Psyllid ID: psy7039


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MDHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVKTGSLMTSKT
ccccEEEEccccccccccccEEEcccccEEEEEEccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEcccccccEEEEEEEEEccccccccccccccEEEcccccccccccccccEEEEEcccEEEEEEEEccccccccccccccEEEEcccEEEEEEcccccccccccccEEEEcccEEEEEEcccEEEEEEcccccccccEEEEEEEccccEEEEcEEcccccccccccccccEEEEEEEEEccccccccccEEEcccccEEEEEEcccEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEccccccccccEEEEEccccEEEEEcccccccccccccccEEEEccccccEEEEcccEEEEEEEEEEEcccEEEEEEccEEccccccEEEEEcccEEEEEEccccccccccEEEEEEEcccccEEEEEEEEEEccccccccccEEEEEcccEEEEEEEccccccccccccEEEEEEEccccccEEEEcccEEEEccEEEccc
ccccEEEEccccccccccccEEEEccccEEEEEEcccccccccccEEEEEEEEcccccEEEEEEcccccEEEEEcccccccEEEEEEEEEEcccccccccccccEEEccccccccccccccccEEEEcccEEEEEEcccccccccccccEEEEccccEEEEEEEEccccccEEEEEccEEEcccccEEEEEEccEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEcccccccccccccEEEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccccEEEEEEcccEEEEEEccccccccccccccEEEEEccccccEEEEcccEEEEEEEEEcccccEEEEEEccEEEccccEEEEEEcccEEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccccEEEEEEcccEEEEEEcccccccccccEEEEEEEEccccccEEEEEEccEEEEcccEcccc
mdhsvliknpfdepgkptdleatdwdkdhvdlqwtppisdggspitGYVVEMkdktgnwekavvvpagetsctvpgliegeTYQFQVRAVnaagpgeaskptapivakpknlapridrstlndvkikagqsfsfdvkefrelsytksplralgvranstkgwvklsepflnhgwsingqvcqiggradvqttksetvldipfcsrsdtghysltlennlgtatasahvtgteftdnnvhegKAYEYRVSAVnaagtekpkiSLDALIGKRIKEFVTSTTaslniknsvrkdsgiykieakndygidmaDIEVVVvskpgpptgpidyttvtpesvsmswkppvddggtpitgapkitsdlsirdmtvlageeftitvpfsgrpkptpiwtvngdevspdgrikfetsenqtiyrnksakratdsgsYTIQLVNTvgsdsasckvyvvdkpsppqgpldvsditpescslswkpplddggspitNYVVEKyesatgvsdlfisksevktgslmtskt
mdhsvliknpfdepgkpTDLEATDWDKDHVDLQwtppisdggspITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAgpgeaskptapivakpknlapridrstlndvkikagqsfsfdvkefrelsytksplralgvransTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAvnaagtekpkislDALIGKRIKEFVtsttaslniknsvrkdsgiykieakndygidmADIEVVVVSKPGPPTGPIDYTTVTPESVSMSwkppvddggtpitgapkitsdlSIRDMTVLAGEEftitvpfsgrpkptpiwtvngdevspdgrikfetsenqtiyrnksakratdsgsYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYEsatgvsdlfisksevktgslmtskt
MDHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVKTGSLMTSKT
************************WDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVN******************************NDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSK*********Y****************************ITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVN**********************************YTIQLVNTVGSDSASCKVYVV*********************************PITNYVVEKYESATGVSDLFI***************
MDHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASA*V*G*****NNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSW*********PITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVKTGSLMTS**
MDHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRN********SGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVK*********
*DHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVKTGSLM****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEFTDNNVHEGKAYEYRVSAVNAAGTEKPKISLDALIGKRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYESATGVSDLFISKSEVKTGSLMTSKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query516 2.2.26 [Sep-21-2011]
Q23551 7158 Twitchin OS=Caenorhabditi yes N/A 0.947 0.068 0.333 9e-68
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.903 0.013 0.292 4e-44
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.903 0.013 0.287 2e-42
P16419 1132 Myosin-binding protein C, no N/A 0.5 0.227 0.272 8e-18
Q00872 1141 Myosin-binding protein C, no N/A 0.554 0.250 0.267 2e-16
Q14324 1141 Myosin-binding protein C, no N/A 0.257 0.116 0.366 1e-15
Q8N9C0 903 Immunoglobulin superfamil no N/A 0.282 0.161 0.317 1e-15
Q5XKE0 1136 Myosin-binding protein C, no N/A 0.257 0.117 0.373 2e-15
Q14896 1274 Myosin-binding protein C, no N/A 0.259 0.105 0.315 3e-15
Q90688 1272 Myosin-binding protein C, no N/A 0.238 0.096 0.307 3e-15
>sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 Back     alignment and function desciption
 Score =  258 bits (659), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 183/548 (33%), Positives = 270/548 (49%), Gaps = 59/548 (10%)

Query: 5    VLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEKAVV 64
            +L KNPFD P +P   E TDWD DHVDL+W PP+SDGG+PI  Y +E + K G WE A+ 
Sbjct: 2863 ILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAIT 2922

Query: 65   VPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDV 124
            VP G+T+ TVP L   E Y+F+V AVN  GP + S  +  ++AKP+NL P IDR  L ++
Sbjct: 2923 VPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNL 2982

Query: 125  KIKAGQSFSFDVKEFRELSYT-------KSPLRALG-VRANSTKGWVKLSEPFLNHGWSI 176
             IKAGQS SFDV    E + T          +R  G V+ ++ +   KL    +  G S 
Sbjct: 2983 TIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSG 3042

Query: 177  NGQVCQIGGRADVQTTKSETVLDIPF-------CSRSDTGHYSLT-----------LENN 218
               +  +    + + T    V+D P         S     H +L            +EN 
Sbjct: 3043 TFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENY 3102

Query: 219  L--------GTATASAHVTGTEFTD--NNVHEGKAYEYRVSAVNAAGTEKPKISLDALIG 268
            +        G    +A V G + T   + +  G  Y++RV+AVNA G   P  +    + 
Sbjct: 3103 VIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLA 3162

Query: 269  KRIKEFVTSTTA-----------SLNIKNSVRKDSGI----YKIEAKNDYGIDMADIEVV 313
            K   +    T A            L  K     D G     Y +E K+++     D+  V
Sbjct: 3163 KDPFDKPGKTNAPEITDWDKDHVDLEWKPPA-NDGGAPIEEYVVEMKDEFSPFWNDVAHV 3221

Query: 314  VVSKPGPPTGPIDYTTVTPESVSMSWKPPV---DDGGTPITGA---PKITSDLSIRDMTV 367
               +     G +   +     +    K  +    D  + +  A   P +    SI+++ V
Sbjct: 3222 PAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKV 3281

Query: 368  LAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSY 427
             AG++F++ +P SG P PT  WT  G  V  D R+K    + +T +  K A R +D+G+Y
Sbjct: 3282 KAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALR-SDTGTY 3340

Query: 428  TIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVV 487
             I+  N  G+D+A  KV V+D PS P+GPLDV++I  + C L+WK P DDGG+ I++YV+
Sbjct: 3341 IIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVI 3400

Query: 488  EKYESATG 495
            EK ++ATG
Sbjct: 3401 EKQDAATG 3408




Regulator of muscle contraction and relaxation. Senses mechanical strain that occurs during muscle activity by unfolding in clearly resolvable steps at differing forces.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|P16419|MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus GN=MYBPC2 PE=1 SV=3 Back     alignment and function description
>sp|Q00872|MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens GN=MYBPC1 PE=1 SV=2 Back     alignment and function description
>sp|Q14324|MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens GN=MYBPC2 PE=1 SV=2 Back     alignment and function description
>sp|Q8N9C0|IGS22_HUMAN Immunoglobulin superfamily member 22 OS=Homo sapiens GN=IGSF22 PE=1 SV=2 Back     alignment and function description
>sp|Q5XKE0|MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus GN=Mybpc2 PE=1 SV=1 Back     alignment and function description
>sp|Q14896|MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens GN=MYBPC3 PE=1 SV=4 Back     alignment and function description
>sp|Q90688|MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus GN=MYBPC3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query516
357609022 7481 hypothetical protein KGM_13458 [Danaus p 0.868 0.059 0.348 2e-72
345486445 8816 PREDICTED: twitchin-like [Nasonia vitrip 0.868 0.050 0.334 1e-69
383852204 8627 PREDICTED: twitchin-like [Megachile rotu 0.903 0.054 0.333 1e-67
328789682 8619 PREDICTED: LOW QUALITY PROTEIN: twitchin 0.893 0.053 0.331 1e-66
32565889 7158 Protein UNC-22, isoform b [Caenorhabditi 0.947 0.068 0.333 6e-66
380026625 8679 PREDICTED: LOW QUALITY PROTEIN: twitchin 0.893 0.053 0.325 6e-66
392901026 6992 Protein UNC-22, isoform d [Caenorhabditi 0.947 0.069 0.333 8e-66
392901030 6435 Protein UNC-22, isoform e [Caenorhabditi 0.947 0.075 0.333 8e-66
392901028 6619 Protein UNC-22, isoform c [Caenorhabditi 0.947 0.073 0.333 8e-66
392901023 6848 Protein UNC-22, isoform g [Caenorhabditi 0.947 0.071 0.333 9e-66
>gi|357609022|gb|EHJ66254.1| hypothetical protein KGM_13458 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  280 bits (715), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 205/589 (34%), Positives = 272/589 (46%), Gaps = 141/589 (23%)

Query: 2    DHSVLIKNPFDEPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGNWEK 61
            + +++ KNPFDEPG P     TDWDKDHVDL+WTPP  DGG+PI GY+VE KDK GNWEK
Sbjct: 3470 EEAIVAKNPFDEPGAPGTPSVTDWDKDHVDLKWTPPKEDGGAPIEGYIVEKKDKFGNWEK 3529

Query: 62   AVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTL 121
            A+ VPA +TSCTVP L+EG+TY+F+VRAVN AGPG  S  T PIVAKP+N+AP+IDR+ L
Sbjct: 3530 ALEVPADKTSCTVPDLVEGQTYEFRVRAVNKAGPGVPSDSTHPIVAKPRNMAPKIDRTNL 3589

Query: 122  NDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQVC 181
             D+KIK GQ F FDVK                             EP     W +  +  
Sbjct: 3590 IDIKIKVGQKFGFDVK--------------------------VSGEPMPETKWFLGKREV 3623

Query: 182  QIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVT--------GTEF 233
            +  G   VQ +   + +     +R+D+G Y++T EN  G   A   V         G   
Sbjct: 3624 KSSGDMKVQHSDYNSKIACKAATRADSGRYTITAENVNGKDVAEVEVIVLSVPSPPGGPL 3683

Query: 234  TDNNVHEGKAY---------------EYRVSA--------VNAAGTEKPK--ISLDALIG 268
              ++VH   A                +Y V          V A  T+ P+  +++D L  
Sbjct: 3684 KVSDVHANGAKLSWNPPADDGGQPIEKYVVERMDEATGRWVQAGETDGPQTNLAVDGLTP 3743

Query: 269  KRIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYT 328
                +F      ++N +      +  +  EAKN +          V SKPG P       
Sbjct: 3744 GHKYKF---RVRAVNRQGKSEPLTTPHATEAKNPFD---------VASKPGTPR----IK 3787

Query: 329  TVTPESVSMSWKPPVDDGGTPITG---------AP------KITSDLS---IRDMTVLAG 370
                + V + W  P  DGG PITG         AP      +I  D++   + D+     
Sbjct: 3788 DFDKDFVELEWTRPDSDGGAPITGYVIEKKDRFAPDWEECAQIEGDVTSGKVPDLIEGNT 3847

Query: 371  EEFTI--------------TVPFSGRPK-------------------------------- 384
             EF +              T P   RPK                                
Sbjct: 3848 YEFRVRAVNKAGKGVPSDSTAPHVARPKNLAPKIDRNFMFDIKIKVGQNFELDVPVAGEP 3907

Query: 385  -PTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCK 443
             PT  W    + V    RIK     + T  R   AKRA D+G+YT++  N  G+DSA+ K
Sbjct: 3908 TPTKEWLHGENMVLNTDRIKVVNDAHSTKIRVIDAKRA-DTGTYTLKAKNINGTDSATVK 3966

Query: 444  VYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVVEKYES 492
            + V+D P PP+GPL V DIT   C+L W+PP DDGGS IT+YVVEK + 
Sbjct: 3967 IVVMDVPLPPEGPLRVDDITKSGCTLRWRPPKDDGGSEITHYVVEKMDQ 4015




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345486445|ref|XP_003425477.1| PREDICTED: twitchin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383852204|ref|XP_003701618.1| PREDICTED: twitchin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328789682|ref|XP_003251305.1| PREDICTED: LOW QUALITY PROTEIN: twitchin [Apis mellifera] Back     alignment and taxonomy information
>gi|32565889|ref|NP_502274.2| Protein UNC-22, isoform b [Caenorhabditis elegans] gi|74966877|sp|Q23551.3|UNC22_CAEEL RecName: Full=Twitchin; AltName: Full=Uncoordinated protein 22 gi|26985879|emb|CAA98065.2| Protein UNC-22, isoform b [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|380026625|ref|XP_003697047.1| PREDICTED: LOW QUALITY PROTEIN: twitchin-like [Apis florea] Back     alignment and taxonomy information
>gi|392901026|ref|NP_001255603.1| Protein UNC-22, isoform d [Caenorhabditis elegans] gi|313004686|emb|CBK19522.1| Protein UNC-22, isoform d [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|392901030|ref|NP_001255604.1| Protein UNC-22, isoform e [Caenorhabditis elegans] gi|313004687|emb|CBK19523.1| Protein UNC-22, isoform e [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|392901028|ref|NP_001122835.2| Protein UNC-22, isoform c [Caenorhabditis elegans] gi|371570818|emb|CAM35838.2| Protein UNC-22, isoform c [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|392901023|ref|NP_001255602.1| Protein UNC-22, isoform g [Caenorhabditis elegans] gi|371570820|emb|CCF23389.1| Protein UNC-22, isoform g [Caenorhabditis elegans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query516
FB|FBgn0005666 8933 bt "bent" [Drosophila melanoga 0.271 0.015 0.645 2e-113
WB|WBGene00006759 7158 unc-22 [Caenorhabditis elegans 0.627 0.045 0.335 1.7e-71
ZFIN|ZDB-GENE-030616-41328 ttnb "titin b" [Danio rerio (t 0.548 10.10 0.311 6.5e-47
MGI|MGI:9886435 Ttn "titin" [Mus musculus (tax 0.662 9.771 0.284 1.7e-48
UNIPROTKB|Q8WZ4234 TTN "Titin" [Homo sapiens (tax 0.633 9.617 0.316 3.1e-55
UNIPROTKB|F1N75734 F1N757 "Uncharacterized protei 0.608 9.235 0.292 2.2e-51
UNIPROTKB|F1PV4535 F1PV45 "Uncharacterized protei 0.662 9.771 0.289 3.5e-48
ZFIN|ZDB-GENE-030113-232 ttna "titin a" [Danio rerio (t 0.315 5.093 0.391 7.3e-51
UNIPROTKB|Q8T6S9350 bt "Bent" [Drosophila simulans 0.257 0.38 0.544 5.8e-34
UNIPROTKB|F1PWA8 1178 MYBPC1 "Uncharacterized protei 0.257 0.112 0.392 4.2e-16
FB|FBgn0005666 bt "bent" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 2.0e-113, Sum P(5) = 2.0e-113
 Identities = 91/141 (64%), Positives = 115/141 (81%)

Query:   353 APKITSDLSIRDMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTI 412
             APKITSDLSIRDMTV+AG+EF ITVP+   P+PT  W++NG EV P  RIKF++++  ++
Sbjct:  6854 APKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLEVIPGERIKFDSNDYASM 6913

Query:   413 YRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWK 472
             Y NKSAKR  ++GSYTI L N  GSD+ASC V VVD+P PPQGPL+  DITP++C+L+WK
Sbjct:  6914 YYNKSAKR-DETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGPLNAYDITPDTCTLAWK 6972

Query:   473 PPLDDGGSPITNYVVEKYESA 493
              PLDDGGSPITNYVVEK +++
Sbjct:  6973 TPLDDGGSPITNYVVEKLDNS 6993


GO:0005737 "cytoplasm" evidence=ISS
GO:0004687 "myosin light chain kinase activity" evidence=NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0007498 "mesoderm development" evidence=IEP
GO:0005524 "ATP binding" evidence=IEA
GO:0008307 "structural constituent of muscle" evidence=IDA
GO:0030018 "Z disc" evidence=IDA
GO:0045214 "sarcomere organization" evidence=IMP
WB|WBGene00006759 unc-22 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-413 ttnb "titin b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:98864 Ttn "titin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WZ42 TTN "Titin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV45 F1PV45 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030113-2 ttna "titin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8T6S9 bt "Bent" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWA8 MYBPC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-22
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-19
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 3e-17
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-15
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-10
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 2e-10
cd0589486 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) doma 1e-09
smart0041085 smart00410, IG_like, Immunoglobulin like 5e-08
smart0040985 smart00409, IG, Immunoglobulin 5e-08
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 7e-07
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 2e-06
cd0576298 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like 3e-06
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-05
cd0573296 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig 2e-04
smart0041085 smart00410, IG_like, Immunoglobulin like 6e-04
smart0040985 smart00409, IG, Immunoglobulin 6e-04
cd0573588 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma 6e-04
cd0009674 cd00096, Ig, Immunoglobulin domain 0.003
pfam0004184 pfam00041, fn3, Fibronectin type III domain 0.004
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 91.4 bits (227), Expect = 2e-22
 Identities = 43/90 (47%), Positives = 54/90 (60%), Gaps = 2/90 (2%)

Query: 14  PGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDK-TGNWEKAVVVPAGETSC 72
           P  PT+L  TD     V L WTPP  D G PITGYVVE ++K +G+W++  V P  ETS 
Sbjct: 1   PSPPTNLRVTDVTSTSVTLSWTPP-EDDGGPITGYVVEYREKGSGDWKEVEVTPGSETSY 59

