | yes | N/A | 0.612 | 0.140 | 0.436 | 6e-74 | |
| Q5T1H1 | 3165 | Protein eyes shut homolog | yes | N/A | 0.722 | 0.114 | 0.304 | 5e-36 | |
| Q5R6R1 | 472 | Protein eyes shut homolog | yes | N/A | 0.538 | 0.569 | 0.316 | 9e-32 | |
| P98160 | 4391 | Basement membrane-specifi | no | N/A | 0.678 | 0.077 | 0.255 | 1e-14 | |
| P31696 | 2081 | Agrin OS=Gallus gallus GN | no | N/A | 0.33 | 0.079 | 0.311 | 5e-14 | |
| A2ASQ1 | 1950 | Agrin OS=Mus musculus GN= | no | N/A | 0.414 | 0.106 | 0.275 | 6e-14 | |
| Q05793 | 3707 | Basement membrane-specifi | no | N/A | 0.45 | 0.060 | 0.265 | 2e-13 | |
| P25304 | 1959 | Agrin OS=Rattus norvegicu | yes | N/A | 0.44 | 0.112 | 0.258 | 3e-13 | |
| O00468 | 2067 | Agrin OS=Homo sapiens GN= | no | N/A | 0.414 | 0.100 | 0.261 | 1e-12 | |
| Q90404 | 1328 | Agrin (Fragment) OS=Diplo | N/A | N/A | 0.482 | 0.181 | 0.253 | 1e-12 |
| >sp|A0A1F4|EYS_DROME Protein eyes shut OS=Drosophila melanogaster GN=eys PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 278 bits (711), Expect = 6e-74, Method: Compositional matrix adjust.
Identities = 156/357 (43%), Positives = 205/357 (57%), Gaps = 51/357 (14%)
Query: 179 DFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAK--SKRGGYTVRVGKNGQQCWLM 236
D L +S Y+ T ++ GPRRIFT I + + R Y ++VG+ G+Q WL
Sbjct: 1410 DHLAVSFIQGYIMLTWNLGA----GPRRIFTQKPIDFRLDAPRVPYEIKVGRIGRQAWLS 1465
Query: 237 VDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAGN 296
VD N+T +SPG ++++ P+LYLGGH NF+ LPHDLPLHSGF GCI+DV+L AG
Sbjct: 1466 VDGKFNITGRSPGSGSRMDVLPILYLGGHEIANFNTLPHDLPLHSGFQGCIYDVQLKAGQ 1525
Query: 297 VGINLYKTRAAEGRGVGQCGTSQCHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRYN 356
V + L +TR GRGVGQCGT +CH H C H GAC+ HGATF+C+C +GW+GPLCA N
Sbjct: 1526 VTVPLQETRGVRGRGVGQCGTRECHRHACQHDGACLQHGATFTCICQEGWYGPLCAQPTN 1585
Query: 357 LCDSTRHNCSFGATCVPLTHSYECDCPPGRTGKFCEKD-ESLSDISFSGRRSY------- 408
CDS + C ATCVPL + YECDCP GRTGK CE+ SLSD+S +GRRSY
Sbjct: 1586 PCDSFNNKCYEDATCVPLVNGYECDCPVGRTGKNCEEVIRSLSDVSLTGRRSYLAVRWPY 1645
Query: 409 ------------------------------ISLPSSELHL-IINESLSDISFSGRRSYIS 437
I+ PSS + ++NE SFS S
Sbjct: 1646 LYDGGDKLGAKRSQMVSYRNFTKKLMPPKPITTPSSHFVMKLLNEVEKQRSFSPVPLMGS 1705
Query: 438 LPSSELH-LHEACIDLEIRPTKDKGLLMYFG-----HPQKNSMMTLSLQGGVLELRV 488
E H + I+ ++RP ++GLL+YFG +K ++LSLQGGV+E R+
Sbjct: 1706 KSFEEHHRVQFFFIEFQLRPLSERGLLLYFGTLNNNQDKKIGFVSLSLQGGVVEFRI 1762
|
Essential for the formation of matrix-filled interrhabdomeral space: critical for the formation of epithelial lumina in the retina. Acts together with prominin (prom) and the cell adhesion molecule chaoptin (chp) to choreograph the partitioning of rhabdomeres into an open system. Drosophila melanogaster (taxid: 7227) |
| >sp|Q5T1H1|EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens GN=EYS PE=1 SV=5 | Back alignment and function description |
|---|
| >sp|Q5R6R1|EYS_PONAB Protein eyes shut homolog (Fragment) OS=Pongo abelii GN=EYS PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P98160|PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q05793|PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus GN=Hspg2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 | Back alignment and function description |
|---|
| >sp|Q90404|AGRIN_DIPOM Agrin (Fragment) OS=Diplobatis ommata GN=AGRN PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 500 | ||||||
| 242007941 | 1628 | hypothetical protein Phum_PHUM150870 [Pe | 0.692 | 0.212 | 0.436 | 2e-98 | |
| 270006587 | 1499 | hypothetical protein TcasGA2_TC010461 [T | 0.696 | 0.232 | 0.419 | 4e-91 | |
| 158297335 | 1062 | AGAP007900-PA [Anopheles gambiae str. PE | 0.744 | 0.350 | 0.362 | 1e-77 | |
| 91094897 | 1322 | PREDICTED: similar to spacemaker [Tribol | 0.55 | 0.208 | 0.455 | 1e-77 | |
| 195147808 | 1150 | GL18721 [Drosophila persimilis] gi|19410 | 0.612 | 0.266 | 0.436 | 9e-74 | |
| 195387311 | 1855 | GJ17499 [Drosophila virilis] gi|19414879 | 0.612 | 0.164 | 0.436 | 2e-73 | |
| 195115060 | 1976 | GI14162 [Drosophila mojavensis] gi|19391 | 0.612 | 0.154 | 0.436 | 2e-73 | |
| 198474263 | 1169 | GA20207 [Drosophila pseudoobscura pseudo | 0.612 | 0.261 | 0.436 | 3e-73 | |
| 195052917 | 1870 | GH13093 [Drosophila grimshawi] gi|193900 | 0.612 | 0.163 | 0.436 | 7e-73 | |
| 195433705 | 2119 | GK15151 [Drosophila willistoni] gi|19416 | 0.612 | 0.144 | 0.431 | 1e-72 |
| >gi|242007941|ref|XP_002424773.1| hypothetical protein Phum_PHUM150870 [Pediculus humanus corporis] gi|212508296|gb|EEB12035.1| hypothetical protein Phum_PHUM150870 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 365 bits (938), Expect = 2e-98, Method: Compositional matrix adjust.