Query: 73  TVPGLIEGETYQFQVRAVNAAGPGEASKPT 102
           T+ GL  G  Y+F+VRAVN  G    S+  
Sbjct: 60  TLTGLKPGTEYEFRVRAVNGGGESPPSESV 89


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143302 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143239 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 516
KOG3513|consensus 1051 100.0
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 99.98
KOG4222|consensus 1281 99.94
PHA02785326 IL-beta-binding protein; Provisional 99.9
KOG4194|consensus873 99.89
KOG4222|consensus 1281 99.85
KOG4194|consensus873 99.81
PHA02785326 IL-beta-binding protein; Provisional 99.61
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.61
PHA02826227 IL-1 receptor-like protein; Provisional 99.54
PHA02826227 IL-1 receptor-like protein; Provisional 99.51
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.45
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.42
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.4
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.39
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.38
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.36
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.35
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.34
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.34
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.34
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.34
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.33
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.33
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.31
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.3
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.3
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.3
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.3
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.29
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.28
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.28
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.26
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.26
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.24
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.24
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.23
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.23
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.22
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.22
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.22
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.22
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.22
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.21
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.21
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.21
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.21
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.2
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.2
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.2
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.2
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.2
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.2
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.2
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.19
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.19
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.19
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.19
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.18
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.18
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.17
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.17
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.17
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.17
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.16
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.16
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.15
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.14
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.14
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.14
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.14
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.13
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.13
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.12
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.12
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.11
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.11
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.11
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.1
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.1
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.09
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.09
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.09
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.08
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.08
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.08
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.08
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.08
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.07
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.07
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.07
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.07
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.07
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.07
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.07
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.06
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.05
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.05
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.05
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.04
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.04
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.04
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.03
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.03
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.02
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.02
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.01
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.01
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.01
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.01
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.01
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.0
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.0
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.0
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 98.99
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 98.99
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 98.99
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 98.99
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 98.99
KOG3515|consensus741 98.99
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.98
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.98
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 98.97
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 98.97
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 98.97
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 98.97
KOG3515|consensus 741 98.97
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 98.96
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 98.96
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 98.96
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 98.96
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 98.95
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.95
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 98.94
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 98.93
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 98.93
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 98.93
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 98.93
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 98.93
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 98.92
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.92
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 98.91
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.91
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 98.91
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.91
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 98.9
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.89
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 98.89
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 98.89
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 98.88
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.88
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 98.87
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.86
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.85
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 98.84
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 98.84
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 98.84
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.84
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 98.83
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 98.83
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.83
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 98.83
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.83
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.81
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 98.81
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.81
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.8
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.8
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.78
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 98.78
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 98.78
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.78
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 98.77
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.77
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 98.77
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.75
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.74
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.73
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.72
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.71
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.7
KOG0196|consensus 996 98.68
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.68
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 98.68
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.67
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 98.66
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.65
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.65
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.65
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.64
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.63
smart0040986 IG Immunoglobulin. 98.6
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.6
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.6
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.57
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.54
smart0040986 IG Immunoglobulin. 98.54
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.52
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.51
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.51
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.48
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.48
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.47
PHA03376221 BARF1; Provisional 98.47
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.45
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.45
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.44
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.44
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.42
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.41
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.38
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.38
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.37
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.34
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.3
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.3
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.29
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.25
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.24
KOG0196|consensus996 98.23
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.22
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.2
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.2
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.18
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.16
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.16
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.15
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.11
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.1
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.1
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.08
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.04
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.02
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 97.99
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 97.98
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 97.95
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 97.94
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 97.94
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 97.94
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.92
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.9
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 97.9
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.89
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.88
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 97.87
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.84
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 97.83
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 97.83
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.82
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 97.82
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.81
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 97.81
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.81
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 97.8
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 97.78
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 97.78
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 97.78
KOG0613|consensus 1205 97.77
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.76
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.76
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 97.75
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 97.72
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.71
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.68
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.67
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 97.66
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.66
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.62
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.61
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.61
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 97.6
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.58
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 97.57
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 97.53
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 97.5
PHA02987189 Ig domain OX-2-like protein; Provisional 97.49
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.46
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.45
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.45
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 97.41
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.4
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.35
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 97.35
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.34
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.33
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.28
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.27
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 97.27
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.24
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.24
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.23
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.2
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.2
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 97.18
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.16
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.14
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 97.13
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.13
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.12
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.11
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 97.1
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.1
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.08
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.08
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 97.08
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.06
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.05
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 97.02
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.02
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.01
PHA02987189 Ig domain OX-2-like protein; Provisional 97.01
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 96.97
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 96.91
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 96.89
KOG4367|consensus699 96.88
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 96.87
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 96.84
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 96.8
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 96.8
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 96.76
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 96.71
smart0040681 IGv Immunoglobulin V-Type. 96.62
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 96.53
KOG0613|consensus 1205 96.53
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 96.41
PHA03376221 BARF1; Provisional 96.27
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.26
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 96.23
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.21
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 96.19
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.99
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 95.94
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 95.82
KOG4258|consensus 1025 95.74
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 95.74
smart0040681 IGv Immunoglobulin V-Type. 95.69
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 95.51
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 95.48
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 95.36
smart0040775 IGc1 Immunoglobulin C-Type. 95.35
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 95.35
smart0040775 IGc1 Immunoglobulin C-Type. 95.23
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 95.11
PHA02982251 hypothetical protein; Provisional 95.05
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 95.03
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 94.86
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 94.68
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 94.67
cd0577093 IgC_beta2m Class I major histocompatibility comple 94.31
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 94.22
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 94.14
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 94.11
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 94.1
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 94.07
KOG4258|consensus1025 94.03
cd0577093 IgC_beta2m Class I major histocompatibility comple 94.02
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 93.96
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 93.93
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 93.92
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 93.86
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 93.81
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 93.74
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 93.73
PHA0263363 hypothetical protein; Provisional 93.62
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 93.48
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 93.41
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 93.09
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 93.01
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 92.74
PHA0263363 hypothetical protein; Provisional 92.72
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 92.5
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 92.46
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 92.26
KOG4802|consensus516 91.93
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 91.78
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 91.3
PHA02982251 hypothetical protein; Provisional 91.22
PHA03270466 envelope glycoprotein C; Provisional 91.12
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 90.95
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 90.63
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 90.5
KOG1480|consensus 909 90.47
PHA03273486 envelope glycoprotein C; Provisional 90.41
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 90.04
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 89.92
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 89.91
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 89.89
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 89.88
PHA03269566 envelope glycoprotein C; Provisional 89.7
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 89.69
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 89.38
smart0006083 FN3 Fibronectin type 3 domain. One of three types 89.3
cd0006393 FN3 Fibronectin type 3 domain; One of three types 89.22
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 88.74
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 87.91
PHA03271490 envelope glycoprotein C; Provisional 87.87
PHA02914500 Immunoglobulin-like domain protein; Provisional 86.63
KOG4597|consensus560 86.35
PHA03271490 envelope glycoprotein C; Provisional 86.29
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 85.74
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 85.74
PHA03270466 envelope glycoprotein C; Provisional 85.42
KOG4802|consensus516 84.87
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 84.85
PHA03269566 envelope glycoprotein C; Provisional 82.26
KOG1480|consensus 909 81.33
PHA02914500 Immunoglobulin-like domain protein; Provisional 80.87
PHA03042 286 CD47-like protein; Provisional 80.39
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=9.5e-38  Score=323.63  Aligned_cols=391  Identities=21%  Similarity=0.275  Sum_probs=306.6

Q ss_pred             EEeeeCCeeEEEecCCCCCCCCceeceEEEEEeCCC-CeEEeEEeecCCcEEEeCCCcCCCeEEEEEEEecCCCCCCCCC
Q psy7039          22 ATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTG-NWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVNAAGPGEASK  100 (516)
Q Consensus        22 ~~~~~~~~v~l~W~~p~~~~~~~i~~Y~v~~~~~~~-~~~~~~~~~~~~~~~~i~~l~~~~~y~~~~~a~n~~g~~~~s~  100 (516)
                      ........|.|.+.+-    |.|+-.  +.|++.++ .+..-.....-...|.|.+.+.+|.|.|+|.|.|..|...   
T Consensus       251 ~~a~~G~~v~LECfA~----G~P~P~--i~W~k~~g~~~~~r~~~~~~~~vL~I~nv~~~D~G~Y~C~AeN~~G~~~---  321 (1051)
T KOG3513|consen  251 ETALKGQSVKLECFAL----GNPTPQ--IKWRKVDGKPPPRRATYSNYGKVLKIPNVQYEDAGEYECIAENSRGSAT---  321 (1051)
T ss_pred             ccccCCCeEEEEEEec----CCCCCc--EEEEeCCCCCCCcceeeeccccEEEecccCcCCCeEEEEEEecccccce---
Confidence            4445678888888762    233332  33555555 4433333334567899999999999999999999988332   