Identities = 190/435 (43%), Positives = 259/435 (59%), Gaps = 89/435 (20%)
Query: 56 FLPPDIEIGQASYSSSMSGLSSFSAYVIPANIHHCFELKFRFVPNSFDQIALLAFIGQDY 115
F I+I ++SS++GLSSF+AY IP I+ +L F+F+ + +QI+L+ F+GQD
Sbjct: 893 FCENSIDIEYPLFASSINGLSSFAAYKIPTEIYQDMQLTFKFIFHDIEQISLMLFMGQDG 952
Query: 116 QHDAITDHLAVSFIKGYVVLTWNLGSGWYLVYFEHTYLFILSRLRSAQDTRLCCLPLHLI 175
H + +DHLAVSFIKGY+VLTWNLGSG ++ H +
Sbjct: 953 YHGSTSDHLAVSFIKGYIVLTWNLGSGPRRIFTPHPVSY--------------------- 991
Query: 176 LGVDFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAKSKRGGYTVRVGKNGQQCWL 235
TGH+F +TV++G+ GQ+ WL
Sbjct: 992 -----------------TGHLF------------------------HTVQIGRAGQRAWL 1010
Query: 236 MVDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAG 295
+VD+ NVT KSPG+LTQLN + +LYLGGH S+NFS+LPHDLPLH+GF+GC+FDVE+ G
Sbjct: 1011 IVDDQRNVTGKSPGKLTQLNARSILYLGGHESRNFSLLPHDLPLHTGFTGCLFDVEIRTG 1070
Query: 296 NVGINLYKTRAAEGRGVGQCGTSQCHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRY 355
+ I + K++ RG+ QCGT+ C+ ++C +GG C++HGATF+CLC DGWFGP C+ +Y
Sbjct: 1071 QMLIKVDKSQPIFSRGISQCGTTMCNENSCENGGGCIDHGATFTCLCKDGWFGPTCSMKY 1130
Query: 356 NLCDSTRHNCSFGATCVPLTHSYECDCPPGRTGKFCEKDESLSDISFSGRRSYISLPSSE 415
N CD+TR NCS G+TCVPL + CDCP G+TGK+CEK E LSDI F G RSY+ L
Sbjct: 1131 NPCDTTRQNCSEGSTCVPLREGFFCDCPIGKTGKYCEKSEELSDIKFKGIRSYLGL---- 1186
Query: 416 LHLIINESLSDISFSGRRSYISLPSSELHLHEACIDLEIRPTKDKGLLMYFGHPQKNSMM 475
S G LH ++CI+LEIRP GL++Y G P+ S
Sbjct: 1187 ------------SVEG-----------LHQFQSCINLEIRPLSKHGLILYSGRPEGQSFW 1223
Query: 476 TLSLQGGVLELRVLM 490
+LSLQ G++ELR+ M
Sbjct: 1224 SLSLQDGMIELRISM 1238
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270006587|gb|EFA03035.1| hypothetical protein TcasGA2_TC010461 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158297335|ref|XP_317590.4| AGAP007900-PA [Anopheles gambiae str. PEST] gi|157015146|gb|EAA12862.4| AGAP007900-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|91094897|ref|XP_973282.1| PREDICTED: similar to spacemaker [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195147808|ref|XP_002014866.1| GL18721 [Drosophila persimilis] gi|194106819|gb|EDW28862.1| GL18721 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195387311|ref|XP_002052339.1| GJ17499 [Drosophila virilis] gi|194148796|gb|EDW64494.1| GJ17499 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195115060|ref|XP_002002085.1| GI14162 [Drosophila mojavensis] gi|193912660|gb|EDW11527.1| GI14162 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|198474263|ref|XP_001356624.2| GA20207 [Drosophila pseudoobscura pseudoobscura] gi|198138315|gb|EAL33688.2| GA20207 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195052917|ref|XP_001993395.1| GH13093 [Drosophila grimshawi] gi|193900454|gb|EDV99320.1| GH13093 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195433705|ref|XP_002064848.1| GK15151 [Drosophila willistoni] gi|194160933|gb|EDW75834.1| GK15151 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 500 | ||||||
| FB|FBgn0031414 | 2176 | eys "eyes shut" [Drosophila me | 0.458 | 0.105 | 0.529 | 3.3e-75 | |
| UNIPROTKB|Q5T1H1 | 3165 | EYS "Protein eyes shut homolog | 0.532 | 0.084 | 0.341 | 2.1e-38 | |
| UNIPROTKB|O00468 | 2067 | AGRN "Agrin" [Homo sapiens (ta | 0.412 | 0.099 | 0.278 | 1.2e-19 | |
| ZFIN|ZDB-GENE-030131-1033 | 2028 | agrn "agrin" [Danio rerio (tax | 0.464 | 0.114 | 0.277 | 2.6e-18 | |
| UNIPROTKB|F1NAT6 | 1213 | HSPG2 "Uncharacterized protein | 0.316 | 0.130 | 0.353 | 3.4e-18 | |
| UNIPROTKB|F1P3E3 | 1952 | AGRN "Agrin" [Gallus gallus (t | 0.366 | 0.093 | 0.316 | 4.6e-17 | |
| UNIPROTKB|F1NWQ6 | 1998 | AGRN "Agrin" [Gallus gallus (t | 0.366 | 0.091 | 0.316 | 4.9e-17 | |
| UNIPROTKB|F1LQ53 | 963 | Agrn "Agrin" [Rattus norvegicu | 0.412 | 0.213 | 0.292 | 5.9e-17 | |
| ZFIN|ZDB-GENE-080807-4 | 3422 | hspg2 "heparan sulfate proteog | 0.474 | 0.069 | 0.293 | 6.9e-17 | |
| MGI|MGI:87961 | 1950 | Agrn "agrin" [Mus musculus (ta | 0.412 | 0.105 | 0.296 | 4.6e-16 |
| FB|FBgn0031414 eys "eyes shut" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 691 (248.3 bits), Expect = 3.3e-75, Sum P(3) = 3.3e-75
Identities = 125/236 (52%), Positives = 161/236 (68%)
Query: 179 DFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAK--SKRGGYTVRVGKNGQQCWLM 236
D L +S Y+ T ++ GPRRIFT I + + R Y ++VG+ G+Q WL
Sbjct: 1410 DHLAVSFIQGYIMLTWNLGA----GPRRIFTQKPIDFRLDAPRVPYEIKVGRIGRQAWLS 1465
Query: 237 VDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAGN 296
VD N+T +SPG ++++ P+LYLGGH NF+ LPHDLPLHSGF GCI+DV+L AG
Sbjct: 1466 VDGKFNITGRSPGSGSRMDVLPILYLGGHEIANFNTLPHDLPLHSGFQGCIYDVQLKAGQ 1525
Query: 297 VGINLYKTRAAEGRGVGQCGTSQCHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRYN 356
V + L +TR GRGVGQCGT +CH H C H GAC+ HGATF+C+C +GW+GPLCA N
Sbjct: 1526 VTVPLQETRGVRGRGVGQCGTRECHRHACQHDGACLQHGATFTCICQEGWYGPLCAQPTN 1585
Query: 357 LCDSTRHNCSFGATCVPLTHSYECDCPPGRTGKFCEKD-ESLSDISFSGRRSYISL 411
CDS + C ATCVPL + YECDCP GRTGK CE+ SLSD+S +GRRSY+++
Sbjct: 1586 PCDSFNNKCYEDATCVPLVNGYECDCPVGRTGKNCEEVIRSLSDVSLTGRRSYLAV 1641
|
|
| UNIPROTKB|Q5T1H1 EYS "Protein eyes shut homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00468 AGRN "Agrin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAT6 HSPG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWQ6 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQ53 Agrn "Agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080807-4 hspg2 "heparan sulfate proteoglycan 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 500 | |||
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 1e-08 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 8e-08 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 5e-07 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 1e-06 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 2e-05 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 3e-05 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 5e-05 | |
| pfam00054 | 131 | pfam00054, Laminin_G_1, Laminin G domain | 6e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-04 | |
| pfam00008 | 32 | pfam00008, EGF, EGF-like domain | 2e-04 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 3e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.001 | |
| pfam00008 | 32 | pfam00008, EGF, EGF-like domain | 0.001 | |
| smart00181 | 35 | smart00181, EGF, Epidermal growth factor-like doma | 0.003 |
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
Score = 52.8 bits (127), Expect = 1e-08
Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
Query: 222 YTVRVGKNGQQCWLMVDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHS 281
+ V V ++G+ L VD V+ PG + LN LYLGG + LP+
Sbjct: 57 HRVSVSRDGRSLTLSVDGGTVVSEALPGSSSILNLNGPLYLGGLPEDSGL---SLLPVTE 113
Query: 282 GFSGCIFDVEL 292
GF GCI +V +
Sbjct: 114 GFVGCIRNVRV 124
|
This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily. Length = 124 |
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215652 pfam00008, EGF, EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|215652 pfam00008, EGF, EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 500 | |||
| KOG3514|consensus | 1591 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG3516|consensus | 1306 | 100.0 | ||
| KOG3514|consensus | 1591 | 99.97 | ||
| KOG3516|consensus | 1306 | 99.96 | ||
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 99.9 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 99.85 | |
| smart00282 | 135 | LamG Laminin G domain. | 99.85 | |
| KOG4289|consensus | 2531 | 99.83 | ||
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 99.77 | |
| KOG1219|consensus | 4289 | 99.33 | ||
| KOG3509|consensus | 964 | 99.13 | ||
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 98.4 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 98.32 | |
| smart00210 | 184 | TSPN Thrombospondin N-terminal -like domains. Hepa | 98.31 | |
| smart00282 | 135 | LamG Laminin G domain. | 98.13 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.84 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.75 | |
| PF13385 | 157 | Laminin_G_3: Concanavalin A-like lectin/glucanases | 97.68 | |
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 97.61 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.59 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.37 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.22 | |
| cd00152 | 201 | PTX Pentraxins are plasma proteins characterized b | 97.06 | |
| smart00159 | 206 | PTX Pentraxin / C-reactive protein / pentaxin fami | 97.02 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.01 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.87 | |
| PF02973 | 190 | Sialidase: Sialidase, N-terminal domain; InterPro: | 96.82 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 96.8 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.7 | |
| KOG1225|consensus | 525 | 96.58 | ||
| KOG1214|consensus | 1289 | 96.55 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.47 | |
| KOG1214|consensus | 1289 | 96.42 | ||
| KOG1217|consensus | 487 | 96.35 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.33 | |
| KOG4260|consensus | 350 | 96.01 | ||
| KOG1225|consensus | 525 | 96.0 | ||
| KOG1217|consensus | 487 | 95.89 | ||
| PF00354 | 195 | Pentaxin: Pentaxin family; InterPro: IPR001759 Pen | 95.34 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.23 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 95.22 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.21 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.18 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 94.07 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 93.75 | |
| KOG1226|consensus | 783 | 92.33 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 92.05 | |
| PF06439 | 185 | DUF1080: Domain of Unknown Function (DUF1080); Int | 90.83 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 90.82 | |
| smart00051 | 63 | DSL delta serrate ligand. | 90.82 | |
| smart00560 | 133 | LamGL LamG-like jellyroll fold domain. | 90.79 | |
| KOG3509|consensus | 964 | 90.35 | ||
| KOG1226|consensus | 783 | 89.44 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 88.66 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 88.47 | |
| KOG4260|consensus | 350 | 87.76 | ||
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 87.52 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 86.51 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 85.63 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 85.43 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 84.72 |
| >KOG3514|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-37 Score=331.75 Aligned_cols=344 Identities=21% Similarity=0.367 Sum_probs=246.6
Q ss_pred cccccccCCCCCCCCccee--cc--ccccc-cCCeeeeecccc-----cCCCc-eeecCCC--------CCCC---CCCC
Q psy7014 2 YAHHLQSCPELTNPDNIKI--LG--RHRQE-ENDRIVNFQHYF-----DTNQP-INQLLSI--------IFTN---FLPP 59 (500)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~--~~--~~~~~-~~~~~~~~~~~~-----~~~~~-~c~c~~~--------~~G~---~C~~ 59 (500)
|.+|+|++||||++.|... +| .|... +..| |.|-.|. +++.. +-.-... ..|. .|+.