Q ss_pred             CCcceEeccCCCCCccccCcccceEEecCCeEEEEEeeeeccccccCccccccccccCccceeecCcCceeeEEeeCCee
Q psy7039         101 PTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKSPLRALGVRANSTKGWVKLSEPFLNHGWSINGQV  180 (516)
Q Consensus       101 ~~~~~~~~~~~~~p~~~~~~~~~~~v~~g~~~~l~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~i~W~~~~~~  180 (516)
                      ....+.+.   ++|.+. ..++++.+..|+.+.|.|.+.                          |.|.++++|.+|+.+
T Consensus       322 ~~~~v~v~---a~P~w~-~~~~d~~~~~gs~v~~eC~a~--------------------------g~P~p~v~WlkNg~p  371 (1051)
T KOG3513|consen  322 HSGHVTVY---APPYWL-QKPQDTEADTGSNVTLECKAS--------------------------GKPNPTVKWLKNGEP  371 (1051)
T ss_pred             eeEEEEEe---cCchhh-cccceeEecCCCCeEEEEEec--------------------------CCCCCceEEeeCCee
Confidence            22223332   578887 788999999999999999999                          999999999999999


Q ss_pred             eccCCc---eEEeecCCeeEEEeccCCCCCCeeEEEEEEcCCCceEEEEEeeceee----e------eccccCCceEEEE
Q psy7039         181 CQIGGR---ADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAHVTGTEF----T------DNNVHEGKAYEYR  247 (516)
Q Consensus       181 ~~~~~~---~~~~~~~~~~~l~i~~~~~~d~g~Y~c~~~~~~g~~~~~~~~~~~~~----~------~~~l~~g~~~~~~  247 (516)
                      +....+   +.+.    ...|+|.+++..|+|.|.|.|+|..|...+++.+.+...    .      ......|..+.+.
T Consensus       372 l~~~~r~~~~~i~----~g~L~is~v~~~dsg~YQC~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~  447 (1051)
T KOG3513|consen  372 LEPAERDPRYKID----DGTLIISNVQESDSGVYQCIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTID  447 (1051)
T ss_pred             cCccCCCcceEEe----CCEEEEEecccccCeEEEeeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEe
Confidence            987655   5553    458999999999999999999999999988876655433    1      1233457888888


Q ss_pred             EEEEccCCCCCceecccccccc--eEEEEEecceeeEEEccCCCCCceEEEEEEEecCCCcceeEEEEEecCCCCCCCCc
Q psy7039         248 VSAVNAAGTEKPKISLDALIGK--RIKEFVTSTTASLNIKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPI  325 (516)
Q Consensus       248 ~~~~~~~g~p~p~i~W~~~~~~--~~~~~~~~~~~~l~i~~l~~~d~g~y~c~a~n~~g~~~~~~~l~v~~~p~~p~~p~  325 (516)
                      |..   .+.|.|.+.|.+....  .........+++|.|.+++.+|.|.|+|.|.|..|.......|.|...+.....  
T Consensus       448 C~~---~asP~p~~~W~k~~~~~~~~~r~~i~edGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tri~~~--  522 (1051)
T KOG3513|consen  448 CKP---FASPKPKVSWLKGGEKLLQSGRIRILEDGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATRITLA--  522 (1051)
T ss_pred             ecc---CCCCcceEEEEcCCcccccCceEEECCCCcEEecccCcccCcEEEEEEEcccCccceEEEEEEecCceEEec--
Confidence            887   8999999999763321  111222467899999999999999999999999999999999999988765422  


Q ss_pred             eeeeccCCeeEEEecCCCCCCCCceeeccccccccccccEEEEcCCeEEEEEEEeee--cCCceEEEECCeecCC---CC
Q psy7039         326 DYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFTITVPFSGR--PKPTPIWTVNGDEVSP---DG  400 (516)
Q Consensus       326 ~~~~~~~~~~~l~W~~p~~~~~~~i~~y~~~~~~~~~~~~~v~~g~~~~l~C~~~g~--p~~~i~W~~~~~~l~~---~~  400 (516)
                                                          +.+..+..|+.+.|.|.+.-.  ....|.|.++|..+..   ..
T Consensus       523 ------------------------------------P~~~~v~~g~~v~l~Ce~shD~~ld~~f~W~~nG~~id~~~~~~  566 (1051)
T KOG3513|consen  523 ------------------------------------PSNTDVKVGESVTLTCEASHDPSLDITFTWKKNGRPIDFNPDGD  566 (1051)
T ss_pred             ------------------------------------cchhhhccCceEEEEeecccCCCcceEEEEEECCEEhhccCCCC
Confidence                                                355678999999999998644  4458999999997743   34


Q ss_pred             ceEEEEcCCeEEEEEcCceecCCceEEEEEEEcCCCceeEEEEEEEecCCCCCCCCcccccccCCeEEEEeeCCCCCCCC
Q psy7039         401 RIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGS  480 (516)
Q Consensus       401 ~~~~~~~~~~~~l~i~~~~~~~~~g~y~c~a~n~~G~~s~s~~l~v~~~p~~P~~~l~~~~~~~~~~~l~W~~p~~~~~~  480 (516)
                      ++......+...|+|.+++. .|+|.|.|.|+....+.+..+.+.|.++|.|| ..+++.+++..++.|+|++.. |+++
T Consensus       567 ~~~~~~~~~~g~L~i~nv~l-~~~G~Y~C~aqT~~Ds~s~~A~l~V~gpPgpP-~~v~~~~i~~t~~~lsW~~g~-dn~S  643 (1051)
T KOG3513|consen  567 HFEINDGSDSGRLTIANVSL-EDSGKYTCVAQTALDSASARADLLVRGPPGPP-PDVHVDDISDTTARLSWSPGS-DNNS  643 (1051)
T ss_pred             ceEEeCCcCccceEEEeecc-ccCceEEEEEEEeecchhcccceEEecCCCCC-CceeEeeeccceEEEEeecCC-CCCC
Confidence            45544433336899999999 99999999999988888888999999999999 789999999999999999765 7789


Q ss_pred             CcceEEEEEEecCCCceee
Q psy7039         481 PITNYVVEKYESATGVSDL  499 (516)
Q Consensus       481 ~i~~Y~v~~~~~~~~~~~~  499 (516)
                      +|..|.|+.|....+.|..
T Consensus       644 pI~~Y~iq~rt~~~~~W~~  662 (1051)
T KOG3513|consen  644 PIEKYTIQFRTPFPGKWKA  662 (1051)
T ss_pred             CceEEeEEecCCCCCcceE
Confidence            9999999999986555443



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 6e-16
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 9e-11
3lpw_A 197 Crystal Structure Of The Fniii-Tandem A77-A78 From 4e-07
1bpv_A112 Titin Module A71 From Human Cardiac Muscle, Nmr, 50 2e-09
2crz_A110 Solution Structure Of The Fifth Fniii Domain Of Hum 8e-09
1wf5_A121 Solution Structure Of The First Fn3 Domain Of Sidek 3e-08
2yux_A120 Solution Structure Of 3rd Fibronectin Type Three Do 2e-07
2yux_A120 Solution Structure Of 3rd Fibronectin Type Three Do 3e-05
1x4z_A121 Solution Structure Of The 2nd Fibronectin Type Iii 2e-07
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 2e-07
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 2e-06
1uey_A127 Solution Structure Of The First Fibronectin Type Ii 5e-07
2e7c_A118 Solution Structure Of The 6th Ig-Like Domain From H 6e-07
3puc_A99 Atomic Resolution Structure Of Titin Domain M7 Leng 2e-06
1gxe_A139 Central Domain Of Cardiac Myosin Binding Protein C 1e-05
3knb_A100 Crystal Structure Of The Titin C-Terminus In Comple 2e-05
2wp3_T102 Crystal Structure Of The Titin M10-Obscurin Like 1 2e-05
1wit_A93 Twitchin Immunoglobulin Superfamily Domain (Igsf Mo 4e-05
2cqv_A114 Solution Structure Of The Eighth Ig-Like Domain Of 1e-04
1u2h_A99 X-Ray Structure Of The N-Terminally Truncated Human 3e-04
1uem_A117 Solution Structure Of The First Fibronectin Type Ii 3e-04
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 5e-04
2db8_A110 Solution Structures Of The Fn3 Domain Of Human Trip 7e-04
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure

Iteration: 1

Score = 82.0 bits (201), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 1/122 (0%) Query: 368 LAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSY 427 L GE +I +PFSG+P P W D + +G + + + T + D+G Y Sbjct: 117 LRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFY 176 Query: 428 TIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVSDITPESCSLSWKPPLDDGGSPITNYVV 487 + N G D + ++ V D P PP+G + VSD++ +S +L+W P DGGS ITNY+V Sbjct: 177 VVCAKNRFGIDQKTVELDVADVPDPPRG-VKVSDVSRDSVNLTWTEPASDGGSKITNYIV 235 Query: 488 EK 489 EK Sbjct: 236 EK 237
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 Back     alignment and structure
>pdb|2CRZ|A Chain A, Solution Structure Of The Fifth Fniii Domain Of Human Fibronectin Type Iii Domain Containing Protein 3a Length = 110 Back     alignment and structure
>pdb|1WF5|A Chain A, Solution Structure Of The First Fn3 Domain Of Sidekick-2 Protein Length = 121 Back     alignment and structure
>pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 Back     alignment and structure
>pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 Back     alignment and structure
>pdb|1X4Z|A Chain A, Solution Structure Of The 2nd Fibronectin Type Iii Domain From Mouse Biregional Cell Adhesion Molecule-RelatedDOWN- Regulated Oncogenes (Cdon) Binding Protein Length = 121 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 Back     alignment and structure
>pdb|2E7C|A Chain A, Solution Structure Of The 6th Ig-Like Domain From Human Myosin-Binding Protein C, Fast-Type Length = 118 Back     alignment and structure
>pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 Back     alignment and structure
>pdb|3KNB|A Chain A, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 100 Back     alignment and structure
>pdb|2WP3|T Chain T, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 102 Back     alignment and structure
>pdb|1WIT|A Chain A, Twitchin Immunoglobulin Superfamily Domain (Igsf Module) (Ig 18'), Nmr, Minimized Average Structure Length = 93 Back     alignment and structure
>pdb|2CQV|A Chain A, Solution Structure Of The Eighth Ig-Like Domain Of Human Myosin Light Chain Kinase Length = 114 Back     alignment and structure
>pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 Back     alignment and structure
>pdb|1UEM|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa1568 Protein Length = 117 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|2DB8|A Chain A, Solution Structures Of The Fn3 Domain Of Human Tripartite Motif Protein 9 Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-42
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-27
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-23
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-11
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-38
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-35
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 8e-24
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-23
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 9e-10
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-32
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 6e-20
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-19
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 6e-06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 3e-32
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 5e-12
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 7e-07
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 1e-31
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-21
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-16
2vkw_A 209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-11
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 6e-05
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 2e-31
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 8e-12
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 3e-06
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-31
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-21
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-14
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-07
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-31
1x5x_A109 Fibronectin type-III domain containing protein 3A; 4e-11
1x5x_A109 Fibronectin type-III domain containing protein 3A; 9e-06
1x5x_A109 Fibronectin type-III domain containing protein 3A; 6e-04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-31
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 4e-13
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 5e-06
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-31
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-11
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-06
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 1e-30
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 4e-12
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 9e-05
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-30
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-13
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-06
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 5e-30
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 3e-19
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 9e-11
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-29
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-29
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 6e-17
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-09
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-29
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-16
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 1e-07
2crz_A110 Fibronectin type-III domain containing protein 3A; 4e-29
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-12
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-07
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-28
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-25
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 7e-24
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 4e-10
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-28
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-11
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-09
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-28
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 4e-15
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-11
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-28
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 6e-13
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-05
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 4e-28
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 7e-15
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 6e-28
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-09
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 9e-05
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 5e-27
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-27
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 3e-11
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 7e-05
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-25
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 2e-16
2rik_A 284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-13
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 1e-25
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 4e-10
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-05
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 3e-25
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 2e-14
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 4e-09
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 6e-07
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 4e-25
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 3e-08
1x4x_A106 Fibronectin type-III domain containing protein 3A; 5e-25
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-07
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-24
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-08
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-04
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-24
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-14
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-11
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-24
2crm_A120 Fibronectin type-III domain containing protein 3A; 8e-19
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-10
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-24
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-11
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-08
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-23
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-20
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-09
1cfb_A 205 Drosophila neuroglian; neural adhesion molecule; H 9e-09
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-23
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-08
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 1e-04
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-23
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-10
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-07
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-23
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-05
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 8e-23
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-06
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 9e-23
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 7e-07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 1e-22
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 7e-08
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 5e-04
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 1e-22
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 3e-10
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-08
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-22
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-11
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 7e-11
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-22
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-08
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 3e-04
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-21
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-20
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-16
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 6e-14
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-13
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-11
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-08
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-07
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-21
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 5e-11
2wim_A 291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-09
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-21
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 6e-18
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-17
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-15
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-11
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-10
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 7e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 6e-21
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 6e-13
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-20
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-13
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-07
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-06
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-20
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-07
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 4e-20
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-13
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-11
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-09
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 7e-20
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-13
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-10
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-05
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-19
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 6e-17
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-14
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-10
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-19
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-19
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-09
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 4e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 5e-19
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 5e-19
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-06
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-19
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-18
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-18
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-12
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-10
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-18
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-14
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 8e-05
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 2e-18
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-04
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-18
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-18
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-16
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-14
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-13
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-10
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 6e-04
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 8e-18
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 8e-18
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-17
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 6e-15
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-08
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-17
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 6e-05
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-17
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 8e-17
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-16
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-08
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 7e-08
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 3e-17
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 7e-07
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 7e-04
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 4e-17
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-17
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 4e-05
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-05
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 9e-17
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-14
1qr4_A 186 Protein (tenascin); fibronectin type-III, heparin, 5e-04
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-16
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 8e-12
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 9e-06
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 9e-06
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-16
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-11
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 7e-08
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-16
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-04
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-16
3k2m_C101 Monobody HA4; engineered binding protein, antibody 6e-04
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 4e-16
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-04
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 5e-16
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-14
1ry7_B 334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 7e-05
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 5e-16
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 4e-10
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-07
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 6e-16
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 3e-04
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 6e-16
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-13
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 2e-11
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 7e-08
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-16
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-15
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-04
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 7e-16
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-08
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-07
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 8e-16
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-15
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 6e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-15
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-15
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-15
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-12
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 3e-10
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-05
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-15
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 7e-04
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-15
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 4e-15
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-15
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-11
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 5e-07
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 6e-15
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 8e-13
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 8e-15
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-14
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-13
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-11
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-04
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 2e-04
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-14
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 6e-14
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 3e-07
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-14
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-11
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 6e-06
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-05
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 1e-14
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-14
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-14
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-12
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-12
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-11
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 1e-14
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-13
2gee_A 203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-14
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 7e-11
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-14
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-14
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 6e-10
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-08
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 6e-05
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-14
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-14
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-04
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-14
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-06
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-14
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 6e-12
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 7e-10
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 1e-09
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 2e-07
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-05
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 4e-14
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-09
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-04
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 5e-14
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-14
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-10
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 9e-08
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 5e-14
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 3e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 6e-14
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 8e-04
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 7e-14
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 1e-13
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 4e-04
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-13
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 5e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 1e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 7e-04
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-13
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-13
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-13
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-13
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-13
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 3e-11
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-13
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-12
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-13
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-13
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 7e-04
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 4e-13
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 6e-09
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-04
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 5e-13
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-13
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 6e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 7e-06
1wwb_X103 Protein (brain derived neurotrophic factor recepto 5e-13
1wwb_X103 Protein (brain derived neurotrophic factor recepto 5e-08
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 6e-13
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 9e-08
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-06
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 7e-13
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 2e-07
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 8e-13
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-06
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-04
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 9e-13
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 7e-07
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 9e-13
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 9e-04
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 9e-13
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-12
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 6e-09
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-04
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 6e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-12
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-12
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-12
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 2e-09
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 5e-09
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-07
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-12
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 3e-12
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 4e-12
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 6e-04
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-12
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 7e-10
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-07
1he7_A126 High affinity nerve growth factor receptor; transf 4e-12
1he7_A126 High affinity nerve growth factor receptor; transf 2e-08
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 7e-12
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 8e-12
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 7e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-11
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-11
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-05
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-11
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-11
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-11
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-11
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-11
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-11
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-09
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-06
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-06
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-06
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 2e-11
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 1e-06
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-11
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-05
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-05
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 4e-11
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-04
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 5e-11
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 5e-09
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-06
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-04
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 7e-11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-10
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 9e-09
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-10
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 1e-10
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 5e-04
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 8e-04
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 1e-10
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-10
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 2e-10
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 9e-05
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-10
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-10
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 1e-05
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-04
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-10
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-06
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-10
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-06
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 3e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 3e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 3e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 3e-10
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-07
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 4e-10
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-05
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 4e-10
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-05
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 6e-10
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 9e-10
1n26_A 325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-07
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 6e-04
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 9e-10
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 2e-09
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-09
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-09
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-09
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-09
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 3e-09
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 3e-09
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 5e-09
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 5e-09
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-04
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 7e-09
3mjg_X289 Beta-type platelet-derived growth factor receptor; 9e-09
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-04
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 1e-08
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-08
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 2e-06
3shs_A 304 HOC head outer capsid protein; immunoglobulin-like 3e-04
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 2e-08
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-08
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-05
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 3e-04
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-08
2erj_C247 Cytokine receptor common gamma chain; immune syste 3e-08
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 3e-08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 5e-08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-05
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 6e-08
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-07
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 1e-07
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 1e-07
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2e-07
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 1e-05
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-07
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 1e-05
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 7e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-07
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 2e-07
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 2e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 7e-04
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 3e-07
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 4e-07
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 6e-04
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 4e-07
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 5e-07
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 5e-07
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 2e-05
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 5e-07
1waa_A93 Titin; metal binding protein, calmodulin-binding, 6e-07
1oww_A98 FN, fibronectin first type III module, CIG; fibron 9e-07
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-04
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-06
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-06
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-06
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 6e-06
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-06
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 4e-06
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 7e-04
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 4e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-04
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 4e-06
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 4e-06
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 3e-04
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 5e-06
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 7e-06
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 7e-06
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 5e-04
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 9e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-05
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-05
2ens_A96 Advanced glycosylation END product-specific recept 1e-05
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 2e-05
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 2e-05
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 2e-05
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 6e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 3e-05
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 6e-04
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 3e-05
2fbo_J250 V1V2;, variable region-containing chitin-binding p 3e-05
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 3e-05
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 4e-05
2v9t_A117 Roundabout homolog 1; structural protein-receptor 4e-05
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 5e-05
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 7e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 7e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-04
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 8e-05
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-04
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 1e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 1e-04
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 1e-04
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 2e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 3e-04
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 5e-04
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 6e-04
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 7e-04
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 7e-04
1gl4_B98 Basement membrane-specific heparan sulfate proteog 8e-04
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
 Score =  152 bits (385), Expect = 2e-42
 Identities = 62/275 (22%), Positives = 97/275 (35%), Gaps = 50/275 (18%)