T Consensus 356 ~t~~~~~a~~~tmlsss~~fyvgg~~~~~~l~gsr-VsF~GClkkV~y~~d~~rl~L~~LAk~g~~~~k~~G~l~y~C~n 434 (1591)
T KOG3514|consen 356 RTEIRQYAPELTMLSSSDFFYVGGSPNTADLPGSR-VSFMGCLKKVVYKNDDTRLELSRLAKQGDSKMKTEGDLSYSCEN 434 (1591)
T ss_pred EecccccccceeEeeccceEEecCCCCccccCCCc-eeeeeeeeeeEeccCceeehhhHHhhcCCceeEeeceEEEecCC
Confidence 7899999999999999984 44 33333 3334 3577762 33321 1111111 2222 4888
Q ss_pred CCccccccccCCCCCCcceEEeecCCCCceEEEEEEEEeeCCCCCceEEEEecccCCCCCCCCeEEEEEECCEEEEEEEc
Q psy7014 60 DIEIGQASYSSSMSGLSSFSAYVIPANIHHCFELKFRFVPNSFDQIALLAFIGQDYQHDAITDHLAVSFIKGYVVLTWNL 139 (500)
Q Consensus 60 ~~~~~~~~f~g~~~~~~sy~~~~~~~~~~~~~~i~~~Frt~~~~~~GlLly~~~~~~~~~~~df~~l~l~~G~l~~~~~~ 139 (500)
.......+|... .||+.+|.+. .....+|+|.|||+.++ |||||++.. .....||+|+||.||++.+.+++
T Consensus 435 ~~~~DpvtFtt~----es~l~LP~Wn-t~~~gSiSf~FRTtepn--Glil~~~g~--~~~~~d~~A~ELldghlyl~ldl 505 (1591)
T KOG3514|consen 435 VAQLDPVTFTTP----ESYLTLPRWN-TKKSGSISFDFRTTEPN--GLILFHGGP--QANATDYFAIELLDGHLYLLLDL 505 (1591)
T ss_pred CCccCceeeecc----cceeeccccc-cCCcceeEEEEeecCCC--ceEEEccCc--ccccccEEEEEEeCCeEEEEEec
Confidence 776666789876 8999999964 56789999999988777 999999752 45778999999999999999999
Q ss_pred CCceeEEEeechhhhhhhhhccccccccccccccccccccceeeeecccccCCCCcccccccCCceEEecCceeeeCCCC
Q psy7014 140 GSGWYLVYFEHTYLFILSRLRSAQDTRLCCLPLHLILGVDFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAKSKR 219 (500)
Q Consensus 140 G~g~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~~~dg~ 219 (500)
|+|... | +. ...++|||.
T Consensus 506 GSG~ik-------------l------------------------------------------------ra-s~rkv~DGe 523 (1591)
T KOG3514|consen 506 GSGVIK-------------L------------------------------------------------RA-SSRKVNDGE 523 (1591)
T ss_pred CCceEE-------------e------------------------------------------------ee-ecccccCCc
Confidence 997542 2 21 122669999
Q ss_pred ccEEEEEEEeCcEEEEEEcCCcceeeeCCCccccccCCCceEEcccccccCcCCCCC---cCCCCCccccccceeecccc
Q psy7014 220 GGYTVRVGKNGQQCWLMVDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHD---LPLHSGFSGCIFDVELSAGN 296 (500)
Q Consensus 220 WwH~V~v~r~~~~~~L~VD~~~~~~~~~~~~~~~L~~~~~lyIGG~~~~~~~~~~~~---~~~~~gF~GCIr~v~ing~~ 296 (500)
| |+|.+.|+++.+.++||... .....||....|+++.++|+|-.+ +....|.+ +..+.||+||||++.|+|..
T Consensus 524 W-hhv~l~R~gR~gsvsVd~~~-~df~tpG~s~iL~ld~~mylG~~~--n~l~~P~~vWta~L~~GyvGCirdl~i~G~s 599 (1591)
T KOG3514|consen 524 W-HHVDLQRDGRTGSVSVDAIK-TDFSTPGDSEILDLDDPMYLGEVP--NNLVYPSEVWTAALRKGYVGCIRDLFIDGVS 599 (1591)
T ss_pred e-EEEEeeccCccceEEEeeee-cCccCCCcceeEeecCceeeccCC--CCccCcHHHHHHHHhccchheehhheeccee
Confidence 9 99999999999999999976 567778999999999999999553 33344433 45778999999999999999
Q ss_pred cccccccccccCCCCcc-ccCC---ccCCCCCCCCCCEEeeCCCceeecCCCCCCCcccccccccccCCCccCCCCCEEe
Q psy7014 297 VGINLYKTRAAEGRGVG-QCGT---SQCHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRYNLCDSTRHNCSFGATCV 372 (500)
Q Consensus 297 ~~l~~~~~~~~~~~~v~-~C~~---~~C~~~pC~ngg~Ci~~~~~~~C~C~~Gy~G~~C~~~i~~C~~~p~pC~ngg~C~ 372 (500)
.++..... ...+.++. .|.. ..|.++||+|+|+|...|+.
T Consensus 600 ~di~q~ae-~q~sagvkpsCs~~~~~~C~~nPC~N~g~C~egwNr----------------------------------- 643 (1591)
T KOG3514|consen 600 TDIRQEAE-AQNSAGVKPSCSLSNEKICESNPCQNGGKCSEGWNR----------------------------------- 643 (1591)
T ss_pred hhhHHHhh-hccccccCcccchhhccccCCCcccCCCCccccccc-----------------------------------
Confidence 88754321 22333343 3431 34555555555555555544
Q ss_pred eCCCCeeeeCCC-CCCCCCcCCCCCCcCccccCCCceEEecCCCccccccccccccccccccccccCCccccccceeeEE
Q psy7014 373 PLTHSYECDCPP-GRTGKFCEKDESLSDISFSGRRSYISLPSSELHLIINESLSDISFSGRRSYISLPSSELHLHEACID 451 (500)
Q Consensus 373 ~~~~g~~C~C~~-G~~G~~Ce~~~~~~~~~F~g~~sy~~~~~~~~~~~~~e~~~~~~f~~~~~~~~~p~~~~~~~~~~i~ 451 (500)
|.|+|.. +|.|+.||.+. ..+.|+|. .|+.+-.+.. . ..+.+.|.
T Consensus 644 -----fiCDCs~T~~~G~~CerE~--t~ls~nGs-~~m~i~L~~~-------------------------~-~tq~E~v~ 689 (1591)
T KOG3514|consen 644 -----FICDCSGTGFEGRTCEREA--TALSYNGS-MSMKIVLPHT-------------------------M-HTQAEDVS 689 (1591)
T ss_pred -----cccccccCcccCcccccee--eeEEEcCe-eeEEEEeccc-------------------------c-eeecceEE
Confidence 5555543 56666666543 45789996 5655543311 1 12677999
Q ss_pred EEEeeCCCCcEEEEcCCCCCCCeEEEEEECCEEEEEEEcC
Q psy7014 452 LEIRPTKDKGLLMYFGHPQKNSMMTLSLQGGVLELRVLML 491 (500)
Q Consensus 452 l~frT~~~~GlLl~~~~~~~~dfi~l~l~~G~l~~~~~~g 491 (500)
++|||..+-||||-.+.....|-+.|+|.+|+|++.+++.
T Consensus 690 iRF~t~r~~Gll~~Tta~~s~D~l~l~L~~g~vkl~v~ls 729 (1591)
T KOG3514|consen 690 IRFRTQRAYGLLFATTARGSADTLRLELDAGQVKLFVNLS 729 (1591)
T ss_pred EEEEecccceeEEEeccCCCCceEEEEEecceEEEEEecC
Confidence 9999999999999998887899999999999999999976
|
|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >smart00210 TSPN Thrombospondin N-terminal -like domains | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity | Back alignment and domain information |
|---|
| >smart00159 PTX Pentraxin / C-reactive protein / pentaxin family | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >smart00560 LamGL LamG-like jellyroll fold domain | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 500 | ||||
| 3r05_A | 1254 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 2e-05 | ||
| 3qcw_A | 1245 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 2e-05 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 3e-05 | ||
| 3asi_A | 410 | Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns | 4e-05 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 4e-05 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 1e-04 |
| >pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 | Back alignment and structure |
|
| >pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 | Back alignment and structure |
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|3ASI|A Chain A, Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns6 Length = 410 | Back alignment and structure |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
Score = 82.3 bits (204), Expect = 5e-19
Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
Query: 320 CHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRYNLCDSTRHNCSFGATCVPLTHSYE 379
C ++ C + C++ F C+C G+ G C + C S C C+ + ++
Sbjct: 48 CVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECAS--SPCLHNGRCLDKINEFQ 105
Query: 380 CDCPPGRTGKFCEKD 394
C+CP G TG C+ D
Sbjct: 106 CECPTGFTGHLCQVD 120
|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 500 | |||
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 100.0 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 100.0 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 100.0 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 100.0 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.98 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.97 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.97 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.96 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.94 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.94 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.93 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.92 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.92 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.92 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.91 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.9 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.9 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.9 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.89 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.86 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.83 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.81 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.69 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.3 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.27 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.24 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.22 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.17 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.13 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.1 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.05 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.03 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.94 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.93 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.91 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.91 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.88 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.84 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 98.83 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.83 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.8 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.76 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.74 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 98.74 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 98.73 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 98.71 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 98.7 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 98.68 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.66 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.65 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 98.63 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 98.62 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 98.61 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.61 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.59 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 98.55 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 98.54 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.54 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.49 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.46 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.43 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.39 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.39 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.37 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.36 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.34 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.24 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.2 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.18 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.17 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.16 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.14 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.13 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.1 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.1 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.08 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.04 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.04 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.03 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.02 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.01 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.96 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.81 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.8 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.73 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.71 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 97.68 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.64 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.63 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.63 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.62 | |
| 1za4_A | 251 | Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel | 97.59 | |
| 2erf_A | 209 | Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug | 97.58 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.58 | |
| 2v73_A | 191 | CBM40, putative EXO-alpha-sialidase; carbohydrate- | 97.57 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.57 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.56 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.53 | |
| 3flp_A | 217 | SAP-like pentraxin; physiological doubly-stacked h | 97.48 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.46 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.42 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.42 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.39 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.39 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.34 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.32 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.29 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.25 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.25 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.23 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.22 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.19 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.13 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.12 | |
| 3kqr_A | 204 | Serum amyloid P-component; glycoprotein, disulfide | 97.12 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.06 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.06 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 97.0 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.98 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.96 | |
| 3pvn_A | 206 | C-reactive protein; pentraxin family, immune syste | 96.81 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.8 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 96.78 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.75 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.74 | |
| 2uur_A | 245 | Collagen alpha-1(IX) chain; glycoprotein, hydroxyl | 96.67 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.61 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 96.6 | |
| 4dqa_A | 355 | Uncharacterized protein; two domains structure, DU | 96.1 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.06 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 95.85 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 95.83 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 95.75 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 95.72 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 95.7 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 95.69 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 95.64 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.64 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 95.61 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.58 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 95.57 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 95.57 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 95.57 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.49 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 95.41 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 95.37 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 95.2 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.89 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 94.7 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 94.7 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 94.62 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 94.56 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 94.16 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 93.87 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 93.47 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 93.41 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 93.34 | |
| 2sli_A | 679 | Intramolecular trans-sialidase; hydrolase, neurami | 93.09 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 92.8 | |
| 2jkb_A | 686 | Sialidase B; intramolecular trans-sialidase, lyase | 92.76 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 91.89 | |
| 4b1m_A | 185 | Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil | 91.77 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 90.95 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 90.68 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 90.61 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 89.71 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 87.47 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 87.17 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 85.35 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 84.74 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 84.5 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 84.5 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 83.57 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 83.5 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 81.73 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 80.16 |
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-39 Score=339.36 Aligned_cols=287 Identities=18% Similarity=0.340 Sum_probs=205.5
Q ss_pred ccccCCCCCCcceEEeecCCCCceEEEEEEEEeeCCCCCceEEEEecccCCCCCCCCeEEEEEECCEEEEEEEcCCceeE
Q psy7014 66 ASYSSSMSGLSSFSAYVIPANIHHCFELKFRFVPNSFDQIALLAFIGQDYQHDAITDHLAVSFIKGYVVLTWNLGSGWYL 145 (500)
Q Consensus 66 ~~f~g~~~~~~sy~~~~~~~~~~~~~~i~~~Frt~~~~~~GlLly~~~~~~~~~~~df~~l~l~~G~l~~~~~~G~g~~~ 145 (500)
.+|.+. +||++|+.... ...++|+|+|||+.++ |||||.+. ...||++|+|++|+|+++|++|+|..
T Consensus 8 v~F~~~----~Syl~~p~~~~-~~~~~is~~frT~~~~--GlLly~~~-----~~~dfi~l~L~~G~l~~~~~~G~g~~- 74 (410)
T 3asi_A 8 VTFKTK----SSYVALATLQA-YTSMHLFFQFKTTSLD--GLILYNSG-----DGNDFIVVELVKGYLHYVFDLGNGAN- 74 (410)
T ss_dssp EEECST----TCEEEESCCCC-SSCEEEEEEEECSCSC--EEEEEEEB-----STTCEEEEEEETTEEEEEEESSSCEE-
T ss_pred cEeCCC----CeeEEeCCCCC-CceEEEEEEEEeCCCC--eEEEEeCC-----CCCCEEEEEEECCEEEEEEECCCCcE-
Confidence 478643 79999998653 4679999999999777 99999863 24699999999999999999999543
Q ss_pred EEeechhhhhhhhhccccccccccccccccccccceeeeecccccCCCCcccccccCCceEEecCceeeeCCCCccEEEE
Q psy7014 146 VYFEHTYLFILSRLRSAQDTRLCCLPLHLILGVDFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAKSKRGGYTVR 225 (500)
Q Consensus 146 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~~~dg~WwH~V~ 225 (500)
.++......++||+| |+|.
T Consensus 75 ------------------------------------------------------------~~~~~s~~~vnDg~W-H~V~ 93 (410)
T 3asi_A 75 ------------------------------------------------------------LIKGSSNKPLNDNQW-HNVM 93 (410)
T ss_dssp ------------------------------------------------------------EEECCCSSCSCSSSC-EEEE
T ss_pred ------------------------------------------------------------EEEeccCcEeCCCCe-EEEE
Confidence 333223346789999 9999
Q ss_pred EEEeCcE-EEEEEcCCcceeeeCCCccccccCCCceEEcccccccCcCCCCCcCCCCCccccccceeecccccccccccc
Q psy7014 226 VGKNGQQ-CWLMVDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAGNVGINLYKT 304 (500)
Q Consensus 226 v~r~~~~-~~L~VD~~~~~~~~~~~~~~~L~~~~~lyIGG~~~~~~~~~~~~~~~~~gF~GCIr~v~ing~~~~l~~~~~ 304 (500)
|.|.++. +.|+||+..... ..++ ...|++..+|||||+|......++.......+|.|||+++.+|++.+++.....
T Consensus 94 v~r~~~~~~~l~VD~~~~~~-~~~~-~~~l~~~~~lyvGG~p~~~~~~~~~~~~~~~~F~GCi~~l~ing~~~dl~~~~~ 171 (410)
T 3asi_A 94 ISRDTSNLHTVKIDTKITTQ-ITAG-ARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDAL 171 (410)
T ss_dssp EEECTTCEEEEEETTEEEEE-ECTT-CCCCCBCSCEEESCCCGGGGGGSCTTCCCSSBCCEEEEEEESSSCCCCTTTTCS
T ss_pred EEEcCCceEEEEECCEecee-ccCC-ccceecCCceEECccccchhhhhhhhcccccCchhheeheeeCCcccCchhhhh
Confidence 9999875 899999976333 3333 357888889999999875444455444556789999999999998766532110
Q ss_pred cccCCCCc-cccCCccCCCCCCCCCCEEeeCCCceeecCCCCCCCcccccccccccCCCccCCCCCEEeeCCCCeeeeCC
Q psy7014 305 RAAEGRGV-GQCGTSQCHNHTCSHGGACMNHGATFSCLCADGWFGPLCASRYNLCDSTRHNCSFGATCVPLTHSYECDCP 383 (500)
Q Consensus 305 ~~~~~~~v-~~C~~~~C~~~pC~ngg~Ci~~~~~~~C~C~~Gy~G~~C~~~i~~C~~~p~pC~ngg~C~~~~~g~~C~C~ 383 (500)
....++ ..|. ...+.|.+ +||.|+|+|++.+.+|.|.|+
T Consensus 172 --~~~~~v~~gC~------------------------------------~~~~~C~~--~pC~n~g~C~~~~~~~~C~C~ 211 (410)
T 3asi_A 172 --FCNGQIERGCE------------------------------------GPSTTCQE--DSCSNQGVCLQQWDGFSCDCS 211 (410)
T ss_dssp --EEESSEEESCC------------------------------------CCSSCCCT--TSSSTTCEEEECSSSEEEECT
T ss_pred --ccCCccCCCCC------------------------------------CCCCCccc--ccCCCCCEecCCCCCceEecc
Confidence 000111 1232 12234444 267777777777777888887
Q ss_pred C-CCCCCCcCCCCCCcCccccCCCceEEecCCCccccccccccccccccccccccCCccccccceeeEEEEEeeCCCCcE
Q psy7014 384 P-GRTGKFCEKDESLSDISFSGRRSYISLPSSELHLIINESLSDISFSGRRSYISLPSSELHLHEACIDLEIRPTKDKGL 462 (500)
Q Consensus 384 ~-G~~G~~Ce~~~~~~~~~F~g~~sy~~~~~~~~~~~~~e~~~~~~f~~~~~~~~~p~~~~~~~~~~i~l~frT~~~~Gl 462 (500)
. +|+|+.|+.... ...|...++|+.+..+... ........|+|.|||++++|+
T Consensus 212 ~~~~~G~~C~~~~~--~~~f~~~~~~~~~~~~~~~------------------------~~~~~~~~i~l~frT~~~~Gl 265 (410)
T 3asi_A 212 MTSFSGPLCNDPGT--TYIFSKGGGQITYKWPPND------------------------RPSTRADRLAIGFSTVQKEAV 265 (410)
T ss_dssp TTSEESTTSCEECC--EEEEEEEEEEEEEECCTTC------------------------CCCBSEEEEEEEEECCCSEEE
T ss_pred CCcccCCCCCCCcc--cccccCCCceEEEecCCCC------------------------CccceeeEEEEEEEeCCCCEE
Confidence 5 788888876532 2446433588877533211 011134589999999999999
Q ss_pred EEEcCCCC-CCCeEEEEEECCEEEEEEEcCCCC
Q psy7014 463 LMYFGHPQ-KNSMMTLSLQGGVLELRVLMLGDR 494 (500)
Q Consensus 463 Ll~~~~~~-~~dfi~l~l~~G~l~~~~~~g~~~ 494 (500)
|||.+... ..||++|+|++|+|+++|++|++.
T Consensus 266 Ll~~~~~~~~~~~l~l~L~~G~l~~~~~~g~~~ 298 (410)
T 3asi_A 266 LVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD 298 (410)
T ss_dssp EEEEEECTTCCCEEEEEEETTEEEEEEESSSSC
T ss_pred EEEEecCCCCCceEEEEEeCCEEEEEEECCCCc
Confidence 99986542 479999999999999999999864
|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A | Back alignment and structure |
|---|
| >2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 500 | ||||
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 2e-10 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 5e-09 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 6e-06 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 2e-08 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 1e-07 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 1e-06 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 2e-07 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 3e-04 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 3e-07 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 2e-06 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 3e-07 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 1e-06 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 3e-07 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 2e-06 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 6e-07 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 2e-06 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 7e-07 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 1e-06 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 1e-06 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 3e-06 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 7e-06 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 6e-04 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 2e-05 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 0.001 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 4e-05 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 0.001 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 5e-05 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 2e-04 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 6e-05 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 4e-04 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 9e-05 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 4e-04 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 2e-04 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 0.001 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 2e-04 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 3e-04 | |
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 3e-04 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 4e-04 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 7e-04 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 0.004 |
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Agrin species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 58.4 bits (140), Expect = 2e-10
Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 11/137 (8%)
Query: 179 DFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAKSKRGGYTVRVGKNGQQCWLMVD 238
D++ ++I ++Q M D P + + I+ ++ + ++ L V
Sbjct: 70 DYIALAIVDGFVQ----MMYDLGSKPVVLRSTVPINTNHW---THIKAYRVQREGSLQVG 122
Query: 239 NMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAGNVG 298
N +T SP TQL+T L+LGG + +GF GCI DV +
Sbjct: 123 NEAPITGSSPLGATQLDTDGALWLGG-MERLSVAHKLPKAYSTGFIGCIRDVIVD--RQE 179
Query: 299 INLYKTRAAEGRGVGQC 315
++L + A + C
Sbjct: 180 LHLVE-DALNNPTILHC 195
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 500 | |||
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.93 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.93 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.91 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.89 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 99.87 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 99.87 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.81 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.01 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.79 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.76 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.75 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.74 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.71 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.7 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.68 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 98.67 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.67 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.65 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.65 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.64 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 98.63 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.63 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.6 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 98.58 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.54 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 98.51 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.5 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.49 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.47 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.46 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.44 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.4 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.39 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.34 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.33 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.33 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.33 | |
| d2erfa1 | 206 | Thrombospondin 1 N-terminal domain {Human (Homo sa | 98.0 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.0 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.93 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.9 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.8 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.79 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.69 | |
| d1b09a_ | 206 | C-reactive protein (CRP) {Human (Homo sapiens) [Ta | 97.47 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.39 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.26 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 97.22 | |
| d1saca_ | 204 | Serum amyloid P component (SAP) {Human (Homo sapie | 97.2 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.06 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.02 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.97 | |
| d2slia1 | 196 | Leech intramolecular trans-sialidase, N-terminal d | 96.9 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.88 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.88 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 96.81 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.72 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 96.59 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 96.36 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 96.23 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 96.22 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 96.22 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.21 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.0 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 95.86 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 95.79 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 95.51 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 95.37 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.31 | |
| d3btaa1 | 207 | Botulinum neurotoxin {Clostridium botulinum, serot | 95.25 | |
| d1epwa1 | 218 | Botulinum neurotoxin {Clostridium botulinum, serot | 95.02 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 94.76 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 94.1 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.88 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 93.83 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.95 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.8 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 92.75 | |
| d1a8da1 | 247 | Tetanus neurotoxin {Clostridium tetani [TaxId: 151 | 92.6 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 92.57 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.36 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.14 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 91.78 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 90.86 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 90.53 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 89.97 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 89.97 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 89.68 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 88.37 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 86.26 | |
| d1oq1a_ | 223 | Hypothetical protein YesU {Bacillus subtilis [TaxI | 86.16 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 85.59 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 82.98 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 82.88 |
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Laminin alpha2 chain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93 E-value=5.7e-25 Score=204.49 Aligned_cols=160 Identities=18% Similarity=0.326 Sum_probs=124.3
Q ss_pred cccccCCCCCCcceEEeecCC-CCceEEEEEEEEeeCCCCCceEEEEecccCCCCCCCCeEEEEEECCEEEEEEEcCCce
Q psy7014 65 QASYSSSMSGLSSFSAYVIPA-NIHHCFELKFRFVPNSFDQIALLAFIGQDYQHDAITDHLAVSFIKGYVVLTWNLGSGW 143 (500)
Q Consensus 65 ~~~f~g~~~~~~sy~~~~~~~-~~~~~~~i~~~Frt~~~~~~GlLly~~~~~~~~~~~df~~l~l~~G~l~~~~~~G~g~ 143 (500)
...|..+. +||+.++... ....+++|+|+|||+.++ |||||.++. ...||++|+|++|+|+++|++|++.
T Consensus 16 ~~~fg~s~---~s~~~~~~~~~~~~~~~~i~~~frT~~~~--GlL~~~~~~----~~~dfi~l~l~~G~l~~~~~~g~~~ 86 (189)
T d1dyka1 16 SKQFGLSR---NSHIAIAFDDTKVKNRLTIELEVRTEAES--GLLFYMARI----NHADFATVQLRNGFPYFSYDLGSGD 86 (189)
T ss_dssp CEECCSST---TCEEEEECCGGGGSSEEEEEEEEEECCSC--EEEEEEECT----TSSSEEEEEEETTEEEEEEESSSCE
T ss_pred ceecCCCC---CceEEEecCcccccccEEEEEEEEECCCC--EEEEEEcCC----CCCcEEEEEEECCEEEEEEECCCcc
Confidence 44664432 7999998544 355789999999999777 999999743 4569999999999999999999853
Q ss_pred eEEEeechhhhhhhhhccccccccccccccccccccceeeeecccccCCCCcccccccCCceEEecCceeeeCCCCccEE
Q psy7014 144 YLVYFEHTYLFILSRLRSAQDTRLCCLPLHLILGVDFLCMSIYTSYLQPTGHMFVDTYRGPRRIFTPNTISAKSKRGGYT 223 (500)
Q Consensus 144 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~~~dg~WwH~ 223 (500)
..+.+.. .++||+| |+
T Consensus 87 -------------------------------------------------------------~~~~~~~--~v~Dg~W-H~ 102 (189)
T d1dyka1 87 -------------------------------------------------------------TSTMIPT--KINDGQW-HK 102 (189)
T ss_dssp -------------------------------------------------------------EEEECCS--CCCSSSC-EE
T ss_pred -------------------------------------------------------------EEecCCc--EeeCCCE-EE
Confidence 2333333 5689999 99
Q ss_pred EEEEEeCcEEEEEEcCCcceeeeCCCccccccCCCceEEcccccccCcCCCCCcCCCCCccccccceeecccccccc
Q psy7014 224 VRVGKNGQQCWLMVDNMGNVTSKSPGRLTQLNTKPMLYLGGHFSKNFSILPHDLPLHSGFSGCIFDVELSAGNVGIN 300 (500)
Q Consensus 224 V~v~r~~~~~~L~VD~~~~~~~~~~~~~~~L~~~~~lyIGG~~~~~~~~~~~~~~~~~gF~GCIr~v~ing~~~~l~ 300 (500)
|.|.|.++.++|.||+... ....++....+++...|||||+|..... ........+|.|||++|+||++.+++.
T Consensus 103 V~v~~~~~~~~l~VD~~~~-~~~~~~~~~~l~~~~~lyiGG~p~~~~~--~~~~~~~~~F~GCi~~v~in~~~~~L~ 176 (189)
T d1dyka1 103 IKIVRVKQEGILYVDDASS-QTISPKKADILDVVGILYVGGLPINYTT--RRIGPVTYSLDGCVRNLHMEQAPVDLD 176 (189)
T ss_dssp EEEEEETTEEEEEETTEEE-EEECSTTCCCCCCCSEEEESSCCTTCCC--CSSCSCCSBCSEEEEEEEESSSCCCTT
T ss_pred EEEEEcccEEEEEECCcce-eeEccCcccccccccceEEecccccccc--cccCcCCCCcEEEEeEEEECCEEecCC
Confidence 9999999999999999764 4455666677888889999999754322 222345578999999999999888763
|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|