Query: 231 TEFTDNNVHEGKAYEYRVSAVNAAGTEKPKIS-------LDALIGKRIKEFVTSTTASLN 283
            E  + NV                G  KP +        + A   K   +        L 
Sbjct: 9   EELRNLNVRYQSNATLVCKV---TGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 65

Query: 284 IKNSVRKDSGIYKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPV 343
           I +    D+ +Y++ A N  G       + V                             
Sbjct: 66  IASVTDDDATVYQVRATNQGGSVSGTASLEVEV--------------------------- 98

Query: 344 DDGGTPITGAPKITSDLSIR---DMTVLAGEEFTITVPFSGRPKPTPIWTVNGDEVSPDG 400
                      KI    ++     +  L GE  +I +PFSG+P P   W    D +  +G
Sbjct: 99  ---------PAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNG 149

Query: 401 RIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQGPLDVS 460
             +   + + T     +     D+G Y +   N  G D  + ++ V D P PP+G   VS
Sbjct: 150 HYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGV-KVS 208

Query: 461 DITPESCSLSWKPPLDDGGSPITNYVVEKYESATG 495
           D++ +S +L+W  P  DGGS ITNY+VEK  +   
Sbjct: 209 DVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAE 243


>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 123 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query516
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.98
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.97
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.97
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.97
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.96
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.96
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.96
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.96
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.96
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.96
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.96
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.96
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.95
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.95
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.95
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.95
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.95
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.95
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.95
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.95
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.95
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.95
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.95
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.94
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.94
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.94
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.93
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.93
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.93
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.93
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.93
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.93
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.93
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.92
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.92
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.92
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.92
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.92
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.91
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.91
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.91
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.91
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.91
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.91
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.91
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.91
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.91
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.91
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.91
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.91
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.91
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.91
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.9
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.9
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.9
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.89
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.89
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.89
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.89
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.88
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.88
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.88
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.87
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.87
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.87
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.87
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.86
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.86
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.85
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.85
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.84
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.84
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.84
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.83
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.83
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.83
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.82
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.82
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.81
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.81
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.8
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.8
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.8
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.8
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.79
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.79
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.79
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.79
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.78
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.77
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.77
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.77
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.77
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.76
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.76
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.76
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.75
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.75
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.75
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.75
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.75
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.75
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.74
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.74
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.74
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.74
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.74
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.74
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.74
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.74
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.74
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.74
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.74
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.73
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.72
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.72
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.72
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.72
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.72
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.72
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.71
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.71
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.71
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.71
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.7
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.69
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.69
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.69
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.69
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.68
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.68
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.68
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.68
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.67
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.67
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.67
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.67
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.66
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.66
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.66
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.66
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.66
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.65
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.65
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.64
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.64
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.64
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.64
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.64
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.64
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.64
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.63
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.63
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.63
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.63
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.63
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.63
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.62
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.62
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.61
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.61
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.61
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.61
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.6
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.6
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.6
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.6
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.59
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.59
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.59
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.59
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.58
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.58
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.57
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.57
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.57
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.56
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.56
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.55
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.55
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.54
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.54
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.54
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.54
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.54
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.53
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.53
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.52
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.52
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.52
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.52
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.52
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.52
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.51
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.51
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.51
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.51
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.51
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.51
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.51
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.51
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.5
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.5
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.5
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.5
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.5
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.5
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.5
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.5
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.49
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.49
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.49
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.49
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.49
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.49
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.48
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.48
3umt_A256 SCFV heavy chain and light chain; stability engine 99.47
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.47
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.47
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.47
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.47
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.47
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.47
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.47
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.47
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.47
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.47
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.47
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.46
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.46
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.46
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.46
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.46
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.46
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.46
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.46
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.46
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.46
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.45
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.45
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.45
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.45
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.45
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.45
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.45
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.44
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.44
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.44
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.44
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.44
3sob_L237 Antibody light chain; beta propeller, protein bind 99.43
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.43
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.43
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.43
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.43
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.42
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.42
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.42
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.42
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.42
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.42
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.42
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.42
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.42
3umt_A256 SCFV heavy chain and light chain; stability engine 99.42
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.42
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.42
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.41
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.41
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.41
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.41
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.41
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.41
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.41
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.4
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.4
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.4
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.4
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.4
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.4
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.4
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.4
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.4
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.4
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.39
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.39
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.39
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.39
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.39
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.39
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.38
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.38
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.38
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.38
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.38
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.37
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.37
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.37
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.37
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.36
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.36
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.36
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.36
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.36
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.36
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.36
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.36
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.35
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.35
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.35
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.35
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.35
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.35
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.35
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.34
3sob_L237 Antibody light chain; beta propeller, protein bind 99.34
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.34
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.34
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.34
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.34
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.34
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.34
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.33
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.33
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.33
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.33
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.33
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.33
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.33
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.33
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.33
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.33
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.33
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.33
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.33
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.32
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.32
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.32
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.32
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.32
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.32
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.32
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.31
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.31
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.31
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.31
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.31
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.31
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.31
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.31
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.31
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.31
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.31
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.3
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.3
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.3
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.3
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.3
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.3
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.3
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.29
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.29
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.29
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.29
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.29
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.29
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.29
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.29
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.29
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.29
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.29
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.29
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.28
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.28
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.28
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.28
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.28
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.28
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.28
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.28
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.27
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.27
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.27
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.27
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.27
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.27
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.27
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.27
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.26
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.26
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.26
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.26
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.26
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.26
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.26
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.26
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.26
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.26
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.26
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.25
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.25
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.25
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.25
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.25
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.25
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.24
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.24
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.24
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.24
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.24
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.24
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.24
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.24
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.24
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.23
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.23
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.23
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.23
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.22
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.22
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.22
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.22
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.22
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.22
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.21
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.21
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.21
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.21
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.21
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.21
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.21
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.2
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.2
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.2
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.2
1he7_A126 High affinity nerve growth factor receptor; transf 99.2
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.2
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.2
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.2
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.2
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.19
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.19
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.19
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.19
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.19
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.19
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.19
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.19
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.19
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.19
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.18
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.18
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.18
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.17
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.17
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.17
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.17
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.17
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.17
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.17
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.17
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.17
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.16
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.16
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.16
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.16
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.16
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 99.15
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.15
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.14
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.14
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.14
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.13
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.13
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.13
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.13
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.13
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.13
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.12
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.12
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.12
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.12
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.11
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.11
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.11
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.11
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.11
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.11
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.11
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.11
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.1
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.1
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.1
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.1
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.09
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.09
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
Probab=100.00  E-value=4.9e-34  Score=300.49  Aligned_cols=334  Identities=19%  Similarity=0.251  Sum_probs=264.3

Q ss_pred             CCcEEEeCCCcCCCeEEEEEEEecCCCCCCCCCCCcceEeccCCCCCccccCcccceEEecCCeEEEEEeeeeccccccC
Q psy7039          68 GETSCTVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAKPKNLAPRIDRSTLNDVKIKAGQSFSFDVKEFRELSYTKS  147 (516)
Q Consensus        68 ~~~~~~i~~l~~~~~y~~~~~a~n~~g~~~~s~~~~~~~~~~~~~~p~~~~~~~~~~~v~~g~~~~l~C~~~~~~~~~~~  147 (516)
                      ....|.|.+++..|.|.|+|.|.|..|....   ...+.+.....+|.+. ..+..+.+.+|+.+.|.|.+.        
T Consensus       155 ~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~~---~~~l~v~~~~~pp~~~-~~p~~~~v~~G~~~~l~C~~~--------  222 (570)
T 3b43_A          155 NVATLQILQTDQSHVGQYNCSASNPLGTASS---SAKLTLSEHEVPPFFD-LKPVSVDLALGESGTFKCHVT--------  222 (570)
T ss_dssp             TEEEEEESSCCGGGCEEEEEEEEETTEEEEE---EEEEEEECCCCCCEEE-ECCCCBCCBSBSCEEEEEEEE--------
T ss_pred             CEEEEEECcCChHHCEEEEEEEEeCCcEEEE---EEEEEEcCCCCCCccc-cCCceeEecCCCeEEEEEEEE--------
Confidence            4568999999999999999999998875432   2223333334566665 455667788999999999999        


Q ss_pred             ccccccccccCccceeecCcCceeeEEeeCCeeeccCCceEEeecCCeeEEEeccCCCCCCeeEEEEEEcCCCceEEEEE
Q psy7039         148 PLRALGVRANSTKGWVKLSEPFLNHGWSINGQVCQIGGRADVQTTKSETVLDIPFCSRSDTGHYSLTLENNLGTATASAH  227 (516)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~p~~~i~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~c~~~~~~g~~~~~~~  227 (516)
                                        |.|.+.++|++++..+....++.+........|.|.+++.+|+|.|+|.+.|..|.......
T Consensus       223 ------------------g~p~p~i~W~k~g~~i~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~g~~~~~~~  284 (570)
T 3b43_A          223 ------------------GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVTKGDAGQYTCYASNVAGKDSCSAQ  284 (570)
T ss_dssp             ------------------SSSCCEEEEEETTEECCTTSSEEEEEETTEEEEEESSBCGGGCEEEEEEEEETTEEEEEEEE
T ss_pred             ------------------ECCCCEEEEEECCEECcCCCcEEEEEECCEEEEEEcccCcccCEEEEEEEECCCCcEEEEEE
Confidence                              99999999999999998888887776677789999999999999999999999998776665


Q ss_pred             eecee---ee-----eccccCCceEEEEEEEEccCCCCCceeccccc-----ccceEEEEEecceeeEEEccCCCCCceE
Q psy7039         228 VTGTE---FT-----DNNVHEGKAYEYRVSAVNAAGTEKPKISLDAL-----IGKRIKEFVTSTTASLNIKNSVRKDSGI  294 (516)
Q Consensus       228 ~~~~~---~~-----~~~l~~g~~~~~~~~~~~~~g~p~p~i~W~~~-----~~~~~~~~~~~~~~~l~i~~l~~~d~g~  294 (516)
                      +.+..   +.     ...+..|....+.|.+   .|.|.|.+.|.+.     ......+........|.|.++..+|+|.
T Consensus       285 l~V~~~p~~~~~~~~~~~v~~g~~~~l~C~~---~g~P~p~v~W~k~~~~l~~~~~~~~~~~~~~~~L~i~~v~~~D~G~  361 (570)
T 3b43_A          285 LGVQEPPRFIKKLEPSRIVKQDEHTRYECKI---GGSPEIKVLWYKDETEIQESSKFRMSFVESVAVLEMYNLSVEDSGD  361 (570)
T ss_dssp             ECCBCCCEEEECCCSBCCEESSCEEEEEEEE---ESSSSCEEEEEETTEECCCSSSEEEEEETTEEEEEEESCCGGGCEE
T ss_pred             EEeecCCcccccCCCccEEcCCCcEEEEEEE---eeCCCCEEEEeECCEECCCCCcEEEEEECCEEEEEECCCCcccCEE
Confidence            44322   11     1235689999999998   7899999999652     2334445555667889999999999999


Q ss_pred             EEEEEEecCCCcceeEEEEEecCCCCCCCCceeeeccCCeeEEEecCCCCCCCCceeeccccccccccccEEEEcCCeEE
Q psy7039         295 YKIEAKNDYGIDMADIEVVVVSKPGPPTGPIDYTTVTPESVSMSWKPPVDDGGTPITGAPKITSDLSIRDMTVLAGEEFT  374 (516)
Q Consensus       295 y~c~a~n~~g~~~~~~~l~v~~~p~~p~~p~~~~~~~~~~~~l~W~~p~~~~~~~i~~y~~~~~~~~~~~~~v~~g~~~~  374 (516)
                      |+|.|.|..|.....+.|.|..+|....                                      .+....+..|+.+.
T Consensus       362 Y~C~a~N~~g~~~~~~~l~V~~~P~~~~--------------------------------------~~~~~~~~~G~~v~  403 (570)
T 3b43_A          362 YTCEAHNAAGSASSSTSLKVKEPPVFRK--------------------------------------KPHPVETLKGADVH  403 (570)
T ss_dssp             EEEEEEBTTBCCEEEEEECEECCCEECS--------------------------------------CCCCEEECTTCCEE
T ss_pred             EEEEEEeCCCEEEEEEEEEecCCCeeec--------------------------------------CCCceeecCCCEEE
Confidence            9999999999998888888887654321                                      12345678899999


Q ss_pred             EEEEEeeecCCceEEEECCeecCCCCceEEEEcCCeEEEEEcCceecCCceEEEEEEEcCCCceeEEEEEEEecCCCCCC
Q psy7039         375 ITVPFSGRPKPTPIWTVNGDEVSPDGRIKFETSENQTIYRNKSAKRATDSGSYTIQLVNTVGSDSASCKVYVVDKPSPPQ  454 (516)
Q Consensus       375 l~C~~~g~p~~~i~W~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~~~~~g~y~c~a~n~~G~~s~s~~l~v~~~p~~P~  454 (516)
                      |.|.+.|.|.+.+.|++++..+..+.++.+...+....|.|.++.. .|.|.|+|.|.|..|.....+.|.|..+|....
T Consensus       404 l~C~~~g~P~p~v~W~k~g~~l~~~~~~~~~~~~~~~~L~i~~v~~-~D~G~Y~C~A~N~~G~~~~~~~l~v~~~P~~~~  482 (570)
T 3b43_A          404 LECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDS-ADIGEYQCKASNDVGSDTCVGSITLKAPPRFVK  482 (570)
T ss_dssp             EEEEEESSSSCCCEEEETTEECCSSSSEEEEEETTEEEEEECSCCG-GGCEEEEEEEECSSCEEEEEEEEEECCCCEEEE
T ss_pred             EEEEEecCCCCEEEEEECCEECcCCCCEEEEEcCCEEEEEECCCCh-hhCEEEEEEEEECCCeEEEEEEEEeccCCcccc
Confidence            9999999999999999999999888888887777778899999999 999999999999999999889999987664221


Q ss_pred             CCcccccccCCeEEEEeeC
Q psy7039         455 GPLDVSDITPESCSLSWKP  473 (516)
Q Consensus       455 ~~l~~~~~~~~~~~l~W~~  473 (516)
                      ....+....++.+.|.+..
T Consensus       483 ~~~~~~~~~g~~~~l~c~~  501 (570)
T 3b43_A          483 KLSDISTVVGEEVQLQATI  501 (570)
T ss_dssp             CCCCBCCBTTCCEEEEEEE
T ss_pred             cCCCceecCCCeEEEEEEE
Confidence            1112333445666666653



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 516
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 5e-22
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 5e-07
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 7e-04
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-21
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 9e-06
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 0.002
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-19
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-04
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-18
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 8e-05
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-18
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-04
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-18
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 6e-08
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 9e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 5e-18
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 8e-04
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 6e-18
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 7e-04
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 7e-18
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-08
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 5e-05
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-17
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-07
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-17
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 3e-05
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 4e-17
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-04
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.002
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 8e-17
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 3e-09
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 1e-16
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 0.001
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-16
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-16
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 5e-16
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-15
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-04
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-15
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 1e-14
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 0.003
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-14
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 1e-14
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 3e-14
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 4e-14
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 4e-14
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 0.002
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 0.002
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-14
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 5e-14
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-06
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 8e-04
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 5e-14
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 5e-14
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 6e-14
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 7e-14
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 7e-14
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 8e-14
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 9e-14
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 1e-13
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-13
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 2e-13
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-13
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-13
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 3e-13
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 4e-13
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 9e-13
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-12
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-09
d2dtge2 196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-04
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.003
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 1e-12
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 1e-12
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 1e-12
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.001
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 1e-12
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 2e-12
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 7e-05
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 4e-12
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 4e-12
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 0.003
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 5e-12
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 0.002
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 6e-12
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 3e-06
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.002
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 6e-12
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 0.001
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 6e-12
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 6e-12
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 7e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 3e-05
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 7e-12
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 9e-12
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 1e-11
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-11
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 2e-11
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 3e-04
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-11
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-11
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 1e-04
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 2e-11
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 3e-11
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 0.001
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 4e-11
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 6e-11
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 6e-11
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 9e-11
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 2e-10
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-10
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 2e-10
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 3e-10
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 0.004
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 3e-10
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 5e-10
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-10
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 9e-10
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 9e-10
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 1e-09
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 1e-09
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 1e-09
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-04
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 0.001
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-09
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 2e-09
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 2e-09
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-04
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 3e-09
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-09
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 4e-09
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 4e-09
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 1e-08
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 2e-08
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-08
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 3e-08
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 1e-07
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 3e-07
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 6e-07
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 7e-07
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 0.004
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 2e-06
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-04
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 2e-06
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 2e-06
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 5e-06
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 6e-06
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 7e-06
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 2e-05
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 8e-06
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 1e-05
d1biha2111 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecro 3e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 4e-05
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 5e-05
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 5e-05
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 5e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 1e-04
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-04
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 2e-04
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 6e-04
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 4e-04
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 4e-04
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 9e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 0.001
d1f6fb196 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus 0.003
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 0.004
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Myosin binding protein C, fast-type
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 88.4 bits (218), Expect = 5e-22
 Identities = 28/96 (29%), Positives = 35/96 (36%), Gaps = 1/96 (1%)

Query: 14  PGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTGN-WEKAVVVPAGETSC 72
              P  L   D       L+W PP   G   I GY+VE   +    W  A   P      
Sbjct: 2   TSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGF 61

Query: 73  TVPGLIEGETYQFQVRAVNAAGPGEASKPTAPIVAK 108
           TV  L  G    F+V  VN AG  E +    P+  +
Sbjct: 62  TVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIR 97


>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 111 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query516
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.63
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.46
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.46
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.46
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.45
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.44
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.44
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.42
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.42
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.41
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.41
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.4
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.4
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.39
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.39
d2crza197 Fibronectin type-III domain containing protein 3a, 99.38
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.38
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.38
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.36
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.36
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.36
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.35
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.32
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.32
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.3
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.3
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.3
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.28
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.28
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.27
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.27
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.27
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.27
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.26
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.26
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.26
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.26
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.25
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.22
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.22
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.21
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.2
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.2
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.2
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.2
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.18
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.18
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.18
d1gxea_130 Cardiac myosin binding protein C, different domain 99.18
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.18
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.18
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.17
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.17
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.16
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.16
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.16
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.15
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.15
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.14
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.14
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d1gxea_130 Cardiac myosin binding protein C, different domain 99.14
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.14
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.14
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.13
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.13
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.13
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.13
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.13
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.13
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.13
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.13
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.13
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.13
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.12
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.12
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.12
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.12
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.11
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.11
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.1
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.09
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.09
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.09
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.09
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.09
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.08
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.08
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.08
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.07
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.07
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.07
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.06
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.06
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.06
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.05
d2avga1110 Cardiac myosin binding protein C, different domain 99.05
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.05
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.05
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.05
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.04
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.04
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.04
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.03
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.02
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.02
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.02
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.01
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.01
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.01
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.01
d2avga1110 Cardiac myosin binding protein C, different domain 99.01
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.01
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.01
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 98.99
d2ifga192 High affinity nerve growth factor receptor TrkA, d 98.99
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.99
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.99
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 98.99
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 98.99
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 98.98
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 98.98
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 98.96
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 98.96
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.95
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.95
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 98.94
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.94
d1pd6a_94 Cardiac myosin binding protein C, different domain 98.94
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.94
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 98.93
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 98.93
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 98.92
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.92
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.92
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 98.91
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.91
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 98.91
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.9
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 98.9
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 98.88
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.87
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 98.87
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.86
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.86
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.86
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.85
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.84
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.84
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 98.84
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.83
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.82
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.81
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 98.8
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 98.8
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.78
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.77
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 98.77
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.77
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.76
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.76
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 98.75
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.75
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.74
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 98.73
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.72
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.71
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 98.68
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 98.67
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.65
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.62
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.61
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 98.61
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.6
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.6
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.59
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 98.58
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.57
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.55
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.54
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.51
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.43
d2crza197 Fibronectin type-III domain containing protein 3a, 98.39
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.38
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.32
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 98.29
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.27
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.2
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.17
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.15
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.14
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.12
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.11
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.1
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.07
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.04
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 97.96
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 97.95
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 97.93
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.92
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 97.89
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.88
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.88
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.87
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.85
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.85
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.85
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.84
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.84
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.83
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.83
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.81
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.81
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.8
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.8
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.8
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 97.8
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.79
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.78
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.77
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.77
d1x3da1105 Fibronectin type-III domain containing protein 3a, 97.76
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.76
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.74
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.74
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.72
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.72
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.71
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 97.7
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.7
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.7
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 97.7
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.69
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.69
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.69
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 97.68
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.67
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.67
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.66
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.66
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.66
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.65
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.63
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.63
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.61
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.61
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.61
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.61
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.6
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.6
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.59
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.59
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.58
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.58
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 97.57
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.57
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.57
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.57
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.56
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 97.56
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.55
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.55
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.55
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.54
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.54
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 97.53
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.53
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.52
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.52
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.52
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.49
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 97.48
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 97.47
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.46
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 97.46
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.46
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.45
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.45
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.44
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.44
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.43
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.43
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.42
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.42
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.42
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.41
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.41
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.41
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.4
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.39
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.39
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.39
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.39
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.38
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.37
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.37
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.37
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.36
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.36
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.36
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.36
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.33
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.33
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.33
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.33
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.32
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.32
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.32
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.31
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.29
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.29
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.28
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.28
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.28
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.27
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.27
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.27
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.26
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 97.24
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.23
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.22
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.22
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 97.22
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 97.21
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.21
d1va9a1109 Down syndrome cell adhesion molecule-like protein 97.21
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.21
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.21
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.21
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.18
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.18
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.17
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.16
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.15
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.15
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.13
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.13
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.13
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.12
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 97.12
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.11
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.1
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.09
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.09
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.09
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.08
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.07
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.07
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.06
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 97.06
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 97.06
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.05
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.02
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.02
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.01
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.01
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.0
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 97.0
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.0
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.0
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.0
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.0
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1mjul1112 Immunoglobulin light chain kappa variable domain, 96.99
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.98
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.96
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 96.96
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 96.96
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 96.95
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 96.94
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 96.93
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 96.93
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 96.92
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 96.91
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 96.91
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 96.91
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.9
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 96.88
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 96.88
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.87
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 96.86
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 96.86
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 96.85
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.84
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 96.83
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.83
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 96.83
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 96.81
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 96.79
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 96.78
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 96.77
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 96.76
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 96.75
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.75
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 96.74
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 96.71
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.71
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.71
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 96.7
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 96.68
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 96.65
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 96.65
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 96.65
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 96.63
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 96.62
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 96.62
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 96.61
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 96.6
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 96.58
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.57
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 96.57
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.57
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 96.56
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.53
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 96.53
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 96.42
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 96.41
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 96.4
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 96.4
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 96.38
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 96.37
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 96.32
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.3
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 96.3
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 96.28
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 96.26
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 96.26
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.25
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 96.23
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 96.22
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 96.18
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 96.16
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.14
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 96.13
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 96.12
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 96.11
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 96.11
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 96.09
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 96.01
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 95.97
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 95.94
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 95.94
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 95.94
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 95.93
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 95.93
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 95.92
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 95.91
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 95.88
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 95.82
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 95.81
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 95.8
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 95.8
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 95.8
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 95.78
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 95.75
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 95.74
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 95.73
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 95.72
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 95.69
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 95.69
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 95.68
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 95.65
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 95.65
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 95.65
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 95.64
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 95.64
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 95.62
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Myosin binding protein C, fast-type
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.63  E-value=7.9e-16  Score=118.98  Aligned_cols=94  Identities=30%  Similarity=0.466  Sum_probs=83.4

Q ss_pred             CCCCCcceEEEeeeCCeeEEEecCCCCCCCCceeceEEEEEeCCC-CeEEeEEeecCCcEEEeCCCcCCCeEEEEEEEec
Q psy7039          13 EPGKPTDLEATDWDKDHVDLQWTPPISDGGSPITGYVVEMKDKTG-NWEKAVVVPAGETSCTVPGLIEGETYQFQVRAVN   91 (516)
Q Consensus        13 ~p~~p~~l~~~~~~~~~v~l~W~~p~~~~~~~i~~Y~v~~~~~~~-~~~~~~~~~~~~~~~~i~~l~~~~~y~~~~~a~n   91 (516)
                      +|++|.+|.+..+++++|.|+|.+|..+++.+|.+|.|+|+..++ .|..........++++|.+|.++..|.|+|+|.|
T Consensus         1 PP~~P~~~~v~~~~~~sv~l~W~pP~~~~~~~i~~Y~V~~~~~~~~~~~~~~~~~~~~~~~~v~~L~~~~~Y~frV~A~n   80 (98)
T d1x5ya1           1 PTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVN   80 (98)
T ss_dssp             CCCCCEEEEEEEECSSEEEEEEECCSCCCSSCCCEEEEEEEETTCCCCEESSSSCBSSSEEEEECCCTTCCEEEEEEEEE
T ss_pred             CCCCCcCcEEEEccCCEEEEEEECCCcCCCCCceEEEEEEEecCcceeEEeeeecCceeEEEECCCcCCeEEEEEEEEEC
Confidence            689999999999999999999999987888899999999998776 8988776667889999999999999999999999


Q ss_pred             CCCCCCCCCCCcceE
Q psy7039          92 AAGPGEASKPTAPIV  106 (516)
Q Consensus        92 ~~g~~~~s~~~~~~~  106 (516)
                      ..|.+.++.....++
T Consensus        81 ~~G~s~~s~~~~~vt   95 (98)
T d1x5ya1          81 IAGRSEPATLLQPVT   95 (98)
T ss_dssp             TTEECCCCCCSSCBC
T ss_pred             CCcCCCCcCCCCCEE
Confidence            999998776554444



>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure