Psyllid ID: psy7042
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 2245 | 2.2.26 [Sep-21-2011] | |||||||
| Q23551 | 7158 | Twitchin OS=Caenorhabditi | yes | N/A | 0.387 | 0.121 | 0.438 | 0.0 | |
| A2ASS6 | 35213 | Titin OS=Mus musculus GN= | yes | N/A | 0.620 | 0.039 | 0.284 | 1e-151 | |
| Q8WZ42 | 34350 | Titin OS=Homo sapiens GN= | no | N/A | 0.496 | 0.032 | 0.304 | 1e-137 | |
| Q3KNY0 | 2849 | Immunoglobulin-like and f | no | N/A | 0.282 | 0.222 | 0.275 | 5e-54 | |
| Q9I7U4 | 18141 | Titin OS=Drosophila melan | no | N/A | 0.251 | 0.031 | 0.266 | 8e-51 | |
| Q86VF2 | 1251 | Immunoglobulin-like and f | no | N/A | 0.283 | 0.509 | 0.265 | 4e-49 | |
| Q00872 | 1141 | Myosin-binding protein C, | no | N/A | 0.289 | 0.570 | 0.267 | 7e-49 | |
| Q15746 | 1914 | Myosin light chain kinase | no | N/A | 0.195 | 0.228 | 0.283 | 1e-47 | |
| Q14324 | 1141 | Myosin-binding protein C, | no | N/A | 0.252 | 0.496 | 0.265 | 4e-46 | |
| Q28824 | 1176 | Myosin light chain kinase | no | N/A | 0.178 | 0.340 | 0.289 | 4e-45 |
| >sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 767 bits (1980), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 386/881 (43%), Positives = 536/881 (60%), Gaps = 10/881 (1%)
Query: 22 YIIERREVGGAIWLKCNDYNVLECSFSVLNLVEGNDYEFRIIAVNAIGKSEPSICTTPVK 81
Y +E RE G +W +DYNV E F+V L E NDYEFR++A+NA GK PS+ + P+K
Sbjct: 5465 YNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIK 5524
Query: 82 ICEFVGGEKPDFIVPLKDLVVPLGKLLTLQCEATGTPVPKCRWLRNGREISSGARYRVET 141
I E GG +P +V +D P + CEA G P P RWLRNGRE+ +RYR E
Sbjct: 5525 IQE-SGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEA 5583
Query: 142 AGGVFRLHFNEVTDVDNGDYTCEAYNSVGFAHTSSRVKIGTPPRIDR-MPNALYIPEGDN 200
+ GV++ EV D+D G+YT E N G ++ + + PP I++ +PN + +P GD
Sbjct: 5584 SDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTI-LPSGDL 5642
Query: 201 TKVKIFYAGDQPMEVSLTKNGRVVQSDD-RFKFTVLDDYIIIFIKEIRKEDAGDYTVNLS 259
++KI+++G P SL N + D + DD+I+I I + +AG Y +S
Sbjct: 5643 VRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVS 5702
Query: 260 NSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDI 319
N SG + F +N+TGLP P GPL +S I T TL W PP DGG K+T YVVE+RD+
Sbjct: 5703 NDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDL 5762
Query: 320 SMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPS 379
S W+ +++ D +IV GL E EY F V A NENG+G PL +PI A+ P+D P+
Sbjct: 5763 SKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPT 5822
Query: 380 PPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINI 439
P + QVGGD+V LSW +PL DGG R++GY ++K E D W R N P+ N+
Sbjct: 5823 SPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNV 5882
Query: 440 PNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQ 499
PNLI+GR+Y +RV+A N+AGLS + ++ + + + P+I+ PL + N
Sbjct: 5883 PNLIDGRKYRYRVFAVNDAGLSDLAELDQTL-FQASGSGEGPKIVSPLSDLNEEVGRCVT 5941
Query: 500 FQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKG 559
F+C I+G P+P W KG +E+ ++++ + +GD LIIN + DADEY CRA N
Sbjct: 5942 FECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSS 6001
Query: 560 GVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIES 619
G +ST+A L I T P+ +PP++ KGE + +KIP+ YP+ + W +D E IE+
Sbjct: 6002 GTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIEN 6061
Query: 620 GGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVE 679
F + T ++ A L I +AS D YRVV EN +G DS V + ++D P+PP+FP +E
Sbjct: 6062 NSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIE 6121
Query: 680 DIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYE 739
+I +++ L W+ P DGGS +TNY +EKRE SW +R+T I GL G QYE
Sbjct: 6122 NILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYE 6181
Query: 740 FRVYAENVYGRSDP-STTSDLITTKDTFKKQIKKRQYDFDETGKKIRGKADEKVSDYDQY 798
FR+ AEN +G+S P T+ ++ D K ++R YD DE GK +RGK S+YD Y
Sbjct: 6182 FRIIAENKHGQSKPCEPTAPVLIPGDERK---RRRGYDVDEQGKIVRGKGTVS-SNYDNY 6237
Query: 799 VFDIYSKYVPQPVDIKTSSVYDHYDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPVSHN 858
VFDI+ +Y PQPV+IK V DHYDI EE+GTGAFGVVHR ER TGN FAAKF+ H
Sbjct: 6238 VFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHE 6297
Query: 859 LEKELIRKEIDIMNQLHHPKLINLHDAFEDDDEMVLIFEVL 899
+KE +RKEI M+ L HP L+NLHDAFEDD+EMV+I+E +
Sbjct: 6298 SDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFM 6338
|
Regulator of muscle contraction and relaxation. Senses mechanical strain that occurs during muscle activity by unfolding in clearly resolvable steps at differing forces. Caenorhabditis elegans (taxid: 6239) EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1 |
| >sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q3KNY0|IGFN1_MOUSE Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Mus musculus GN=Igfn1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster GN=sls PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q86VF2|IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens GN=IGFN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q00872|MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens GN=MYBPC1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q14324|MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens GN=MYBPC2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2245 | ||||||
| 328710146 | 8645 | PREDICTED: twitchin-like [Acyrthosiphon | 0.301 | 0.078 | 0.742 | 0.0 | |
| 383852204 | 8627 | PREDICTED: twitchin-like [Megachile rotu | 0.391 | 0.101 | 0.711 | 0.0 | |
| 307200525 | 5935 | Titin [Harpegnathos saltator] | 0.391 | 0.147 | 0.712 | 0.0 | |
| 189233817 | 8838 | PREDICTED: similar to CG32019-PA [Tribol | 0.315 | 0.080 | 0.714 | 0.0 | |
| 270014673 | 8877 | hypothetical protein TcasGA2_TC004721 [T | 0.315 | 0.079 | 0.714 | 0.0 | |
| 350413804 | 8700 | PREDICTED: twitchin-like [Bombus impatie | 0.391 | 0.100 | 0.708 | 0.0 | |
| 340710318 | 8715 | PREDICTED: twitchin-like [Bombus terrest | 0.391 | 0.100 | 0.707 | 0.0 | |
| 380026625 | 8679 | PREDICTED: LOW QUALITY PROTEIN: twitchin | 0.391 | 0.101 | 0.700 | 0.0 | |
| 328789682 | 8619 | PREDICTED: LOW QUALITY PROTEIN: twitchin | 0.391 | 0.101 | 0.693 | 0.0 | |
| 242010244 | 8829 | titin, putative [Pediculus humanus corpo | 0.390 | 0.099 | 0.686 | 0.0 |
| >gi|328710146|ref|XP_003244179.1| PREDICTED: twitchin-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 1427 bits (3693), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 652/878 (74%), Positives = 754/878 (85%)
Query: 22 YIIERREVGGAIWLKCNDYNVLECSFSVLNLVEGNDYEFRIIAVNAIGKSEPSICTTPVK 81
Y IE+R+VG A+W+KCNDY+V +C F+ +NL+EG DYEFR+ A+N +GKSEPS CTTPVK
Sbjct: 6897 YSIEKRQVGNAVWVKCNDYSVFDCKFTAMNLIEGADYEFRVFALNIVGKSEPSTCTTPVK 6956
Query: 82 ICEFVGGEKPDFIVPLKDLVVPLGKLLTLQCEATGTPVPKCRWLRNGREISSGARYRVET 141
ICEF GGEKP+FIVPL + VV GK +TL+CEA G P+P +WL+NGREI SG RY+ E+
Sbjct: 6957 ICEFEGGEKPEFIVPLTNKVVQFGKTITLRCEAIGKPMPNAKWLKNGREIISGGRYKCES 7016
Query: 142 AGGVFRLHFNEVTDVDNGDYTCEAYNSVGFAHTSSRVKIGTPPRIDRMPNALYIPEGDNT 201
A GVF+LHF EV+++D+GDYTCE+YN VGF TSSRVKIG PP+I+RMPN++ +PEG+N+
Sbjct: 7017 ANGVFQLHFPEVSEIDDGDYTCESYNPVGFVTTSSRVKIGHPPKIERMPNSINVPEGENS 7076
Query: 202 KVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNS 261
K+KIFY+GD ++ L KNG + D FKFT+ DDY+IIF+KE +K DA DYTV L N
Sbjct: 7077 KIKIFYSGDSLEDIVLEKNGTTIPQSDHFKFTIFDDYVIIFLKEAKKNDASDYTVTLRNP 7136
Query: 262 SGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISM 321
SGS SG+FTINI+G PGPPIGPL VSEITKHTC+L WNPPKYDGGLK+THY+VERRDI+
Sbjct: 7137 SGSTSGSFTINISGYPGPPIGPLGVSEITKHTCSLSWNPPKYDGGLKITHYIVERRDITS 7196
Query: 322 PHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPP 381
HWICISTTC DT FIVQGLTEG EY+F ++AVN+NG+ PPLEG+NPIKAKSPYDKPSPP
Sbjct: 7197 NHWICISTTCKDTHFIVQGLTEGNEYVFRIIAVNDNGLSPPLEGVNPIKAKSPYDKPSPP 7256
Query: 382 GIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPN 441
GIP VT++GGDFVNLSW+KP+DDGGSRIQGY IDK E+ SD WQRVN AIC +QINI N
Sbjct: 7257 GIPTVTEIGGDFVNLSWEKPIDDGGSRIQGYLIDKREIDSDTWQRVNAAICVTTQINISN 7316
Query: 442 LIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQ 501
LIEGRQY FRV+AQNEAGLSLPS ASN+V IKDP+ A+ PEII PL AIQN NAQFQ
Sbjct: 7317 LIEGRQYVFRVFAQNEAGLSLPSQASNTVTIKDPLTAQPPEIIKPLGRVQAIQNQNAQFQ 7376
Query: 502 CTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGV 561
C ITG PKPTI+W KG+REITPSARHH+F EGD++TLIIN VYG D+DEYVCRA NKGG+
Sbjct: 7377 CVITGVPKPTITWYKGAREITPSARHHMFNEGDSHTLIINGVYGADSDEYVCRASNKGGI 7436
Query: 562 KSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGG 621
KST+ EL IMT PK NVPPRFRDTA+FDKGENVV+KIPFTG+PKPKI WYR+NEVIESG
Sbjct: 7437 KSTRGELFIMTPPKLNVPPRFRDTAFFDKGENVVIKIPFTGFPKPKIKWYRENEVIESGS 7496
Query: 622 HFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDI 681
HF VE SERHAILTIRD S D++PYRV+AENDLG+DSAI+KIQISD PDPP ++EDI
Sbjct: 7497 HFAVEVSERHAILTIRDVSKYDSSPYRVLAENDLGVDSAIIKIQISDHPDPPFSLSIEDI 7556
Query: 682 GHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFR 741
G DSL L W AP WDGGSNITNY++EKRE PMSSWIRVGNTRFT+ A+TGLSPGH+YEFR
Sbjct: 7557 GQDSLILNWNAPTWDGGSNITNYLIEKREIPMSSWIRVGNTRFTSTAVTGLSPGHEYEFR 7616
Query: 742 VYAENVYGRSDPSTTSDLITTKDTFKKQIKKRQYDFDETGKKIRGKADEKVSDYDQYVFD 801
VYAENVYGRS PS S ++ TK+ KK K ++Y+ DETGKKIRGKAD + DYD YVFD
Sbjct: 7617 VYAENVYGRSKPSEVSPVVKTKELLKKPPKTKRYEVDETGKKIRGKADGNIKDYDHYVFD 7676
Query: 802 IYSKYVPQPVDIKTSSVYDHYDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPVSHNLEK 861
IYSKY+PQPVDIKT SVYD+YDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPV+HN+EK
Sbjct: 7677 IYSKYIPQPVDIKTQSVYDYYDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPVAHNVEK 7736
Query: 862 ELIRKEIDIMNQLHHPKLINLHDAFEDDDEMVLIFEVL 899
ELI+KEIDIMNQLHHPKLINLHDAFED+DEMVLIFE L
Sbjct: 7737 ELIKKEIDIMNQLHHPKLINLHDAFEDEDEMVLIFEFL 7774
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383852204|ref|XP_003701618.1| PREDICTED: twitchin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307200525|gb|EFN80687.1| Titin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|189233817|ref|XP_971502.2| PREDICTED: similar to CG32019-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014673|gb|EFA11121.1| hypothetical protein TcasGA2_TC004721 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350413804|ref|XP_003490119.1| PREDICTED: twitchin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340710318|ref|XP_003393739.1| PREDICTED: twitchin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380026625|ref|XP_003697047.1| PREDICTED: LOW QUALITY PROTEIN: twitchin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328789682|ref|XP_003251305.1| PREDICTED: LOW QUALITY PROTEIN: twitchin [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|242010244|ref|XP_002425880.1| titin, putative [Pediculus humanus corporis] gi|212509846|gb|EEB13142.1| titin, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2245 | ||||||
| FB|FBgn0005666 | 8933 | bt "bent" [Drosophila melanoga | 0.397 | 0.099 | 0.635 | 0.0 | |
| WB|WBGene00006759 | 7158 | unc-22 [Caenorhabditis elegans | 0.393 | 0.123 | 0.421 | 1.9e-216 | |
| MGI|MGI:98864 | 35 | Ttn "titin" [Mus musculus (tax | 0.345 | 22.14 | 0.312 | 3.6e-123 | |
| UNIPROTKB|Q8WZ42 | 34 | TTN "Titin" [Homo sapiens (tax | 0.346 | 22.85 | 0.313 | 1.2e-130 | |
| UNIPROTKB|F1N757 | 34 | F1N757 "Uncharacterized protei | 0.360 | 23.82 | 0.312 | 7.1e-119 | |
| UNIPROTKB|F1PV45 | 35 | F1PV45 "Uncharacterized protei | 0.360 | 23.14 | 0.310 | 2.3e-116 | |
| ZFIN|ZDB-GENE-030616-413 | 28 | ttnb "titin b" [Danio rerio (t | 0.345 | 27.71 | 0.296 | 9.5e-122 | |
| ZFIN|ZDB-GENE-030113-2 | 32 | ttna "titin a" [Danio rerio (t | 0.338 | 23.78 | 0.306 | 6.7e-96 | |
| WB|WBGene00006436 | 18 | ttn-1 [Caenorhabditis elegans | 0.265 | 33.11 | 0.304 | 2.3e-99 | |
| FB|FBgn0086906 | 18 | sls "sallimus" [Drosophila mel | 0.292 | 36.5 | 0.244 | 1.3e-56 |
| FB|FBgn0005666 bt "bent" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 3147 (1112.9 bits), Expect = 0., Sum P(5) = 0.
Identities = 569/896 (63%), Positives = 699/896 (78%)
Query: 22 YIIERREVGGAIWLKCNDYNVLECSFSVLNLVEGNDYEFRIIAVNAIGKSEPSICTTPVK 81
YIIERR++GGA+W+KCNDYNVL+ ++V+NL+E DYEFR+ AVN+ G+SEPS+CT P+K
Sbjct: 7185 YIIERRDIGGAVWVKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIK 7244
Query: 82 ICEFVGGEKPDFIVPLKDLVVPLGKLLTLQCEATGTPVPKCRWLRNGREIS-SGARYRVE 140
+CE +GG+KPD+I L+D V P GK TLQC A+G P P RWLRNG+EI +G R +
Sbjct: 7245 VCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEIQMNGGRMTCD 7304
Query: 141 TAGGVFRLHFNEVTDVDNGDYTCEAYNSVGFAHTSSRVKIGTPPRIDRMPNALYIPEGDN 200
+ GVFRLH + V D+GDYTCEA NS+GF +TS +KIG+PP I+R P+ L +PEGDN
Sbjct: 7305 SKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLPEGDN 7364
Query: 201 TKVKIFYAGDQPMEVSLTKNGRVV--QSDD-RFKFTVLDDYIIIFIKEIRKEDAGDYXXX 257
+K+KIFY+GDQP+ V L KN V+ +DD K + DDY+ I+I+ I K D G Y
Sbjct: 7365 SKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKSDGGPYQIE 7424
Query: 258 XXXXXXXXXXXFXXXXXXXXXXXXXXXDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERR 317
F +S I K++C L+W PP YDGGLKV+HYV+ER+
Sbjct: 7425 FTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERK 7484
Query: 318 DISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDK 377
D+S PHWI +S+TC DT F VQGL E QEY+F VMAVNENGMGPPLEG+NPI+AK P D
Sbjct: 7485 DVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDP 7544
Query: 378 PSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQI 437
PSPPG P +T++GGDFV+L W+KP DGG+ IQGYWIDK EVGS+ WQRVN ICA +QI
Sbjct: 7545 PSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNATICAANQI 7604
Query: 438 NIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHN 497
N NLIEGRQYEFR++AQN AGLS SSAS +V+I DP AA P I+ PLR+AN IQNHN
Sbjct: 7605 NCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQNHN 7664
Query: 498 AQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVN 557
AQF CTI G PKPTISW KG+REI+ AR+H+++EGD + L IN V+G DADEYVCRAVN
Sbjct: 7665 AQFTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVN 7724
Query: 558 KGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVI 617
K G KST+A L IMTAPK NVPPRFRDTAYFDKGENVV+KIPFTG+PKP+I W RD E I
Sbjct: 7725 KAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENI 7784
Query: 618 ESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPT 677
ESGGH+ VE ERHA+L IRD S++D+ PYR+ AEN+LG D+AI+++QISDRPDPP+FP
Sbjct: 7785 ESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPL 7844
Query: 678 VEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQ 737
+E IG +SL+L W+AP+WDG S+ITNY VE+REHP+SSWIRVGNTRFT+MA++GL+PG +
Sbjct: 7845 IESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKE 7904
Query: 738 YEFRVYAENVYGRSDPSTTSDLITTKDTFKKQIKKRQYDFDETGKKIRGKADEKVSDYDQ 797
Y+FR++A+NVYGRSD S TS LI TK++ KK+ +R+++ D G+K+RGKAD V DYD
Sbjct: 7905 YDFRIFADNVYGRSDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDS 7964
Query: 798 YVFDIYSKYVPQPVDIKTSSVYDHYDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPVSH 857
YVFDIYSK+VPQPV+I SVYD YDILEEIGTGAFGVVHRCRER TGNIFAAKFIPVSH
Sbjct: 7965 YVFDIYSKFVPQPVEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSH 8024
Query: 858 NLEKELIRKEIDIMNQLHHPKLINLHDAFEDDDEMVLIFEVLDRPHPPENLHADEF 913
++EK+LIR+EIDIMNQLHH KLINLHDAFEDDDEM+LI E L E + A+ +
Sbjct: 8025 SVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGY 8080
|
|
| WB|WBGene00006759 unc-22 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98864 Ttn "titin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WZ42 TTN "Titin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PV45 F1PV45 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-413 ttnb "titin b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030113-2 ttna "titin a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006436 ttn-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0086906 sls "sallimus" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.11 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 2245 | |||
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 3e-24 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 3e-24 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 2e-23 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-20 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 5e-20 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 5e-20 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 1e-19 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 1e-19 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 2e-19 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 1e-18 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 1e-18 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 5e-18 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 7e-18 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 4e-17 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 5e-16 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 9e-16 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 9e-16 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 1e-15 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 2e-15 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 2e-15 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 4e-15 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 9e-15 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 9e-15 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 2e-14 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 2e-14 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 2e-14 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 2e-14 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 2e-14 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 3e-14 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 3e-14 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 2e-13 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 3e-13 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 8e-13 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 8e-13 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 3e-12 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 3e-12 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 6e-12 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 1e-11 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 2e-11 | |
| cd05894 | 86 | cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) doma | 2e-11 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 3e-11 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 3e-11 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 3e-11 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 4e-11 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 4e-11 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 4e-11 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 4e-11 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 5e-11 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 5e-11 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 5e-11 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 6e-11 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 7e-11 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 9e-11 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 9e-11 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 9e-11 | |
| cd05848 | 94 | cd05848, Ig1_Contactin-5, First Ig domain of conta | 1e-10 | |
| cd05848 | 94 | cd05848, Ig1_Contactin-5, First Ig domain of conta | 1e-10 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 3e-10 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 3e-10 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 3e-10 | |
| cd05894 | 86 | cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) doma | 4e-10 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 6e-10 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 6e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 7e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 7e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 1e-09 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 1e-09 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 1e-09 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 1e-09 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 2e-09 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 2e-09 | |
| cd05750 | 75 | cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li | 2e-09 | |
| cd05750 | 75 | cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li | 2e-09 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 4e-09 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 4e-09 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 5e-09 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 5e-09 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 7e-09 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 9e-09 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 1e-08 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 1e-08 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 1e-08 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 1e-08 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 2e-08 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 2e-08 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 2e-08 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 2e-08 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 2e-08 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 3e-08 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 3e-08 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 3e-08 | |
| cd04967 | 91 | cd04967, Ig1_Contactin, First Ig domain of contact | 3e-08 | |
| cd04967 | 91 | cd04967, Ig1_Contactin, First Ig domain of contact | 3e-08 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 4e-08 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 4e-08 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 6e-08 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 6e-08 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 6e-08 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 6e-08 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 6e-08 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 7e-08 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 7e-08 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 8e-08 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 9e-08 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 9e-08 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 9e-08 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 9e-08 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 9e-08 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 9e-08 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 9e-08 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 9e-08 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 1e-07 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 1e-07 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 1e-07 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 1e-07 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 1e-07 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 1e-07 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 1e-07 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-07 | |
| cd05762 | 98 | cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like | 2e-07 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 2e-07 | |
| cd05743 | 78 | cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- | 2e-07 | |
| cd05743 | 78 | cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- | 2e-07 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 2e-07 | |
| cd04969 | 73 | cd04969, Ig5_Contactin_like, Fifth Ig domain of co | 2e-07 | |
| cd04969 | 73 | cd04969, Ig5_Contactin_like, Fifth Ig domain of co | 2e-07 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 2e-07 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 2e-07 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 4e-07 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 4e-07 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 4e-07 | |
| cd05851 | 88 | cd05851, Ig3_Contactin-1, Third Ig domain of conta | 4e-07 | |
| cd05851 | 88 | cd05851, Ig3_Contactin-1, Third Ig domain of conta | 4e-07 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 4e-07 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 5e-07 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 5e-07 | |
| cd05729 | 85 | cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) | 5e-07 | |
| cd05729 | 85 | cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) | 5e-07 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 6e-07 | |
| pfam00047 | 62 | pfam00047, ig, Immunoglobulin domain | 6e-07 | |
| pfam00047 | 62 | pfam00047, ig, Immunoglobulin domain | 6e-07 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 6e-07 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 6e-07 | |
| cd05894 | 86 | cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) doma | 9e-07 | |
| cd05728 | 85 | cd05728, Ig4_Contactin-2-like, Fourth Ig domain of | 9e-07 | |
| cd05728 | 85 | cd05728, Ig4_Contactin-2-like, Fourth Ig domain of | 9e-07 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 9e-07 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 1e-06 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 1e-06 | |
| cd05731 | 71 | cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig | 1e-06 | |
| cd05731 | 71 | cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig | 1e-06 | |
| cd07831 | 282 | cd07831, STKc_MOK, Catalytic domain of the Serine/ | 1e-06 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 1e-06 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 2e-06 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 2e-06 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 2e-06 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 2e-06 | |
| cd05857 | 85 | cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like | 2e-06 | |
| cd05857 | 85 | cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like | 2e-06 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 2e-06 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 2e-06 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 3e-06 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 3e-06 | |
| cd05729 | 85 | cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) | 3e-06 | |
| cd05729 | 85 | cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) | 3e-06 | |
| cd04971 | 81 | cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobuli | 3e-06 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 4e-06 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 4e-06 | |
| cd05733 | 77 | cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig | 4e-06 | |
| cd05733 | 77 | cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig | 4e-06 | |
| cd06647 | 293 | cd06647, STKc_PAK_I, Catalytic domain of the Prote | 4e-06 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 4e-06 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 5e-06 | |
| cd07855 | 334 | cd07855, STKc_ERK5, Catalytic domain of the Serine | 6e-06 | |
| cd05762 | 98 | cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like | 7e-06 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 1e-05 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 1e-05 | |
| cd07848 | 287 | cd07848, STKc_CDKL5, Catalytic domain of the Serin | 1e-05 | |
| cd08528 | 269 | cd08528, STKc_Nek10, Catalytic domain of the Prote | 1e-05 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 1e-05 | |
| cd07872 | 309 | cd07872, STKc_PCTAIRE2, Catalytic domain of the Se | 1e-05 | |
| PLN00034 | 353 | PLN00034, PLN00034, mitogen-activated protein kina | 1e-05 | |
| cd05726 | 90 | cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like | 2e-05 | |
| cd05726 | 90 | cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like | 2e-05 | |
| cd04976 | 71 | cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-lik | 2e-05 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 2e-05 | |
| cd05723 | 71 | cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- | 2e-05 | |
| cd05723 | 71 | cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- | 2e-05 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 3e-05 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 3e-05 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 3e-05 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 3e-05 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 3e-05 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 3e-05 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 4e-05 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 4e-05 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 4e-05 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 4e-05 | |
| cd04968 | 88 | cd04968, Ig3_Contactin_like, Third Ig domain of co | 4e-05 | |
| cd04968 | 88 | cd04968, Ig3_Contactin_like, Third Ig domain of co | 4e-05 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 4e-05 | |
| cd05870 | 98 | cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-lik | 4e-05 | |
| cd05870 | 98 | cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-lik | 4e-05 | |
| cd05857 | 85 | cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like | 5e-05 | |
| cd05857 | 85 | cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like | 5e-05 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 5e-05 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 5e-05 | |
| cd06655 | 296 | cd06655, STKc_PAK2, Catalytic domain of the Protei | 5e-05 | |
| cd05869 | 97 | cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-lik | 5e-05 | |
| cd05869 | 97 | cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-lik | 5e-05 | |
| cd04972 | 90 | cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul | 6e-05 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 7e-05 | |
| cd07873 | 301 | cd07873, STKc_PCTAIRE1, Catalytic domain of the Se | 7e-05 | |
| cd05743 | 78 | cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- | 8e-05 | |
| cd05743 | 78 | cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- | 8e-05 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 8e-05 | |
| cd05747 | 92 | cd05747, Ig5_Titin_like, M5, fifth immunoglobulin | 9e-05 | |
| cd05747 | 92 | cd05747, Ig5_Titin_like, M5, fifth immunoglobulin | 9e-05 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 9e-05 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 1e-04 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 1e-04 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 1e-04 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 1e-04 | |
| cd07871 | 288 | cd07871, STKc_PCTAIRE3, Catalytic domain of the Se | 1e-04 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 1e-04 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 1e-04 | |
| cd08218 | 256 | cd08218, STKc_Nek1, Catalytic domain of the Protei | 1e-04 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 2e-04 | |
| cd05747 | 92 | cd05747, Ig5_Titin_like, M5, fifth immunoglobulin | 2e-04 | |
| cd05747 | 92 | cd05747, Ig5_Titin_like, M5, fifth immunoglobulin | 2e-04 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 2e-04 | |
| cd05895 | 76 | cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)- | 2e-04 | |
| cd05895 | 76 | cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)- | 2e-04 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 2e-04 | |
| cd05763 | 75 | cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) | 2e-04 | |
| cd05763 | 75 | cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) | 2e-04 | |
| cd06656 | 297 | cd06656, STKc_PAK3, Catalytic domain of the Protei | 2e-04 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 2e-04 | |
| cd05864 | 70 | cd05864, Ig2_VEGFR-2, Second immunoglobulin (Ig)-l | 2e-04 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 3e-04 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 3e-04 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 3e-04 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 3e-04 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 3e-04 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 3e-04 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 3e-04 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 3e-04 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 3e-04 | |
| cd06654 | 296 | cd06654, STKc_PAK1, Catalytic domain of the Protei | 3e-04 | |
| cd05852 | 73 | cd05852, Ig5_Contactin-1, Fifth Ig domain of conta | 3e-04 | |
| cd05852 | 73 | cd05852, Ig5_Contactin-1, Fifth Ig domain of conta | 3e-04 | |
| cd05726 | 90 | cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like | 4e-04 | |
| cd05726 | 90 | cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like | 4e-04 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 4e-04 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 5e-04 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 5e-04 | |
| cd05737 | 92 | cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob | 5e-04 | |
| cd06620 | 284 | cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of | 5e-04 | |
| cd05764 | 74 | cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) | 5e-04 | |
| cd05764 | 74 | cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) | 5e-04 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 5e-04 | |
| cd05875 | 77 | cd05875, Ig6_hNeurofascin_like, Sixth immunoglobul | 5e-04 | |
| cd05875 | 77 | cd05875, Ig6_hNeurofascin_like, Sixth immunoglobul | 5e-04 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 5e-04 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 6e-04 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 6e-04 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 6e-04 | |
| cd04972 | 90 | cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul | 6e-04 | |
| cd04972 | 90 | cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul | 6e-04 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 6e-04 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 6e-04 | |
| pfam13927 | 74 | pfam13927, Ig_3, Immunoglobulin domain | 6e-04 | |
| pfam13927 | 74 | pfam13927, Ig_3, Immunoglobulin domain | 6e-04 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 7e-04 | |
| cd06615 | 308 | cd06615, PKc_MEK, Catalytic domain of the dual-spe | 7e-04 | |
| cd06649 | 331 | cd06649, PKc_MEK2, Catalytic domain of the dual-sp | 8e-04 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 8e-04 | |
| cd06658 | 292 | cd06658, STKc_PAK5, Catalytic domain of the Protei | 9e-04 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 0.001 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 0.001 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 0.001 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 0.001 | |
| cd05747 | 92 | cd05747, Ig5_Titin_like, M5, fifth immunoglobulin | 0.001 | |
| cd05763 | 75 | cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) | 0.001 | |
| cd05763 | 75 | cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) | 0.001 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 0.001 | |
| cd06637 | 272 | cd06637, STKc_TNIK, Catalytic domain of the Protei | 0.001 | |
| cd06622 | 286 | cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of | 0.001 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 0.001 | |
| cd06639 | 291 | cd06639, STKc_myosinIIIB, Catalytic domain of the | 0.001 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 0.002 | |
| cd04976 | 71 | cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-lik | 0.002 | |
| cd08228 | 267 | cd08228, STKc_Nek6, Catalytic domain of the Protei | 0.002 | |
| cd05760 | 77 | cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like | 0.002 | |
| cd05760 | 77 | cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like | 0.002 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 0.002 | |
| cd05876 | 71 | cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik | 0.002 | |
| cd05876 | 71 | cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik | 0.002 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 0.002 | |
| cd08225 | 257 | cd08225, STKc_Nek5, Catalytic domain of the Protei | 0.002 | |
| cd05856 | 82 | cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I | 0.002 | |
| cd05856 | 82 | cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I | 0.002 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 0.003 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 0.003 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 0.003 | |
| cd08221 | 256 | cd08221, STKc_Nek9, Catalytic domain of the Protei | 0.003 | |
| cd05858 | 90 | cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-lik | 0.003 | |
| cd05858 | 90 | cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-lik | 0.003 | |
| cd08219 | 255 | cd08219, STKc_Nek3, Catalytic domain of the Protei | 0.003 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 0.003 | |
| cd04978 | 76 | cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin | 0.004 | |
| cd04978 | 76 | cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin | 0.004 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 0.004 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 0.004 | |
| cd07869 | 303 | cd07869, STKc_PFTAIRE1, Catalytic domain of the Se | 0.004 |
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
Score = 98.5 bits (246), Expect = 3e-24
Identities = 32/90 (35%), Positives = 47/90 (52%)
Query: 481 PEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLII 540
P+ ++ + +A+F CT+TG P PT+SW K + + S R + EG TYTL I
Sbjct: 1 PKFTQKPKDVEVQEGESARFTCTVTGDPDPTVSWFKDGQPLRSSDRFKVTYEGGTYTLTI 60
Query: 541 NSVYGVDADEYVCRAVNKGGVKSTKAELII 570
++V D +Y C A N G AEL +
Sbjct: 61 SNVQPDDEGKYTCVATNSAGEAEASAELTV 90
|
Length = 90 |
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143302 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143256 cd05848, Ig1_Contactin-5, First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >gnl|CDD|143256 cd05848, Ig1_Contactin-5, First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|143302 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|143239 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143259 cd05851, Ig3_Contactin-1, Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143259 cd05851, Ig3_Contactin-1, Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143302 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143172 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|143239 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143177 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|143278 cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143278 cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143277 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143277 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143303 cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143303 cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143272 cd05864, Ig2_VEGFR-2, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143283 cd05875, Ig6_hNeurofascin_like, Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >gnl|CDD|143283 cd05875, Ig6_hNeurofascin_like, Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|143177 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|143266 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >gnl|CDD|143266 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2245 | |||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG4222|consensus | 1281 | 100.0 | ||
| KOG4222|consensus | 1281 | 100.0 | ||
| KOG4194|consensus | 873 | 99.95 | ||
| KOG4194|consensus | 873 | 99.94 | ||
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 99.9 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 99.88 | |
| KOG3515|consensus | 741 | 99.84 | ||
| KOG3515|consensus | 741 | 99.84 | ||
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 99.77 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 99.68 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.67 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.62 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 99.57 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 99.54 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 99.53 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.52 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 99.52 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 99.52 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 99.52 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 99.51 | |
| KOG0196|consensus | 996 | 99.5 | ||
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 99.5 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 99.49 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 99.49 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 99.48 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 99.48 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 99.47 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 99.47 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 99.46 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 99.46 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 99.46 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 99.45 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 99.45 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 99.45 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 99.45 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 99.44 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 99.44 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 99.44 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.43 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 99.43 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 99.43 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 99.43 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.43 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 99.42 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 99.42 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 99.42 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 99.42 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 99.41 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 99.41 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 99.41 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 99.4 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.4 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 99.4 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 99.39 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 99.39 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 99.39 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 99.38 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 99.38 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 99.38 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 99.38 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 99.37 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.37 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 99.36 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.35 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 99.35 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 99.35 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 99.35 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 99.35 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 99.35 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 99.35 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 99.35 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 99.35 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 99.34 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 99.34 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 99.34 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 99.34 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 99.34 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 99.33 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 99.33 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 99.33 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 99.33 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 99.33 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 99.33 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 99.32 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 99.32 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 99.31 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 99.31 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 99.31 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 99.3 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 99.3 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 99.3 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 99.3 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.3 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 99.29 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 99.29 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 99.29 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.29 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 99.29 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 99.29 | |
| KOG0196|consensus | 996 | 99.28 | ||
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 99.28 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 99.28 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 99.28 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 99.28 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 99.28 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 99.28 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 99.28 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 99.28 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 99.27 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 99.27 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 99.27 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 99.26 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.26 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 99.25 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 99.25 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 99.25 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 99.24 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 99.24 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 99.23 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 99.23 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 99.23 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 99.23 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 99.21 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 99.21 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 99.21 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 99.21 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 99.2 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 99.2 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 99.19 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 99.19 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 99.19 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 99.19 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 99.19 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 99.19 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.18 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 99.18 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 99.17 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 99.17 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 99.17 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 99.17 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 99.16 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 99.16 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 99.16 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 99.15 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 99.15 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 99.15 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 99.14 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 99.14 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 99.14 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 99.14 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 99.13 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 99.13 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 99.12 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 99.12 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 99.11 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 99.11 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 99.09 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 99.08 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 99.07 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 99.06 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 99.06 | |
| KOG0613|consensus | 1205 | 99.05 | ||
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 99.05 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 99.04 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 99.04 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 99.02 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 99.01 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 99.01 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 99.01 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 99.0 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 99.0 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 99.0 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 98.99 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 98.99 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 98.99 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 98.98 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 98.95 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 98.95 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 98.95 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 98.94 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 98.94 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 98.94 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 98.93 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 98.93 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 98.92 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 98.89 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 98.88 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 98.88 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 98.87 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 98.86 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 98.83 | |
| KOG4258|consensus | 1025 | 98.83 | ||
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 98.8 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 98.8 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 98.79 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 98.79 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 98.78 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 98.77 | |
| KOG4258|consensus | 1025 | 98.77 | ||
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 98.75 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 98.74 | |
| KOG0613|consensus | 1205 | 98.74 | ||
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 98.74 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 98.73 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 98.72 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 98.72 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 98.7 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 98.7 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 98.68 | |
| smart00409 | 86 | IG Immunoglobulin. | 98.68 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 98.67 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 98.67 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 98.67 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 98.65 | |
| smart00409 | 86 | IG Immunoglobulin. | 98.65 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 98.65 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 98.65 | |
| PHA03376 | 221 | BARF1; Provisional | 98.65 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 98.59 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 98.59 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 98.58 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 98.58 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 98.56 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 98.55 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 98.54 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 98.53 | |
| KOG4802|consensus | 516 | 98.53 | ||
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 98.52 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 98.49 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 98.49 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 98.48 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 98.46 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 98.41 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 98.41 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 98.41 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 98.4 | |
| PHA03376 | 221 | BARF1; Provisional | 98.4 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 98.29 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 98.27 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 98.25 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 98.24 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 98.24 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 98.21 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 98.16 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 98.16 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.16 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 98.15 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 98.13 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 98.12 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.11 | |
| cd05883 | 82 | Ig2_Necl-2 Second immunoglobulin (Ig)-like domain | 98.1 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 98.08 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.08 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.06 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 98.06 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.05 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 98.04 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.04 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 98.03 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 98.02 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 98.02 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 98.01 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 97.99 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 97.99 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 97.97 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 97.96 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 97.96 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 97.94 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 97.92 | |
| cd05883 | 82 | Ig2_Necl-2 Second immunoglobulin (Ig)-like domain | 97.91 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 97.91 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 97.9 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 97.9 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 97.88 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 97.88 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 97.86 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 97.86 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 97.85 | |
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 97.84 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 97.84 | |
| cd07705 | 83 | Ig2_Necl-1 Second immunoglobulin (Ig)-like domain | 97.84 | |
| cd05755 | 100 | Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do | 97.84 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 97.76 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 97.74 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 97.74 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 97.72 | |
| KOG4802|consensus | 516 | 97.71 | ||
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 97.71 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 97.66 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 97.64 | |
| cd07705 | 83 | Ig2_Necl-1 Second immunoglobulin (Ig)-like domain | 97.64 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 97.64 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 97.62 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 97.61 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 97.6 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 97.6 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 97.6 | |
| cd05755 | 100 | Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do | 97.58 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 97.57 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 97.56 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 97.54 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 97.53 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 97.53 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 97.51 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 97.5 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 97.49 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 97.46 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 97.45 | |
| cd05884 | 83 | Ig2_Necl-3 Second immunoglobulin (Ig)-like domain | 97.45 | |
| cd07698 | 93 | IgC_MHC_I_alpha3 Class I major histocompatibility | 97.44 | |
| KOG1480|consensus | 909 | 97.44 | ||
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 97.44 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 97.42 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 97.41 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 97.41 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 97.4 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 97.4 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 97.38 | |
| cd05884 | 83 | Ig2_Necl-3 Second immunoglobulin (Ig)-like domain | 97.37 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 97.35 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 97.34 | |
| cd05772 | 111 | IgC_SIRP Signal-regulatory protein (SIRP) immunogl | 97.27 | |
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 97.24 | |
| KOG1480|consensus | 909 | 97.24 | ||
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 97.22 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 97.21 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 97.19 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 97.17 | |
| cd05772 | 111 | IgC_SIRP Signal-regulatory protein (SIRP) immunogl | 97.14 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 97.12 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 97.1 | |
| PF08205 | 89 | C2-set_2: CD80-like C2-set immunoglobulin domain ; | 97.09 | |
| cd07698 | 93 | IgC_MHC_I_alpha3 Class I major histocompatibility | 97.05 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 97.05 | |
| PF08205 | 89 | C2-set_2: CD80-like C2-set immunoglobulin domain ; | 97.03 | |
| cd05766 | 94 | IgC_MHC_II_beta Class II major histocompatibility | 96.93 | |
| cd05770 | 93 | IgC_beta2m Class I major histocompatibility comple | 96.9 | |
| smart00407 | 75 | IGc1 Immunoglobulin C-Type. | 96.89 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 96.89 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 96.86 | |
| cd05767 | 94 | IgC_MHC_II_alpha Class II major histocompatibility | 96.8 | |
| PHA03270 | 466 | envelope glycoprotein C; Provisional | 96.76 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 96.75 | |
| PHA03271 | 490 | envelope glycoprotein C; Provisional | 96.75 | |
| PHA03273 | 486 | envelope glycoprotein C; Provisional | 96.73 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 96.71 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 96.65 | |
| cd07699 | 100 | IgC_L Immunoglobulin Constant domain. IgC_L: Immun | 96.65 | |
| KOG1026|consensus | 774 | 96.63 | ||
| cd07699 | 100 | IgC_L Immunoglobulin Constant domain. IgC_L: Immun | 96.62 | |
| cd05719 | 95 | Ig2_PVR_like Second immunoglobulin (Ig) domain of | 96.6 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 96.56 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 96.54 | |
| smart00407 | 75 | IGc1 Immunoglobulin C-Type. | 96.54 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 96.54 | |
| cd05766 | 94 | IgC_MHC_II_beta Class II major histocompatibility | 96.54 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 96.51 | |
| cd05847 | 94 | IgC_CH2_IgE CH2 domain (second constant Ig domain | 96.47 | |
| cd05767 | 94 | IgC_MHC_II_alpha Class II major histocompatibility | 96.44 | |
| cd05770 | 93 | IgC_beta2m Class I major histocompatibility comple | 96.39 | |
| cd05719 | 95 | Ig2_PVR_like Second immunoglobulin (Ig) domain of | 96.37 | |
| cd05847 | 94 | IgC_CH2_IgE CH2 domain (second constant Ig domain | 96.36 | |
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 96.32 | |
| cd05769 | 115 | IgC_TCR_beta T cell receptor (TCR) beta chain cons | 96.29 | |
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 96.15 | |
| PHA03271 | 490 | envelope glycoprotein C; Provisional | 96.09 | |
| cd05768 | 102 | IgC_CH4 CH4 domain (fourth constant Ig domain of t | 96.08 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 96.04 | |
| PF07654 | 83 | C1-set: Immunoglobulin C1-set domain; InterPro: IP | 95.98 | |
| cd07696 | 96 | IgC_CH3 CH3 domain (third constant Ig domain of th | 95.96 | |
| cd05768 | 102 | IgC_CH4 CH4 domain (fourth constant Ig domain of t | 95.91 | |
| cd07703 | 95 | Ig2_Nectin-2_like Second immunoglobulin (Ig) domai | 95.91 | |
| cd07697 | 96 | IgC_TCR_gamma T cell receptor (TCR) gamma chain co | 95.87 | |
| cd07696 | 96 | IgC_CH3 CH3 domain (third constant Ig domain of th | 95.79 | |
| cd07703 | 95 | Ig2_Nectin-2_like Second immunoglobulin (Ig) domai | 95.75 | |
| PHA03270 | 466 | envelope glycoprotein C; Provisional | 95.68 | |
| cd05769 | 115 | IgC_TCR_beta T cell receptor (TCR) beta chain cons | 95.67 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 95.66 | |
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 95.61 | |
| cd07697 | 96 | IgC_TCR_gamma T cell receptor (TCR) gamma chain co | 95.48 | |
| cd07704 | 97 | Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom | 95.48 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 95.47 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 95.46 | |
| KOG4597|consensus | 560 | 95.44 | ||
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 95.34 | |
| cd04985 | 95 | IgC_CH1 CH1 domain (first constant Ig domain of th | 95.28 | |
| PF07654 | 83 | C1-set: Immunoglobulin C1-set domain; InterPro: IP | 95.27 | |
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 95.18 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 95.1 | |
| PHA03273 | 486 | envelope glycoprotein C; Provisional | 94.92 | |
| cd07689 | 99 | Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain | 94.92 | |
| cd04985 | 95 | IgC_CH1 CH1 domain (first constant Ig domain of th | 94.81 | |
| cd07704 | 97 | Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom | 94.73 | |
| cd07689 | 99 | Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain | 94.56 | |
| KOG4367|consensus | 699 | 94.46 | ||
| KOG4228|consensus | 1087 | 94.27 | ||
| PHA02914 | 500 | Immunoglobulin-like domain protein; Provisional | 94.13 | |
| KOG4152|consensus | 830 | 93.9 | ||
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 93.65 | |
| KOG4367|consensus | 699 | 93.38 | ||
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 93.09 | |
| cd04986 | 99 | IgC_CH2 CH2 domain (second constant Ig domain of t | 93.06 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 92.85 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 92.8 | |
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 92.72 | |
| cd04986 | 99 | IgC_CH2 CH2 domain (second constant Ig domain of t | 92.47 | |
| KOG4152|consensus | 830 | 92.33 | ||
| KOG3632|consensus | 1335 | 92.08 | ||
| KOG4597|consensus | 560 | 91.69 | ||
| PHA02914 | 500 | Immunoglobulin-like domain protein; Provisional | 90.13 | |
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 89.75 | |
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 89.62 | |
| KOG1026|consensus | 774 | 88.83 | ||
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 88.65 | |
| PHA03042 | 286 | CD47-like protein; Provisional | 88.3 | |
| KOG3632|consensus | 1335 | 87.87 | ||
| PF02124 | 211 | Marek_A: Marek's disease glycoprotein A; InterPro: | 87.83 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 87.09 | |
| KOG0200|consensus | 609 | 87.01 | ||
| PHA03042 | 286 | CD47-like protein; Provisional | 86.9 | |
| PHA03283 | 542 | envelope glycoprotein E; Provisional | 86.27 | |
| PF03921 | 91 | ICAM_N: Intercellular adhesion molecule (ICAM), N- | 84.24 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 83.87 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 83.72 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 83.26 | |
| KOG4806|consensus | 454 | 82.36 | ||
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 82.2 | |
| PF06328 | 89 | Lep_receptor_Ig: Ig-like C2-type domain; InterPro: | 82.09 | |
| PF05790 | 80 | C2-set: Immunoglobulin C2-set domain; InterPro: IP | 81.57 | |
| PF05790 | 80 | C2-set: Immunoglobulin C2-set domain; InterPro: IP | 80.95 | |
| PHA02865 | 338 | MHC-like TNF binding protein; Provisional | 80.54 | |
| KOG0595|consensus | 429 | 80.36 | ||
| PF06328 | 89 | Lep_receptor_Ig: Ig-like C2-type domain; InterPro: | 80.34 |
| >KOG3513|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-75 Score=716.04 Aligned_cols=802 Identities=25% Similarity=0.347 Sum_probs=628.6
Q ss_pred cCCcceEEecc---------eeeeeceEEECCCc-cCCcEEEEEEEEcCCCCCCCCCccccEEEeeccCCCCCceec-CC
Q psy7042 29 VGGAIWLKCND---------YNVLECSFSVLNLV-EGNDYEFRIIAVNAIGKSEPSICTTPVKICEFVGGEKPDFIV-PL 97 (2245)
Q Consensus 29 ~~~~~w~~~~~---------~~~~~~~l~i~~~~-~~d~G~Y~C~a~n~~g~~~~~~~~~~~~v~~~~~~~~P~~~~-~~ 97 (2245)
..+-+|++||. .....++|.|++.. ..|.|.|+|.|+|..|...+....... ...+.|.. ..
T Consensus 71 ~Psy~W~kng~~~d~~~~~~~~~~~G~lvI~~p~~~~d~G~YqC~AsN~~Gta~S~~~~l~~-------~~i~~F~~e~~ 143 (1051)
T KOG3513|consen 71 EPSYRWTKNGTEFDPTEYPRVSVLGGTLVITNPDAALDQGIYQCFASNKLGTAVSREARLQF-------GFIPKFKKEER 143 (1051)
T ss_pred CceeEEEECCeecccccccceeeecCceEecCCcchhhcceeEEEeecccceeeccceeecc-------cccccCccccC
Confidence 34457888775 22347899999998 999999999999999998765433221 35677764 56
Q ss_pred cceEEeCCCeEEEEEEE-eeecCCceEEEECCeec-c--CCCeEEEEEcCcEEEEEEeeeccCCCeEEEEEEEcCcccce
Q psy7042 98 KDLVVPLGKLLTLQCEA-TGTPVPKCRWLRNGREI-S--SGARYRVETAGGVFRLHFNEVTDVDNGDYTCEAYNSVGFAH 173 (2245)
Q Consensus 98 ~~~~v~~G~~v~L~C~~-~g~p~~~i~W~~~g~~l-~--~~~~~~~~~~~~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~ 173 (2245)
+.+.+.+|+.+.|.|.. .+.|.+++.|..+..+- . .+.|+.....|. |.|.++..+|.+.|.|.|.+......
T Consensus 144 ~~v~v~eG~~~~L~C~pP~~~P~l~~~W~~~~~~~~~~~~~~r~~~~~~G~---Lyfs~V~~~D~~~Y~C~a~~~~~~~~ 220 (1051)
T KOG3513|consen 144 SPVEVEEGDGVVLPCNPPAHFPPLRYYWMLNEFPHFVQIDNRRVFSQENGN---LYFSNVETSDFGNYICSATFPSTQTI 220 (1051)
T ss_pred CcEEEEeCCceEEeCCCCCCCCCccEEehhccCCcccccCcceeEecccce---EEEeecchhhcCceEEEEEchhhccc
Confidence 67899999999999998 56788999998865432 2 223666666554 99999999999999999998443222
Q ss_pred ---eEEEEEe-------cCCCeeecC-CCceEEcCCCeEEEEEEEecCCCceEEEeeCceeeecCCceEEEEeCCeEEEE
Q psy7042 174 ---TSSRVKI-------GTPPRIDRM-PNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIF 242 (2245)
Q Consensus 174 ---~~~~l~V-------~~~P~~~~~-~~~~~v~~G~~~~l~C~~~g~p~~~i~W~~~g~~l~~~~~~~~~~~~~~~~L~ 242 (2245)
.-+.|++ ..+|+|... |.......|+.+.|.|.+.|+|.|.|.|+|.|.....+ +.... ....+|.
T Consensus 221 v~~~~~~L~~~~~~~~~~~~P~i~~~~p~~~~a~~G~~v~LECfA~G~P~P~i~W~k~~g~~~~~-r~~~~--~~~~vL~ 297 (1051)
T KOG3513|consen 221 VQGPPFPLIVRSNNVMREYAPKILVPFPETETALKGQSVKLECFALGNPTPQIKWRKVDGKPPPR-RATYS--NYGKVLK 297 (1051)
T ss_pred ccCCceeEEEcccccccccCCccccCCCCcccccCCCeEEEEEEecCCCCCcEEEEeCCCCCCCc-ceeee--ccccEEE
Confidence 1344555 346776654 55778889999999999999999999999977642222 22222 2334899
Q ss_pred EcccCccCceeEEEEEEcCCcceEEEEEEEEecCCCCCCCCcccceeeccceEEEecCCCCCCCceeEEEEEEEEecCCC
Q psy7042 243 IKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMP 322 (2245)
Q Consensus 243 i~~~~~~d~G~Y~C~a~n~~g~~~~~~~l~V~~~p~~~~~~~~~~~~~~~s~~~~w~pp~~~~~~~~~~~~~~~~~~~~~ 322 (2245)
|.+++.+|+|.|+|.|.|..|.......|+|..+|.....+-
T Consensus 298 I~nv~~~D~G~Y~C~AeN~~G~~~~~~~v~v~a~P~w~~~~~-------------------------------------- 339 (1051)
T KOG3513|consen 298 IPNVQYEDAGEYECIAENSRGSATHSGHVTVYAPPYWLQKPQ-------------------------------------- 339 (1051)
T ss_pred ecccCcCCCeEEEEEEecccccceeeEEEEEecCchhhcccc--------------------------------------
Confidence 999999999999999999999999999999998886432211
Q ss_pred ceEEeeeccCcceEEEcCCCCCCEEEEEEEEEecCCCCCCCCCCCceecCCCCCCCCCCCCcEEEeecCCeeEEEecCCC
Q psy7042 323 HWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPL 402 (2245)
Q Consensus 323 ~~~~~~~~~~~~~~~i~~l~~~~~~~~~c~a~n~~g~~~~~~~~~~~~~~~~~~~p~~~~~~~v~~~~~~~~~l~W~~~~ 402 (2245)
-..+..+....+.|.|. +.+...++|.+++
T Consensus 340 ---------------d~~~~~gs~v~~eC~a~-----------------------------------g~P~p~v~WlkNg 369 (1051)
T KOG3513|consen 340 ---------------DTEADTGSNVTLECKAS-----------------------------------GKPNPTVKWLKNG 369 (1051)
T ss_pred ---------------eeEecCCCCeEEEEEec-----------------------------------CCCCCceEEeeCC
Confidence 11234577778888883 3444689999864
Q ss_pred CCCCC--CccEEEEEeeecCCCCcEEEeeeecCCceeecCCcccCceEEEEEEeecCCCCCCCCCCCCcEEecCCcccCC
Q psy7042 403 DDGGS--RIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKA 480 (2245)
Q Consensus 403 ~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~l~~~~~g~y~c~a~n~~g~~~~s~~~~~v~~~~~~~~~~ 480 (2245)
..... ...++.+ ....|.|.++...|+|+|+|.|.|..|... ++..+.|. ..+
T Consensus 370 ~pl~~~~r~~~~~i------------------~~g~L~is~v~~~dsg~YQC~A~Nk~G~i~---anA~L~V~----a~~ 424 (1051)
T KOG3513|consen 370 EPLEPAERDPRYKI------------------DDGTLIISNVQESDSGVYQCIAENKYGTIY---ANAELKVL----ASA 424 (1051)
T ss_pred eecCccCCCcceEE------------------eCCEEEEEecccccCeEEEeeeecccceEe---eeeEEEEE----ccC
Confidence 43221 1111111 236799999999999999999999999765 33344443 245
Q ss_pred Cceeccccc--cccccccceeeEEEEeccCcCeEEEEeCCeecCCCccEEEEeeCCeEEEEEecccccCCceEEEEEEeC
Q psy7042 481 PEIIVPLRN--ANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNK 558 (2245)
Q Consensus 481 p~~~~~~~~--~~~~~g~~~~l~C~~~g~p~~~v~W~~~~~~i~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~n~ 558 (2245)
|.|...+-. ..+..|.++.|.|...+.|.+.+.|.|+++.+..+.|+.+..+| +|.|.+++.+|+|.|+|.|.|.
T Consensus 425 P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~~~~r~~i~edG---tL~I~n~t~~DaG~YtC~A~N~ 501 (1051)
T KOG3513|consen 425 PVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLLQSGRIRILEDG---TLEISNVTRSDAGKYTCVAENK 501 (1051)
T ss_pred CCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEcCCcccccCceEEECCCC---cEEecccCcccCcEEEEEEEcc
Confidence 777666644 46788999999999999999999999999988889999999999 7999999999999999999999
Q ss_pred CCCCCcceeEeEecCCCCCCCCCcccceEeeCCCeEEEEEeeeecCC--CeEEEEeCCeEee---ccCeEEEEecCCeEE
Q psy7042 559 GGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPK--PKITWYRDNEVIE---SGGHFHVETSERHAI 633 (2245)
Q Consensus 559 ~g~~~~~~~l~v~~~p~~~~~p~~~~~~~~~~g~~~~l~C~~~g~p~--~~i~W~~~~~~~~---~~~~~~~~~~~~~~~ 633 (2245)
.|.....+.|.|+.++.|..+|.. ..+..|+.++|.|++..+|. +.|.|.+||..+. .+.++......+...
T Consensus 502 ~G~a~~~~~L~Vkd~tri~~~P~~---~~v~~g~~v~l~Ce~shD~~ld~~f~W~~nG~~id~~~~~~~~~~~~~~~~g~ 578 (1051)
T KOG3513|consen 502 LGKAESTGNLIVKDATRITLAPSN---TDVKVGESVTLTCEASHDPSLDITFTWKKNGRPIDFNPDGDHFEINDGSDSGR 578 (1051)
T ss_pred cCccceEEEEEEecCceEEeccch---hhhccCceEEEEeecccCCCcceEEEEEECCEEhhccCCCCceEEeCCcCccc
Confidence 999999999999999999887753 45788999999999987764 5799999999763 445555554444478
Q ss_pred EEEcCCCCCcCEEEEEEEEeCCCCceeEEEEEeeCCCCCCCCCeeeeecCCcEEEEeeCCCCCCCcccccEEEEeeeCCC
Q psy7042 634 LTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPM 713 (2245)
Q Consensus 634 l~i~~~~~~d~g~y~C~a~n~~g~~~~~~~l~v~~~P~~p~~~~~~~~~~~si~lsW~~p~~~~~~~~~~y~v~~~~~~~ 713 (2245)
|+|.+++..|+|.|.|+|.....+.++.+.+.|.++|.||.++.+.+++.+++.|+|+ |+.|++++|..|.|+.+....
T Consensus 579 L~i~nv~l~~~G~Y~C~aqT~~Ds~s~~A~l~V~gpPgpP~~v~~~~i~~t~~~lsW~-~g~dn~SpI~~Y~iq~rt~~~ 657 (1051)
T KOG3513|consen 579 LTIANVSLEDSGKYTCVAQTALDSASARADLLVRGPPGPPPDVHVDDISDTTARLSWS-PGSDNNSPIEKYTIQFRTPFP 657 (1051)
T ss_pred eEEEeeccccCceEEEEEEEeecchhcccceEEecCCCCCCceeEeeeccceEEEEee-cCCCCCCCceEEeEEecCCCC
Confidence 9999999999999999999999999999999999999999999999999999999999 556777899999999999988
Q ss_pred CCeEEEce---eee--eeEEEecCCCCCEEEEEEEEEecccCCCCCCCCccEEecCccccccccccccccCCCceeeccc
Q psy7042 714 SSWIRVGN---TRF--TTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTKDTFKKQIKKRQYDFDETGKKIRGKA 788 (2245)
Q Consensus 714 ~~w~~~~~---~~~--~~~~i~~L~p~t~y~~~v~a~n~~G~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~ 788 (2245)
..|..+.. ... .+.++.+|.|...|+|||.|+|..|.|++|..++...|.++.|
T Consensus 658 ~~W~~v~~vp~~~~~~~sa~vv~L~Pwv~YeFRV~AvN~iG~gePS~pS~~~rT~ea~P--------------------- 716 (1051)
T KOG3513|consen 658 GKWKAVTTVPGNITGDESATVVNLSPWVEYEFRVVAVNSIGIGEPSPPSEKVRTPEAAP--------------------- 716 (1051)
T ss_pred CcceEeeECCCcccCccceeEEccCCCcceEEEEEEEcccccCCCCCCccceecCCCCC---------------------
Confidence 89987652 111 3577999999999999999999999999999999888777543
Q ss_pred ccccccCCceEEEEeeeccCccccccccceecccccccccccCceeEEEEeeecccCCeeEEEeeccCCchhhhhhheee
Q psy7042 789 DEKVSDYDQYVFDIYSKYVPQPVDIKTSSVYDHYDILEEIGTGAFGVVHRCRERKTGNIFAAKFIPVSHNLEKELIRKEI 868 (2245)
Q Consensus 789 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 868 (2245)
T Consensus 717 -------------------------------------------------------------------------------- 716 (1051)
T KOG3513|consen 717 -------------------------------------------------------------------------------- 716 (1051)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred eeeeccCCCceEeecccccCCcceEEEEEEecCCCCCcccEEeeeeCceEEEEecCC--CCCCCCccceEEEeeeecCCC
Q psy7042 869 DIMNQLHHPKLINLHDAFEDDDEMVLIFEVLDRPHPPENLHADEFAGDSLTLYWTPP--RDNGGSEITNYVVEKKDYNST 946 (2245)
Q Consensus 869 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~p~~l~~~~~~~~~~~l~W~~p--~~~~g~~i~~y~i~~~~~~~~ 946 (2245)
-..|.++.......+.+.|+|+|- ...+| +-.+|+|.|++.+..
T Consensus 717 ---------------------------------~~~P~nv~g~g~~~~eLvItW~Pl~~~~qNG-~gfgY~Vswr~~g~~ 762 (1051)
T KOG3513|consen 717 ---------------------------------SVNPSNVKGGGGSPTELVITWEPLPEEEQNG-PGFGYRVSWRPQGAD 762 (1051)
T ss_pred ---------------------------------ccCCccccccCCCCceEEEEeccCCHHHccC-CCceEEEEEEeCCCC
Confidence 135667777667788899999984 34454 889999999998888
Q ss_pred -ceEEeccee-eeceEEE--ecCCCCceeeEEEEEEeccccCCCccccCcccccCCCCCCC-CCCCCeeEeecCCeEEEE
Q psy7042 947 -VWTKVSSYV-TTPFVRV--RNLAIGSTYEFRVMAENQYGLSKPALTIDPIKAKHPFDVPG-APGAPKGVDSTEDSISLV 1021 (2245)
Q Consensus 947 -~~~~~~~~~-~~~~~~i--~~L~p~~~y~~~v~a~n~~g~~~~s~~~~~~~~~t~~~~p~-~p~~~~~~~~~~~~v~l~ 1021 (2245)
.|++..... ....+.+ .-..|++.|++.|.|.|+.|.|+.+. .+.+...++.|. +|..+.+...+.+.+.|+
T Consensus 763 ~~W~~~~v~~~d~~~~V~~~~st~~~tpyevKVqa~N~~GeGp~s~---~~v~~S~Ed~P~~ap~~~~~~~~s~s~~~v~ 839 (1051)
T KOG3513|consen 763 KEWKEVIVSNQDQPRYVVSNESTEPFTPYEVKVQAINDQGEGPESQ---VTVGYSGEDEPPVAPTKLSAKPLSSSEVNLS 839 (1051)
T ss_pred cccceeEecccCCceEEEcCCCCCCcceeEEEEEEecCCCCCCCCc---eEEEEcCCCCCCCCCccceeecccCceEEEE
Confidence 898766544 2334444 44667999999999999999998874 444444566665 999999999999999999
Q ss_pred ecCCCCCCCCccceEEEEEEecCCccceeccccccCCcceeEEEEeecccccCCccCchhhhhhhhhcccccccccccCC
Q psy7042 1022 WSKPRHDGGSPIQRYIVEKRLISDDKWIKASMAHIPDTSLKYVLWVSEGKSIGSERGSTAQFLELLLMFIPNRVTSLIEN 1101 (2245)
Q Consensus 1022 W~~p~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~~~ 1101 (2245)
|++|...+| .+.+|.|+|...++.. ..+....+.... .. ..|.||+++
T Consensus 840 W~~~~~~nG-~l~gY~v~Y~~~~~~~-~~~~~~~i~~~~---~~---------------------------~~ltgL~~~ 887 (1051)
T KOG3513|consen 840 WKPPLWDNG-KLTGYEVKYWKINEKE-GSLSRVQIAGNR---TS---------------------------WRLTGLEPN 887 (1051)
T ss_pred ecCcCccCC-ccceeEEEEEEcCCCc-ccccceeecCCc---ce---------------------------EeeeCCCCC
Confidence 999988885 4899999998776553 112111111111 01 169999999
Q ss_pred cEEEEEEEEEecCCCCCCCCCCcceeecCCCC
Q psy7042 1102 HEYEFRVCAVNAAGQGPWSSSSDIIMCCAPPC 1133 (2245)
Q Consensus 1102 ~~Y~~~v~A~n~~G~~~~s~~~~~~~~~~~p~ 1133 (2245)
+.|.|.|+|.|.+|.|+.+.....++..++|.
T Consensus 888 T~Y~~~vrA~nsaG~Gp~s~~~~~tt~k~pPs 919 (1051)
T KOG3513|consen 888 TKYRFYVRAYTSAGGGPASSEENVTTKKAPPS 919 (1051)
T ss_pred ceEEEEEEEecCCCCCCCccceeccccCCCCc
Confidence 99999999999999999998888877666665
|
|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >KOG1480|consensus | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >KOG1480|consensus | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin | Back alignment and domain information |
|---|
| >smart00407 IGc1 Immunoglobulin C-Type | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >PHA03270 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >PHA03271 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA03273 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >cd07699 IgC_L Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >cd07699 IgC_L Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >smart00407 IGc1 Immunoglobulin C-Type | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) | Back alignment and domain information |
|---|
| >cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin | Back alignment and domain information |
|---|
| >cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >PHA03271 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins | Back alignment and domain information |
|---|
| >cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins | Back alignment and domain information |
|---|
| >PHA03270 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03273 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins | Back alignment and domain information |
|---|
| >cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PHA02914 Immunoglobulin-like domain protein; Provisional | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >PHA02914 Immunoglobulin-like domain protein; Provisional | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PHA03042 CD47-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >PHA03042 CD47-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03283 envelope glycoprotein E; Provisional | Back alignment and domain information |
|---|
| >PF03921 ICAM_N: Intercellular adhesion molecule (ICAM), N-terminal domain; InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] | Back alignment and domain information |
|---|
| >PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >PHA02865 MHC-like TNF binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 2245 | ||||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 6e-64 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 2e-13 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 3e-09 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 2e-06 | ||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 6e-47 | ||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 1e-23 | ||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 3e-19 | ||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 2e-10 | ||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 2e-09 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 2e-40 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 8e-08 | ||
| 1kob_A | 387 | Twitchin Kinase Fragment (Aplysia), Autoregulated P | 5e-40 | ||
| 3lpw_A | 197 | Crystal Structure Of The Fniii-Tandem A77-A78 From | 7e-36 | ||
| 3lpw_A | 197 | Crystal Structure Of The Fniii-Tandem A77-A78 From | 7e-36 | ||
| 3lpw_A | 197 | Crystal Structure Of The Fniii-Tandem A77-A78 From | 3e-11 | ||
| 2j8h_A | 197 | Structure Of The Immunoglobulin Tandem Repeat A168- | 2e-22 | ||
| 2j8h_A | 197 | Structure Of The Immunoglobulin Tandem Repeat A168- | 3e-10 | ||
| 2j8h_A | 197 | Structure Of The Immunoglobulin Tandem Repeat A168- | 3e-09 | ||
| 2ill_A | 195 | Anomalous Substructure Of Titin-A168169 Length = 19 | 5e-22 | ||
| 2ill_A | 195 | Anomalous Substructure Of Titin-A168169 Length = 19 | 6e-10 | ||
| 2ill_A | 195 | Anomalous Substructure Of Titin-A168169 Length = 19 | 6e-09 | ||
| 3lcy_A | 197 | Titin Ig Tandem Domains A164-A165 Length = 197 | 2e-18 | ||
| 3lcy_A | 197 | Titin Ig Tandem Domains A164-A165 Length = 197 | 1e-12 | ||
| 3lcy_A | 197 | Titin Ig Tandem Domains A164-A165 Length = 197 | 1e-08 | ||
| 2jll_A | 389 | Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | 5e-15 | ||
| 2jll_A | 389 | Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | 5e-15 | ||
| 2j90_A | 304 | Crystal Structure Of Human Zip Kinase In Complex Wi | 1e-14 | ||
| 3bhy_A | 283 | Crystal Structure Of Human Death Associated Protein | 2e-14 | ||
| 3b43_A | 570 | I-band Fragment I65-i70 From Titin Length = 570 | 2e-14 | ||
| 3b43_A | 570 | I-band Fragment I65-i70 From Titin Length = 570 | 2e-14 | ||
| 3b43_A | 570 | I-band Fragment I65-i70 From Titin Length = 570 | 2e-06 | ||
| 1yrp_A | 278 | Catalytic Domain Of Human Zip Kinase Phosphorylated | 4e-14 | ||
| 2ya9_A | 361 | Crystal Structure Of The Autoinhibited Form Of Mous | 8e-14 | ||
| 2yux_A | 120 | Solution Structure Of 3rd Fibronectin Type Three Do | 2e-13 | ||
| 2yux_A | 120 | Solution Structure Of 3rd Fibronectin Type Three Do | 3e-09 | ||
| 2yux_A | 120 | Solution Structure Of 3rd Fibronectin Type Three Do | 4e-08 | ||
| 2rik_A | 284 | I-Band Fragment I67-I69 From Titin Length = 284 | 3e-13 | ||
| 2rik_A | 284 | I-Band Fragment I67-I69 From Titin Length = 284 | 3e-13 | ||
| 2rik_A | 284 | I-Band Fragment I67-I69 From Titin Length = 284 | 2e-06 | ||
| 1tki_A | 321 | Autoinhibited Serine Kinase Domain Of The Giant Mus | 4e-13 | ||
| 2xuu_A | 334 | Crystal Structure Of A Dap-Kinase 1 Mutant Length = | 4e-13 | ||
| 2rjm_A | 284 | 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat | 4e-13 | ||
| 2rjm_A | 284 | 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat | 7e-13 | ||
| 2rjm_A | 284 | 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat | 2e-06 | ||
| 2x0g_A | 334 | X-ray Structure Of A Dap-kinase Calmodulin Complex | 4e-13 | ||
| 2xzs_A | 312 | Death Associated Protein Kinase 1 Residues 1-312 Le | 6e-13 | ||
| 2a27_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 6e-13 | ||
| 1wmk_A | 321 | Human Death-Associated Kinase Drp-1, Mutant S308d D | 6e-13 | ||
| 2y0a_A | 326 | Structure Of Dapk1 Construct Residues 1-304 Length | 6e-13 | ||
| 2w4k_A | 302 | X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | 6e-13 | ||
| 2a2a_A | 321 | High-resolution Crystallographic Analysis Of The Au | 7e-13 | ||
| 1z9x_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 7e-13 | ||
| 3gu4_A | 295 | Crystal Structure Of Dapkq23v-Amppnp Length = 295 | 7e-13 | ||
| 1p4f_A | 293 | Death Associated Protein Kinase Catalytic Domain Wi | 7e-13 | ||
| 1zws_A | 288 | Crystal Structure Of The Catalytic Domain Of Human | 7e-13 | ||
| 1ig1_A | 294 | 1.8a X-Ray Structure Of Ternary Complex Of A Cataly | 7e-13 | ||
| 3f5u_A | 295 | Crystal Structure Of The Death Associated Protein K | 7e-13 | ||
| 3dfc_B | 295 | Crystal Structure Of A Glycine-Rich Loop Mutant Of | 8e-13 | ||
| 2yak_A | 285 | Structure Of Death-Associated Protein Kinase 1 (Dap | 8e-13 | ||
| 1ya5_A | 201 | Crystal Structure Of The Titin Domains Z1z2 In Comp | 8e-13 | ||
| 1ya5_A | 201 | Crystal Structure Of The Titin Domains Z1z2 In Comp | 1e-10 | ||
| 1ya5_A | 201 | Crystal Structure Of The Titin Domains Z1z2 In Comp | 2e-07 | ||
| 2a38_A | 194 | Crystal Structure Of The N-Terminus Of Titin Length | 9e-13 | ||
| 2a38_A | 194 | Crystal Structure Of The N-Terminus Of Titin Length | 1e-10 | ||
| 2a38_A | 194 | Crystal Structure Of The N-Terminus Of Titin Length | 2e-07 | ||
| 1wvw_A | 278 | Crystal Structures Of Kinase Domain Of Dap Kinase I | 1e-12 | ||
| 2w4j_A | 277 | X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | 1e-12 | ||
| 2xyc_A | 291 | Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | 1e-12 | ||
| 2xyc_A | 291 | Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | 8e-11 | ||
| 3gu8_A | 295 | Crystal Structure Of Dapkl93g With N6-Cyclopentylad | 2e-12 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 2e-12 | ||
| 3laf_A | 403 | Structure Of Dcc, A Netrin-1 Receptor Length = 403 | 5e-12 | ||
| 3laf_A | 403 | Structure Of Dcc, A Netrin-1 Receptor Length = 403 | 3e-06 | ||
| 2iep_A | 192 | Crystal Structure Of Immunoglobulin-Like Domains 1 | 5e-12 | ||
| 2iep_A | 192 | Crystal Structure Of Immunoglobulin-Like Domains 1 | 9e-07 | ||
| 2iep_A | 192 | Crystal Structure Of Immunoglobulin-Like Domains 1 | 3e-06 | ||
| 1bpv_A | 112 | Titin Module A71 From Human Cardiac Muscle, Nmr, 50 | 5e-11 | ||
| 1bpv_A | 112 | Titin Module A71 From Human Cardiac Muscle, Nmr, 50 | 5e-11 | ||
| 1bpv_A | 112 | Titin Module A71 From Human Cardiac Muscle, Nmr, 50 | 1e-09 | ||
| 2xy1_A | 192 | Crystal Structure Of Ncam2 Ig3-4 Length = 192 | 8e-11 | ||
| 2xy1_A | 192 | Crystal Structure Of Ncam2 Ig3-4 Length = 192 | 7e-07 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 9e-11 | ||
| 3kl8_A | 269 | Camkiintide Inhibitor Complex Length = 269 | 1e-10 | ||
| 3kk8_A | 284 | Camkii Substrate Complex A Length = 284 | 1e-10 | ||
| 3kk9_A | 282 | Camkii Substrate Complex B Length = 282 | 2e-10 | ||
| 2v5t_A | 189 | Crystal Structure Of Ncam2 Ig2-3 Length = 189 | 6e-10 | ||
| 2v5t_A | 189 | Crystal Structure Of Ncam2 Ig2-3 Length = 189 | 3e-06 | ||
| 4fr4_A | 384 | Crystal Structure Of Human SerineTHREONINE-Protein | 7e-10 | ||
| 2wim_A | 291 | Crystal Structure Of Ncam2 Ig1-3 Length = 291 | 8e-10 | ||
| 2wim_A | 291 | Crystal Structure Of Ncam2 Ig1-3 Length = 291 | 5e-06 | ||
| 3mfr_A | 351 | Cask-4m Cam Kinase Domain, Native Length = 351 | 2e-09 | ||
| 3dmk_A | 816 | Crystal Structure Of Down Syndrome Cell Adhesion Mo | 3e-09 | ||
| 3dmk_A | 816 | Crystal Structure Of Down Syndrome Cell Adhesion Mo | 8e-05 | ||
| 2yr3_A | 99 | Solution Structure Of The Fourth Ig-Like Domain Fro | 3e-09 | ||
| 2yr3_A | 99 | Solution Structure Of The Fourth Ig-Like Domain Fro | 3e-09 | ||
| 3pxh_A | 201 | Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt | 3e-09 | ||
| 3pxh_A | 201 | Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt | 1e-06 | ||
| 1uem_A | 117 | Solution Structure Of The First Fibronectin Type Ii | 4e-09 | ||
| 1uem_A | 117 | Solution Structure Of The First Fibronectin Type Ii | 3e-05 | ||
| 2yd9_A | 304 | Crystal Structure Of The N-Terminal Ig1-3 Module Of | 4e-09 | ||
| 2yd9_A | 304 | Crystal Structure Of The N-Terminal Ig1-3 Module Of | 1e-05 | ||
| 2yd9_A | 304 | Crystal Structure Of The N-Terminal Ig1-3 Module Of | 2e-04 | ||
| 3tac_A | 361 | Crystal Structure Of The Liprin-AlphaCASK COMPLEX L | 7e-09 | ||
| 3c0g_A | 351 | Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len | 9e-09 | ||
| 2wel_A | 327 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 1e-08 | ||
| 2vn9_A | 301 | Crystal Structure Of Human Calcium Calmodulin Depen | 2e-08 | ||
| 2vz6_A | 313 | Structure Of Human Calcium Calmodulin Dependent Pro | 2e-08 | ||
| 4agu_A | 311 | Crystal Structure Of The Human Cdkl1 Kinase Domain | 3e-08 | ||
| 3pxj_A | 210 | Tandem Ig Repeats Of Dlar Length = 210 | 3e-08 | ||
| 3pxj_A | 210 | Tandem Ig Repeats Of Dlar Length = 210 | 8e-04 | ||
| 2yd5_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 4e-08 | ||
| 2yd5_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 2e-07 | ||
| 2w4o_A | 349 | Crystal Structure Of Human Camk4 In Complex With 4- | 5e-08 | ||
| 3puc_A | 99 | Atomic Resolution Structure Of Titin Domain M7 Leng | 5e-08 | ||
| 3puc_A | 99 | Atomic Resolution Structure Of Titin Domain M7 Leng | 5e-08 | ||
| 3puc_A | 99 | Atomic Resolution Structure Of Titin Domain M7 Leng | 6e-04 | ||
| 1cs6_A | 382 | N-terminal Fragment Of Axonin-1 From Chicken Length | 2e-07 | ||
| 1cs6_A | 382 | N-terminal Fragment Of Axonin-1 From Chicken Length | 2e-07 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 2e-07 | ||
| 1qz1_A | 291 | Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam | 2e-07 | ||
| 1qz1_A | 291 | Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam | 8e-04 | ||
| 3bhh_A | 295 | Crystal Structure Of Human Calcium/calmodulin-depen | 4e-07 | ||
| 2v7o_A | 336 | Crystal Structure Of Human Calcium-Calmodulin-Depen | 5e-07 | ||
| 2vra_A | 208 | Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 | 5e-07 | ||
| 2vra_A | 208 | Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 | 7e-04 | ||
| 2vr9_A | 217 | Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 | 5e-07 | ||
| 2vr9_A | 217 | Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 | 7e-04 | ||
| 3soa_A | 444 | Full-Length Human Camkii Length = 444 | 6e-07 | ||
| 2yd1_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 8e-07 | ||
| 2yd1_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 5e-04 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 1e-06 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 1e-06 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 1e-06 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 1e-06 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 6e-05 | ||
| 2wp3_T | 102 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 1e-06 | ||
| 2wp3_T | 102 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 3e-05 | ||
| 2wp3_T | 102 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 1e-04 | ||
| 2e7c_A | 118 | Solution Structure Of The 6th Ig-Like Domain From H | 1e-06 | ||
| 2e7c_A | 118 | Solution Structure Of The 6th Ig-Like Domain From H | 9e-06 | ||
| 2e7c_A | 118 | Solution Structure Of The 6th Ig-Like Domain From H | 3e-05 | ||
| 3knb_A | 100 | Crystal Structure Of The Titin C-Terminus In Comple | 1e-06 | ||
| 3knb_A | 100 | Crystal Structure Of The Titin C-Terminus In Comple | 3e-05 | ||
| 3knb_A | 100 | Crystal Structure Of The Titin C-Terminus In Comple | 1e-04 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 2e-06 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 2e-06 | ||
| 2y7j_A | 365 | Structure Of Human Phosphorylase Kinase, Gamma 2 Le | 2e-06 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 2e-06 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 2e-06 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 2e-06 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 2e-06 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 2e-06 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 2e-06 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 2e-06 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 2e-06 | ||
| 1tlk_A | 154 | X-Ray Structure Determination Of Telokin, The C-Ter | 2e-06 | ||
| 1tlk_A | 154 | X-Ray Structure Determination Of Telokin, The C-Ter | 2e-06 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 2e-06 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 2e-06 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 2e-06 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 2e-06 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 2e-06 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 2e-06 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 2e-06 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 2e-06 | ||
| 3com_A | 314 | Crystal Structure Of Mst1 Kinase Length = 314 | 2e-06 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 2e-06 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 2e-06 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 2e-06 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 2e-06 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 2e-06 | ||
| 2yd3_A | 202 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 2e-06 | ||
| 2yd3_A | 202 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 1e-05 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 2e-06 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 2e-06 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 2e-06 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 2e-06 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 2e-06 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 2e-06 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 2e-06 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 2e-06 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 3e-06 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 3e-06 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 3e-06 | ||
| 1ung_A | 292 | Structural Mechanism For The Inhibition Of Cdk5-P25 | 3e-06 | ||
| 1h4l_A | 292 | Structure And Regulation Of The Cdk5-P25(Nck5a) Com | 3e-06 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 3e-06 | ||
| 1ua2_A | 346 | Crystal Structure Of Human Cdk7 Length = 346 | 3e-06 | ||
| 2yd2_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 3e-06 | ||
| 2yd2_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 1e-05 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 3e-06 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 3e-06 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 3e-06 | ||
| 2cqv_A | 114 | Solution Structure Of The Eighth Ig-Like Domain Of | 3e-06 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 4e-06 | ||
| 1fhg_A | 154 | High Resolution Refinement Of Telokin Length = 154 | 4e-06 | ||
| 1fhg_A | 154 | High Resolution Refinement Of Telokin Length = 154 | 4e-06 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 4e-06 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 4e-06 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 4e-06 | ||
| 1ii4_E | 220 | Crystal Structure Of Ser252trp Apert Mutant Fgf Rec | 4e-06 | ||
| 1ii4_E | 220 | Crystal Structure Of Ser252trp Apert Mutant Fgf Rec | 4e-06 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 4e-06 | ||
| 3s97_C | 201 | Ptprz Cntn1 Complex Length = 201 | 4e-06 | ||
| 3s97_C | 201 | Ptprz Cntn1 Complex Length = 201 | 4e-06 | ||
| 1e0o_B | 219 | Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin C | 5e-06 | ||
| 1e0o_B | 219 | Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin C | 5e-06 | ||
| 1ev2_E | 220 | Crystal Structure Of Fgf2 In Complex With The Extra | 5e-06 | ||
| 1ev2_E | 220 | Crystal Structure Of Fgf2 In Complex With The Extra | 5e-06 | ||
| 1cvs_C | 225 | Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L | 6e-06 | ||
| 1cvs_C | 225 | Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L | 1e-05 | ||
| 3ojv_C | 226 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 6e-06 | ||
| 3ojv_C | 226 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 1e-05 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 7e-06 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 8e-06 | ||
| 1evt_C | 225 | Crystal Structure Of Fgf1 In Complex With The Extra | 1e-05 | ||
| 1evt_C | 225 | Crystal Structure Of Fgf1 In Complex With The Extra | 1e-05 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 1e-05 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 1e-05 | ||
| 2yd4_A | 210 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 1e-05 | ||
| 3knb_B | 107 | Crystal Structure Of The Titin C-Terminus In Comple | 1e-05 | ||
| 3knb_B | 107 | Crystal Structure Of The Titin C-Terminus In Comple | 1e-05 | ||
| 3lm0_A | 327 | Crystal Structure Of Human SerineTHREONINE KINASE 1 | 1e-05 | ||
| 2fdb_P | 220 | Crystal Structure Of Fibroblast Growth Factor (Fgf) | 1e-05 | ||
| 2fdb_P | 220 | Crystal Structure Of Fibroblast Growth Factor (Fgf) | 1e-05 | ||
| 1iil_E | 220 | Crystal Structure Of Pro253arg Apert Mutant Fgf Rec | 1e-05 | ||
| 1iil_E | 220 | Crystal Structure Of Pro253arg Apert Mutant Fgf Rec | 1e-05 | ||
| 1djs_A | 216 | Ligand-binding Portion Of Fibroblast Growth Factor | 2e-05 | ||
| 1djs_A | 216 | Ligand-binding Portion Of Fibroblast Growth Factor | 2e-05 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 2e-05 | ||
| 3p3y_A | 404 | Crystal Structure Of Neurofascin Homophilic Adhesio | 2e-05 | ||
| 3p3y_A | 404 | Crystal Structure Of Neurofascin Homophilic Adhesio | 2e-05 | ||
| 2dm3_A | 110 | Solution Structure Of The Second Ig Domain Of Human | 2e-05 | ||
| 2dm3_A | 110 | Solution Structure Of The Second Ig Domain Of Human | 2e-05 | ||
| 2dm3_A | 110 | Solution Structure Of The Second Ig Domain Of Human | 4e-05 | ||
| 2wwk_O | 109 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 2e-05 | ||
| 2wwk_O | 109 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 2e-05 | ||
| 2wp3_O | 109 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 2e-05 | ||
| 2wp3_O | 109 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 2e-05 | ||
| 2yd6_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 2e-05 | ||
| 3f3z_A | 277 | Crystal Structure Of Cryptosporidium Parvum Calcium | 2e-05 | ||
| 2qg5_A | 294 | Cryptosporidium Parvum Calcium Dependent Protein Ki | 3e-05 | ||
| 3kn5_A | 325 | Crystal Structure Of The C-Terminal Kinase Domain O | 3e-05 | ||
| 2jam_A | 304 | Crystal Structure Of Human Calmodulin-Dependent Pro | 3e-05 | ||
| 2jc6_A | 334 | Crystal Structure Of Human Calmodulin-Dependent Pro | 3e-05 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 3e-05 | ||
| 4f1o_A | 287 | Crystal Structure Of The L1180t Mutant Roco4 Kinase | 3e-05 | ||
| 3dfa_A | 286 | Crystal Structure Of Kinase Domain Of Calcium-depen | 3e-05 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 4e-05 | ||
| 2wei_A | 287 | Crystal Structure Of The Kinase Domain Of Cryptospo | 4e-05 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 4e-05 | ||
| 2j7t_A | 302 | Crystal Structure Of Human Serine Threonine Kinase- | 5e-05 | ||
| 3mtr_A | 215 | Crystal Structure Of The Ig5-Fn1 Tandem Of Human Nc | 5e-05 | ||
| 4bc6_A | 293 | Crystal Structure Of Human Serine Threonine Kinase- | 5e-05 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 5e-05 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 5e-05 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 5e-05 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 5e-05 | ||
| 1u2h_A | 99 | X-Ray Structure Of The N-Terminally Truncated Human | 5e-05 | ||
| 1u2h_A | 99 | X-Ray Structure Of The N-Terminally Truncated Human | 5e-05 | ||
| 1u2h_A | 99 | X-Ray Structure Of The N-Terminally Truncated Human | 7e-04 | ||
| 1gxe_A | 139 | Central Domain Of Cardiac Myosin Binding Protein C | 6e-05 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 6e-05 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 6e-05 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 6e-05 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 6e-05 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 6e-05 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 7e-05 | ||
| 1x3d_A | 118 | Solution Structure Of The Fibronectin Type-Iii Doma | 7e-05 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 7e-05 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 7e-05 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 7e-05 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 7e-05 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 7e-05 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 7e-05 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 7e-05 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 7e-05 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 8e-05 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 8e-05 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 8e-05 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 8e-05 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 8e-05 | ||
| 4f0f_A | 287 | Crystal Structure Of The Roco4 Kinase Domain Bound | 8e-05 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 8e-05 | ||
| 1nct_A | 106 | Titin Module M5, N-Terminally Extended, Nmr Length | 8e-05 | ||
| 1nct_A | 106 | Titin Module M5, N-Terminally Extended, Nmr Length | 8e-05 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 8e-05 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 8e-05 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 8e-05 | ||
| 4f1m_A | 287 | Crystal Structure Of The G1179s Roco4 Kinase Domain | 9e-05 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 9e-05 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 9e-05 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 9e-05 | ||
| 3d5u_A | 317 | Crystal Structure Of A Wildtype Polo-Like Kinase 1 | 9e-05 | ||
| 4ic7_A | 442 | Crystal Structure Of The Erk5 Kinase Domain In Comp | 9e-05 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 9e-05 | ||
| 3d5w_A | 317 | Crystal Structure Of A Phosphorylated Polo-Like Kin | 9e-05 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 1e-04 | ||
| 3d5v_A | 317 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 1e-04 | ||
| 2v5s_A | 394 | Structural Basis For Dscam Isoform Specificity Leng | 1e-04 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 1e-04 | ||
| 2v5m_A | 388 | Structural Basis For Dscam Isoform Specificity Leng | 1e-04 | ||
| 3db6_A | 301 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 1e-04 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 1e-04 | ||
| 1wit_A | 93 | Twitchin Immunoglobulin Superfamily Domain (Igsf Mo | 1e-04 | ||
| 1wit_A | 93 | Twitchin Immunoglobulin Superfamily Domain (Igsf Mo | 5e-04 | ||
| 4b99_A | 398 | Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le | 1e-04 | ||
| 1tnm_A | 100 | Tertiary Structure Of An Immunoglobulin-Like Domain | 1e-04 | ||
| 1tnm_A | 100 | Tertiary Structure Of An Immunoglobulin-Like Domain | 1e-04 | ||
| 3hko_A | 345 | Crystal Structure Of A Cdpk Kinase Domain From Cryp | 1e-04 | ||
| 3is5_A | 285 | Crystal Structure Of Cdpk Kinase Domain From Toxopl | 2e-04 | ||
| 1x5y_A | 111 | Solution Structure Of The Fibronectin Type-Iii Doma | 2e-04 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 2e-04 | ||
| 1uey_A | 127 | Solution Structure Of The First Fibronectin Type Ii | 2e-04 | ||
| 1uey_A | 127 | Solution Structure Of The First Fibronectin Type Ii | 4e-04 | ||
| 3ojm_B | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 2e-04 | ||
| 3ojm_B | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 2e-04 | ||
| 3dar_A | 105 | Crystal Structure Of D2 Domain From Human Fgfr2 Len | 2e-04 | ||
| 3dar_A | 105 | Crystal Structure Of D2 Domain From Human Fgfr2 Len | 2e-04 | ||
| 1wvz_A | 104 | Solution Structure Of The D2 Domain Of The Fibrobla | 2e-04 | ||
| 1wvz_A | 104 | Solution Structure Of The D2 Domain Of The Fibrobla | 2e-04 | ||
| 3caf_A | 100 | Crystal Structure Of Hfgfr2 D2 Domain Length = 100 | 2e-04 | ||
| 3caf_A | 100 | Crystal Structure Of Hfgfr2 D2 Domain Length = 100 | 2e-04 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 2e-04 | ||
| 3grw_A | 241 | Fgfr3 In Complex With A Fab Length = 241 | 2e-04 | ||
| 3grw_A | 241 | Fgfr3 In Complex With A Fab Length = 241 | 2e-04 | ||
| 3zyo_A | 411 | Crystal Structure Of The N-Terminal Leucine Rich Re | 3e-04 | ||
| 3zyo_A | 411 | Crystal Structure Of The N-Terminal Leucine Rich Re | 3e-04 | ||
| 1ql6_A | 298 | The Catalytic Mechanism Of Phosphorylase Kinase Pro | 3e-04 | ||
| 3kld_A | 384 | Ptprg Cntn4 Complex Length = 384 | 3e-04 | ||
| 3kld_A | 384 | Ptprg Cntn4 Complex Length = 384 | 3e-04 | ||
| 3jxa_A | 383 | Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = | 3e-04 | ||
| 3jxa_A | 383 | Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = | 3e-04 | ||
| 1phk_A | 298 | Two Structures Of The Catalytic Domain Of Phosphory | 3e-04 | ||
| 1ry7_B | 334 | Crystal Structure Of The 3 Ig Form Of Fgfr3c In Com | 3e-04 | ||
| 1ry7_B | 334 | Crystal Structure Of The 3 Ig Form Of Fgfr3c In Com | 3e-04 | ||
| 3zut_A | 362 | The Structure Of Ost1 (D160a) Kinase Length = 362 | 3e-04 | ||
| 3zuu_A | 362 | The Structure Of Ost1 (D160a, S175d) Kinase In Comp | 3e-04 | ||
| 3oj2_C | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 3e-04 | ||
| 3oj2_C | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 3e-04 | ||
| 3mtl_A | 324 | Crystal Structure Of The Pctaire1 Kinase In Complex | 3e-04 | ||
| 2doc_A | 119 | Solution Structure Of The Fibronectin Type-Iii Doma | 3e-04 | ||
| 1f3m_C | 297 | Crystal Structure Of Human SerineTHREONINE KINASE P | 4e-04 | ||
| 3fxz_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Ruthen | 4e-04 | ||
| 1yhv_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Two Po | 4e-04 | ||
| 3uc3_A | 361 | The Crystal Structure Of Snf1-Related Kinase 2.3 Le | 4e-04 | ||
| 3q52_A | 306 | Structure Of Phosphorylated Pak1 Kinase Domain Leng | 4e-04 | ||
| 3q4z_A | 306 | Structure Of Unphosphorylated Pak1 Kinase Domain Le | 4e-04 | ||
| 1nun_B | 230 | Crystal Structure Analysis Of The Fgf10-fgfr2b Comp | 5e-04 | ||
| 1nun_B | 230 | Crystal Structure Analysis Of The Fgf10-fgfr2b Comp | 5e-04 | ||
| 4apc_A | 350 | Crystal Structure Of Human Nima-Related Kinase 1 (N | 5e-04 | ||
| 2qr8_A | 342 | 2.0a X-ray Structure Of C-terminal Kinase Domain Of | 5e-04 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 5e-04 | ||
| 1g1c_A | 99 | I1 Domain From Titin Length = 99 | 5e-04 | ||
| 1g1c_A | 99 | I1 Domain From Titin Length = 99 | 5e-04 | ||
| 3udb_A | 317 | Crystal Structure Of Snrk2.6 Length = 317 | 6e-04 | ||
| 2phk_A | 277 | The Crystal Structure Of A Phosphorylase Kinase Pep | 6e-04 | ||
| 2qr7_A | 342 | 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of | 7e-04 | ||
| 2lqr_A | 108 | Nmr Structure Of Ig3 Domain Of Palladin Length = 10 | 7e-04 | ||
| 2lqr_A | 108 | Nmr Structure Of Ig3 Domain Of Palladin Length = 10 | 7e-04 | ||
| 2v55_A | 406 | Mechanism Of Multi-site Phosphorylation From A Rock | 7e-04 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 7e-04 | ||
| 3v8s_A | 410 | Human Rho-Associated Protein Kinase 1 (Rock 1) In C | 8e-04 | ||
| 2dm2_A | 110 | Solution Structure Of The First Ig Domain Of Human | 8e-04 | ||
| 2dm2_A | 110 | Solution Structure Of The First Ig Domain Of Human | 8e-04 | ||
| 2esm_A | 415 | Crystal Structure Of Rock 1 Bound To Fasudil Length | 8e-04 | ||
| 3hyh_A | 275 | Crystal Structure Of The Protein Kinase Domain Of Y | 8e-04 |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
|
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 | Back alignment and structure |
| >pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 | Back alignment and structure |
| >pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 | Back alignment and structure |
| >pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 | Back alignment and structure |
| >pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 | Back alignment and structure |
| >pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 | Back alignment and structure |
| >pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 | Back alignment and structure |
| >pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 | Back alignment and structure |
| >pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 | Back alignment and structure |
| >pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 | Back alignment and structure |
| >pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 | Back alignment and structure |
| >pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 | Back alignment and structure |
| >pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 | Back alignment and structure |
| >pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | Back alignment and structure |
| >pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | Back alignment and structure |
| >pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 | Back alignment and structure |
| >pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 | Back alignment and structure |
| >pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 | Back alignment and structure |
| >pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 | Back alignment and structure |
| >pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 | Back alignment and structure |
| >pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 | Back alignment and structure |
| >pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 | Back alignment and structure |
| >pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 | Back alignment and structure |
| >pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 | Back alignment and structure |
| >pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 | Back alignment and structure |
| >pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 | Back alignment and structure |
| >pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 | Back alignment and structure |
| >pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 | Back alignment and structure |
| >pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 | Back alignment and structure |
| >pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 | Back alignment and structure |
| >pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 | Back alignment and structure |
| >pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 | Back alignment and structure |
| >pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 | Back alignment and structure |
| >pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 | Back alignment and structure |
| >pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 | Back alignment and structure |
| >pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 | Back alignment and structure |
| >pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 | Back alignment and structure |
| >pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | Back alignment and structure |
| >pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 | Back alignment and structure |
| >pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 | Back alignment and structure |
| >pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 | Back alignment and structure |
| >pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 | Back alignment and structure |
| >pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 | Back alignment and structure |
| >pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 | Back alignment and structure |
| >pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 | Back alignment and structure |
| >pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 | Back alignment and structure |
| >pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 | Back alignment and structure |
| >pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 | Back alignment and structure |
| >pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 | Back alignment and structure |
| >pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 | Back alignment and structure |
| >pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 | Back alignment and structure |
| >pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 | Back alignment and structure |
| >pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 | Back alignment and structure |
| >pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | Back alignment and structure |
| >pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | Back alignment and structure |
| >pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | Back alignment and structure |
| >pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 | Back alignment and structure |
| >pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 | Back alignment and structure |
| >pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 | Back alignment and structure |
| >pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 | Back alignment and structure |
| >pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 | Back alignment and structure |
| >pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 | Back alignment and structure |
| >pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 | Back alignment and structure |
| >pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 | Back alignment and structure |
| >pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 | Back alignment and structure |
| >pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 | Back alignment and structure |
| >pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 | Back alignment and structure |
| >pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 | Back alignment and structure |
| >pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 | Back alignment and structure |
| >pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 | Back alignment and structure |
| >pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 | Back alignment and structure |
| >pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 | Back alignment and structure |
| >pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 | Back alignment and structure |
| >pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 | Back alignment and structure |
| >pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 | Back alignment and structure |
| >pdb|2YR3|A Chain A, Solution Structure Of The Fourth Ig-Like Domain From Myosin Light Chain Kinase, Smooth Muscle Length = 99 | Back alignment and structure |
| >pdb|2YR3|A Chain A, Solution Structure Of The Fourth Ig-Like Domain From Myosin Light Chain Kinase, Smooth Muscle Length = 99 | Back alignment and structure |
| >pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 | Back alignment and structure |
| >pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 | Back alignment and structure |
| >pdb|1UEM|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa1568 Protein Length = 117 | Back alignment and structure |
| >pdb|1UEM|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa1568 Protein Length = 117 | Back alignment and structure |
| >pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 | Back alignment and structure |
| >pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 | Back alignment and structure |
| >pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 | Back alignment and structure |
| >pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 | Back alignment and structure |
| >pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 | Back alignment and structure |
| >pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 | Back alignment and structure |
| >pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 | Back alignment and structure |
| >pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 | Back alignment and structure |
| >pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 | Back alignment and structure |
| >pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 | Back alignment and structure |
| >pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 | Back alignment and structure |
| >pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 | Back alignment and structure |
| >pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 | Back alignment and structure |
| >pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 | Back alignment and structure |
| >pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 | Back alignment and structure |
| >pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 | Back alignment and structure |
| >pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 | Back alignment and structure |
| >pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 | Back alignment and structure |
| >pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 | Back alignment and structure |
| >pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 | Back alignment and structure |
| >pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 | Back alignment and structure |
| >pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 | Back alignment and structure |
| >pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 | Back alignment and structure |
| >pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 | Back alignment and structure |
| >pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 | Back alignment and structure |
| >pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 | Back alignment and structure |
| >pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 | Back alignment and structure |
| >pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 | Back alignment and structure |
| >pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|2WP3|T Chain T, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 102 | Back alignment and structure |
| >pdb|2WP3|T Chain T, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 102 | Back alignment and structure |
| >pdb|2WP3|T Chain T, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 102 | Back alignment and structure |
| >pdb|2E7C|A Chain A, Solution Structure Of The 6th Ig-Like Domain From Human Myosin-Binding Protein C, Fast-Type Length = 118 | Back alignment and structure |
| >pdb|2E7C|A Chain A, Solution Structure Of The 6th Ig-Like Domain From Human Myosin-Binding Protein C, Fast-Type Length = 118 | Back alignment and structure |
| >pdb|2E7C|A Chain A, Solution Structure Of The 6th Ig-Like Domain From Human Myosin-Binding Protein C, Fast-Type Length = 118 | Back alignment and structure |
| >pdb|3KNB|A Chain A, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 100 | Back alignment and structure |
| >pdb|3KNB|A Chain A, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 100 | Back alignment and structure |
| >pdb|3KNB|A Chain A, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 100 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1TLK|A Chain A, X-Ray Structure Determination Of Telokin, The C-Terminal Domain Of Myosin Light Chain Kinase, At 2.8 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|1TLK|A Chain A, X-Ray Structure Determination Of Telokin, The C-Terminal Domain Of Myosin Light Chain Kinase, At 2.8 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 | Back alignment and structure |
| >pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 | Back alignment and structure |
| >pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 | Back alignment and structure |
| >pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 | Back alignment and structure |
| >pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|2CQV|A Chain A, Solution Structure Of The Eighth Ig-Like Domain Of Human Myosin Light Chain Kinase Length = 114 | Back alignment and structure |
| >pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 | Back alignment and structure |
| >pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|1II4|E Chain E, Crystal Structure Of Ser252trp Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|1II4|E Chain E, Crystal Structure Of Ser252trp Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3S97|C Chain C, Ptprz Cntn1 Complex Length = 201 | Back alignment and structure |
| >pdb|3S97|C Chain C, Ptprz Cntn1 Complex Length = 201 | Back alignment and structure |
| >pdb|1E0O|B Chain B, Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin Complex Length = 219 | Back alignment and structure |
| >pdb|1E0O|B Chain B, Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin Complex Length = 219 | Back alignment and structure |
| >pdb|1EV2|E Chain E, Crystal Structure Of Fgf2 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 2 (Fgfr2) Length = 220 | Back alignment and structure |
| >pdb|1EV2|E Chain E, Crystal Structure Of Fgf2 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 2 (Fgfr2) Length = 220 | Back alignment and structure |
| >pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 | Back alignment and structure |
| >pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 | Back alignment and structure |
| >pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 | Back alignment and structure |
| >pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 | Back alignment and structure |
| >pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 | Back alignment and structure |
| >pdb|3KNB|B Chain B, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 107 | Back alignment and structure |
| >pdb|3KNB|B Chain B, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 107 | Back alignment and structure |
| >pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 | Back alignment and structure |
| >pdb|2FDB|P Chain P, Crystal Structure Of Fibroblast Growth Factor (Fgf)8b In Complex With Fgf Receptor (Fgfr) 2c Length = 220 | Back alignment and structure |
| >pdb|2FDB|P Chain P, Crystal Structure Of Fibroblast Growth Factor (Fgf)8b In Complex With Fgf Receptor (Fgfr) 2c Length = 220 | Back alignment and structure |
| >pdb|1IIL|E Chain E, Crystal Structure Of Pro253arg Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|1IIL|E Chain E, Crystal Structure Of Pro253arg Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|1DJS|A Chain A, Ligand-binding Portion Of Fibroblast Growth Factor Receptor 2 In Complex With Fgf1 Length = 216 | Back alignment and structure |
| >pdb|1DJS|A Chain A, Ligand-binding Portion Of Fibroblast Growth Factor Receptor 2 In Complex With Fgf1 Length = 216 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 | Back alignment and structure |
| >pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 | Back alignment and structure |
| >pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 | Back alignment and structure |
| >pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 | Back alignment and structure |
| >pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 | Back alignment and structure |
| >pdb|2WWK|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig F17r Mutant Complex Length = 109 | Back alignment and structure |
| >pdb|2WWK|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig F17r Mutant Complex Length = 109 | Back alignment and structure |
| >pdb|2WP3|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 109 | Back alignment and structure |
| >pdb|2WP3|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 109 | Back alignment and structure |
| >pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 | Back alignment and structure |
| >pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 | Back alignment and structure |
| >pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 | Back alignment and structure |
| >pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 | Back alignment and structure |
| >pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 | Back alignment and structure |
| >pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 | Back alignment and structure |
| >pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 | Back alignment and structure |
| >pdb|3MTR|A Chain A, Crystal Structure Of The Ig5-Fn1 Tandem Of Human Ncam Length = 215 | Back alignment and structure |
| >pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 | Back alignment and structure |
| >pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 | Back alignment and structure |
| >pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|1X3D|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Fibronectin Type-Iii Domain Containing Protein 3a Length = 118 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|1NCT|A Chain A, Titin Module M5, N-Terminally Extended, Nmr Length = 106 | Back alignment and structure |
| >pdb|1NCT|A Chain A, Titin Module M5, N-Terminally Extended, Nmr Length = 106 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 | Back alignment and structure |
| >pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 | Back alignment and structure |
| >pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 | Back alignment and structure |
| >pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|1WIT|A Chain A, Twitchin Immunoglobulin Superfamily Domain (Igsf Module) (Ig 18'), Nmr, Minimized Average Structure Length = 93 | Back alignment and structure |
| >pdb|1WIT|A Chain A, Twitchin Immunoglobulin Superfamily Domain (Igsf Module) (Ig 18'), Nmr, Minimized Average Structure Length = 93 | Back alignment and structure |
| >pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 | Back alignment and structure |
| >pdb|1TNM|A Chain A, Tertiary Structure Of An Immunoglobulin-Like Domain From The Muscle Protein Titin: A New Member Of The I Set Length = 100 | Back alignment and structure |
| >pdb|1TNM|A Chain A, Tertiary Structure Of An Immunoglobulin-Like Domain From The Muscle Protein Titin: A New Member Of The I Set Length = 100 | Back alignment and structure |
| >pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 | Back alignment and structure |
| >pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 | Back alignment and structure |
| >pdb|1X5Y|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Mouse Myosin-Binding Protein C, Fast-Type Homolog Length = 111 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 | Back alignment and structure |
| >pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 | Back alignment and structure |
| >pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 | Back alignment and structure |
| >pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 | Back alignment and structure |
| >pdb|3DAR|A Chain A, Crystal Structure Of D2 Domain From Human Fgfr2 Length = 105 | Back alignment and structure |
| >pdb|3DAR|A Chain A, Crystal Structure Of D2 Domain From Human Fgfr2 Length = 105 | Back alignment and structure |
| >pdb|1WVZ|A Chain A, Solution Structure Of The D2 Domain Of The Fibroblast Growth Factor Length = 104 | Back alignment and structure |
| >pdb|1WVZ|A Chain A, Solution Structure Of The D2 Domain Of The Fibroblast Growth Factor Length = 104 | Back alignment and structure |
| >pdb|3CAF|A Chain A, Crystal Structure Of Hfgfr2 D2 Domain Length = 100 | Back alignment and structure |
| >pdb|3CAF|A Chain A, Crystal Structure Of Hfgfr2 D2 Domain Length = 100 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|3GRW|A Chain A, Fgfr3 In Complex With A Fab Length = 241 | Back alignment and structure |
| >pdb|3GRW|A Chain A, Fgfr3 In Complex With A Fab Length = 241 | Back alignment and structure |
| >pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 | Back alignment and structure |
| >pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 | Back alignment and structure |
| >pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 | Back alignment and structure |
| >pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 | Back alignment and structure |
| >pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 | Back alignment and structure |
| >pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 | Back alignment and structure |
| >pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 | Back alignment and structure |
| >pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 | Back alignment and structure |
| >pdb|1RY7|B Chain B, Crystal Structure Of The 3 Ig Form Of Fgfr3c In Complex With Fgf1 Length = 334 | Back alignment and structure |
| >pdb|1RY7|B Chain B, Crystal Structure Of The 3 Ig Form Of Fgfr3c In Complex With Fgf1 Length = 334 | Back alignment and structure |
| >pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 | Back alignment and structure |
| >pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 | Back alignment and structure |
| >pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 | Back alignment and structure |
| >pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 | Back alignment and structure |
| >pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 | Back alignment and structure |
| >pdb|2DOC|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Neural Cell Adhesion Molecule 2 Length = 119 | Back alignment and structure |
| >pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 | Back alignment and structure |
| >pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 | Back alignment and structure |
| >pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 | Back alignment and structure |
| >pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 | Back alignment and structure |
| >pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|1NUN|B Chain B, Crystal Structure Analysis Of The Fgf10-fgfr2b Complex Length = 230 | Back alignment and structure |
| >pdb|1NUN|B Chain B, Crystal Structure Analysis Of The Fgf10-fgfr2b Complex Length = 230 | Back alignment and structure |
| >pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 | Back alignment and structure |
| >pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|1G1C|A Chain A, I1 Domain From Titin Length = 99 | Back alignment and structure |
| >pdb|1G1C|A Chain A, I1 Domain From Titin Length = 99 | Back alignment and structure |
| >pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 | Back alignment and structure |
| >pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 | Back alignment and structure |
| >pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 | Back alignment and structure |
| >pdb|2LQR|A Chain A, Nmr Structure Of Ig3 Domain Of Palladin Length = 108 | Back alignment and structure |
| >pdb|2LQR|A Chain A, Nmr Structure Of Ig3 Domain Of Palladin Length = 108 | Back alignment and structure |
| >pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 | Back alignment and structure |
| >pdb|2DM2|A Chain A, Solution Structure Of The First Ig Domain Of Human Palladin Length = 110 | Back alignment and structure |
| >pdb|2DM2|A Chain A, Solution Structure Of The First Ig Domain Of Human Palladin Length = 110 | Back alignment and structure |
| >pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 | Back alignment and structure |
| >pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
Score = 352 bits (904), Expect = e-109
Identities = 93/393 (23%), Positives = 152/393 (38%), Gaps = 15/393 (3%)
Query: 90 KPDFIVPLKDLVVPLGKLLTLQCEATGTPVPKCRWLRNGREI-------SSGARYRVETA 142
+P I+ LK+ +TL C+A G P+P+ W R S R V+
Sbjct: 1 QP-HIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQ 59
Query: 143 GGVFRLHFNEVTDVDNGDYTCEAYNSVGFAHTSSRVKIGTPPRIDRMPNALYIPEGDNTK 202
G LH +V D+G Y CEA + +G S + I P+ Y EG+
Sbjct: 60 HGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPIN 119
Query: 203 VKIFYAGDQPMEVSLTKNGRVVQSDD--RFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSN 260
+ + P + ++ V+ + + K +I+ I D G Y +N
Sbjct: 120 ISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATN 179
Query: 261 SSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDIS 320
G+ + + + +P P G + E+++ T + +N P GG+ + HY V+ ++++
Sbjct: 180 HIGTRFQEYILALADVPSSPYGVK-IIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVA 238
Query: 321 MPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSP 380
W + + T ++ L Y V AVN G G + I P +PSP
Sbjct: 239 SEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSK--IEIFQTLPVREPSP 296
Query: 381 PGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIP 440
P I G LS K DDGG+ I Y + + I +
Sbjct: 297 PSIHGQP-SSGKSFKLSITKQ-DDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILE 354
Query: 441 NLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIK 473
+L YE ++ A N G S P+ S+ K
Sbjct: 355 HLQWTMGYEVQITAANRLGYSEPTVYEFSMPPK 387
|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 257 | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 257 | Back alignment and structure |
|---|
| >1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 192 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >2jtd_A Myomesin-1, skelemin; immunoglobulin domain, muscle protein, thick filament, immune system, cell adhesion; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2jtd_A Myomesin-1, skelemin; immunoglobulin domain, muscle protein, thick filament, immune system, cell adhesion; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 | Back alignment and structure |
|---|
| >1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2245 | |||
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 100.0 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 100.0 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 100.0 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 100.0 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 100.0 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 100.0 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 100.0 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 100.0 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 100.0 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 100.0 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 100.0 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 100.0 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 100.0 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 100.0 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 100.0 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 100.0 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 100.0 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 100.0 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 100.0 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 100.0 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 100.0 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 100.0 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 100.0 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 100.0 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 100.0 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 100.0 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 100.0 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 100.0 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 100.0 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 100.0 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 100.0 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 100.0 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 100.0 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 99.98 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 99.98 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 99.97 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 99.97 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 99.97 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.97 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.97 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 99.97 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 99.97 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 99.97 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 99.96 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 99.96 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.96 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.96 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 99.96 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 99.96 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.96 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.96 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 99.96 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 99.96 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.95 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 99.95 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 99.95 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.95 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 99.95 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 99.95 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.95 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.94 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.94 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 99.94 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 99.94 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 99.94 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 99.93 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 99.93 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.93 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.93 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 99.93 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.93 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 99.93 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.93 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 99.93 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.92 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 99.92 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 99.92 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 99.92 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.92 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 99.92 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 99.92 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.92 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 99.92 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 99.92 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 99.92 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.91 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.91 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.91 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 99.91 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 99.91 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 99.91 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 99.91 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 99.91 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 99.91 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 99.91 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.91 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.9 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 99.9 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.9 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 99.9 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 99.9 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.9 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 99.9 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.9 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.89 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 99.89 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.89 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.89 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.89 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.88 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.88 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 99.88 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.87 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.87 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.87 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 99.87 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.87 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.87 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.86 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.86 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.86 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.86 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.86 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.86 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 99.86 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.86 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.85 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.85 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.85 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.85 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.84 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.84 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 99.84 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.84 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.84 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.84 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.84 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.84 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.84 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.83 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.83 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.83 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.83 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.83 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.83 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.83 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.83 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 99.82 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.82 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 99.82 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.82 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.82 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 99.82 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.82 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.81 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.81 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.81 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.81 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 99.81 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.81 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.81 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.81 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.81 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.81 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.81 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.8 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.8 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.8 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.8 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 99.8 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.79 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.79 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.79 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.79 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.79 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 99.79 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.78 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.78 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 99.78 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.78 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.78 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.78 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.77 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 99.77 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.77 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.77 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.76 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 99.76 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 99.76 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 99.76 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.76 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.76 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 99.76 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.76 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 99.76 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.76 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.76 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 99.76 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.76 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 99.75 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.75 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.75 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 99.75 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 99.75 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.75 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 99.75 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.74 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.74 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.74 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.74 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 99.74 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 99.74 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 99.74 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 99.74 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 99.73 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 99.73 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 99.73 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.73 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.73 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 99.73 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 99.73 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 99.73 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 99.73 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.73 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.72 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.72 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.72 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 99.72 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.72 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.72 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 99.72 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 99.72 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 99.72 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.72 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 99.72 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.72 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.72 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.71 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.71 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 99.71 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.71 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.71 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 99.71 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.71 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 99.71 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 99.7 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 99.7 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 99.7 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 99.7 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.7 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 99.7 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 99.7 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 99.7 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.7 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 99.7 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.7 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 99.7 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 99.69 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 99.69 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.69 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 99.69 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.69 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 99.69 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.69 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 99.69 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.68 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.68 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 99.68 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 99.68 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 99.68 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.68 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 99.68 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.68 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 99.68 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 99.67 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 99.67 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 99.67 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.67 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 99.67 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.67 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 99.67 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 99.67 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 99.67 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.67 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.67 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.67 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 99.66 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 99.66 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 99.66 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.66 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 99.66 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 99.66 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.65 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 99.65 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 99.65 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 99.65 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 99.65 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 99.65 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.65 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 99.65 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 99.65 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 99.65 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 99.65 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.65 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 99.64 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.64 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 99.64 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.64 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.64 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 99.64 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 99.64 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 99.64 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 99.64 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 99.63 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.63 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 99.63 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 99.63 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.63 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 99.63 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 99.63 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 99.62 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 99.62 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 99.62 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 99.62 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 99.62 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.62 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 99.61 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.61 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 99.61 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 99.61 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 99.61 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 99.61 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 99.6 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 99.6 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.6 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 99.6 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 99.6 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 99.59 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.59 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.59 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.59 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 99.59 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.59 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 99.59 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 99.59 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 99.59 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.59 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 99.59 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.58 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 99.58 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 99.58 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 99.58 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.58 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 99.58 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 99.58 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 99.58 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 99.58 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 99.58 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 99.58 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 99.58 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 99.58 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 99.57 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 99.57 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 99.57 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 99.57 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 99.57 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 99.57 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 99.57 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.56 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 99.56 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 99.56 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 99.56 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 99.56 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 99.56 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 99.56 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 99.56 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 99.56 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 99.56 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 99.55 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 99.54 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 99.54 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 99.54 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 99.54 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 99.53 | |
| 4acp_A | 240 | IG gamma-1 chain C region; immune system, antibody | 99.53 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 99.53 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 99.53 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 99.53 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 99.53 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 99.52 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 99.52 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 99.52 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 99.52 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 99.52 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 99.52 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 99.52 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 99.51 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 99.51 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 99.51 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 99.51 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 99.51 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 99.5 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.5 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 99.5 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 99.5 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 99.5 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 99.5 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 99.5 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 99.5 | |
| 1ypz_F | 230 | T-cell receptor gamma chain, beta-2-microglobulin; | 99.49 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 99.49 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 99.49 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 99.49 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 99.49 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.49 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 99.49 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 99.48 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 99.48 | |
| 3qhz_H | 232 | Human monoclonal antibody DEL2D1, FAB heavy chain; | 99.48 | |
| 3to4_D | 253 | NKT vbeta2 (mouse variable domain, human constant; | 99.48 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 99.47 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.47 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.47 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.47 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 99.47 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.47 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 99.47 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 99.47 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.46 | |
| 3tv3_H | 239 | PGT128 heavy chain, IG gamma-1 chain C region; FAB | 99.46 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 99.46 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 99.46 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 99.46 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 99.46 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 99.46 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 99.45 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 99.45 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 99.45 | |
| 3u2s_H | 248 | PG9 heavy chain; greek KEY, immunoglobulin, immune | 99.45 | |
| 1ypz_E | 207 | T cell receptor delta, beta-2-microglobulin; H2-T2 | 99.44 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 99.44 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 99.44 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 99.44 | |
| 1oga_E | 252 | TRBC1, T-cell receptor beta chain C region; immune | 99.44 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 99.44 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 99.43 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 99.43 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 99.43 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 99.43 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 99.42 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 99.42 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 99.42 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 99.42 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 99.42 | |
| 1ow0_A | 214 | IG alpha-1 chain C region; IGA1, fcari, CD89, anti | 99.41 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 99.41 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 99.41 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 99.41 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 99.41 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 99.41 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 99.4 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 99.4 | |
| 3n9g_H | 230 | FAB fragment of MAB CR4354, heavy chain; human neu | 99.4 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.4 | |
| 1iam_A | 185 | ICAM-1, CD54, intercellular adhesion molecule-1; r | 99.4 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 99.4 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 99.39 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 99.39 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 99.39 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 99.39 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 99.39 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 99.39 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 99.39 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 99.38 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 99.38 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 99.38 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 99.38 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 99.38 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 99.37 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 99.37 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 99.37 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 99.37 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 99.37 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 99.37 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.37 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.36 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.36 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 99.36 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 99.36 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 99.36 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 99.36 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 99.35 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 99.35 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 99.35 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 99.35 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.35 |
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-54 Score=604.62 Aligned_cols=348 Identities=20% Similarity=0.323 Sum_probs=263.8
Q ss_pred CCCceecCCcc-eEEeCCCeEEEEEEEeeecCCceEEEE-CCeeccCCCeEEEEEcCcEEEEEEeeeccCC------CeE
Q psy7042 89 EKPDFIVPLKD-LVVPLGKLLTLQCEATGTPVPKCRWLR-NGREISSGARYRVETAGGVFRLHFNEVTDVD------NGD 160 (2245)
Q Consensus 89 ~~P~~~~~~~~-~~v~~G~~v~L~C~~~g~p~~~i~W~~-~g~~l~~~~~~~~~~~~~~~~L~i~~~~~~d------~G~ 160 (2245)
.+|.|+..|.+ +.+..|+.++|.|.+.|.|.|+|.|+| ||..+....+......++ +|.|.+++.+| +|.
T Consensus 37 ~~P~~~~~p~~~~~~~~g~~~~l~C~a~g~p~p~~~W~k~~g~~~~~~~~~~~~~~~g--~l~i~~~~~~~~~~~~d~G~ 114 (816)
T 3dmk_A 37 KGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDG--KLVFPPFRAEDYRQEVHAQV 114 (816)
T ss_dssp EEEEEEECCCSEEEEETTTCEEEECEEEEESCCEEEEEETTSCBCCCBTTTBEECSTT--EEEECCCCGGGCCHHHHEEE
T ss_pred CCCcEEeCCCCeEEEECCCCeEEEeeecCCCCCEEEEEeCCCCCccCCCceEEEeeCC--cEEEcCCChHHccccccceE
Confidence 46899987776 578999999999999999999999999 898887544433334445 48999998886 899
Q ss_pred EEEEEEcCcccc-eeEEEEEecCCCeeecCCCceEEcCCCeEEEEEEEecCC---CceEEEeeCceeee-----cCCceE
Q psy7042 161 YTCEAYNSVGFA-HTSSRVKIGTPPRIDRMPNALYIPEGDNTKVKIFYAGDQ---PMEVSLTKNGRVVQ-----SDDRFK 231 (2245)
Q Consensus 161 Y~C~a~n~~g~~-~~~~~l~V~~~P~~~~~~~~~~v~~G~~~~l~C~~~g~p---~~~i~W~~~g~~l~-----~~~~~~ 231 (2245)
|+|.|.|..|.. +..+.|.+..++.+...+....+.+|+.+.|.|.+.+.+ .+.+.|+|++..+. ...++.
T Consensus 115 Y~C~a~n~~G~~~S~~~~v~~~~~~~~~~~~~~~~v~~G~~v~L~C~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~r~~ 194 (816)
T 3dmk_A 115 YACLARNQFGSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENYFPGAEYDGKYL 194 (816)
T ss_dssp EEEEEEETTEEEEEEEEEEEEECCCCCCCBCCCEEEETTSCEEECCBCCHHHHTTEEEEEEEETTSCEECBSSCBTTTEE
T ss_pred EEEEEecCcceEEccceEEEEEEccccEEEEecceEecCceEEEEECCCccccccEEEEEEEecCceEeccccCCCceEE
Confidence 999999999987 446778887788887778888999999999999976433 27899999887654 244554
Q ss_pred EEEeCCeEEEEEcccCccCc-eeEEEEEEcCCcceE-E---EEEEEEecCCCCCCCCcccceeeccceEEEecCCCCCCC
Q psy7042 232 FTVLDDYIIIFIKEIRKEDA-GDYTVNLSNSSGSVS-G---TFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGG 306 (2245)
Q Consensus 232 ~~~~~~~~~L~i~~~~~~d~-G~Y~C~a~n~~g~~~-~---~~~l~V~~~p~~~~~~~~~~~~~~~s~~~~w~pp~~~~~ 306 (2245)
+...+ .|.|.+++.+|+ |.|+|.|.|..+... . ...|.|..+
T Consensus 195 ~~~~g---~L~I~~v~~~D~~g~Y~C~~~~~~~~~~~~s~~~~~l~v~~~------------------------------ 241 (816)
T 3dmk_A 195 VLPSG---ELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP------------------------------ 241 (816)
T ss_dssp ECTTS---CEEESSCCGGGSSCEEEEEEEETTTCCEEECSBCEEEEEECC------------------------------
T ss_pred EecCc---eEEEecCChhhccceeEEEEeeeeeeeeeecccccceEEeCC------------------------------
Confidence 43333 699999999998 999999987542211 0 011111110
Q ss_pred ceeEEEEEEEEecCCCceEEeeeccCcceEEEcCCCCCCEEEEEEEEEecCCCCCCCCCCCceecCCCCCCCCCCCCcEE
Q psy7042 307 LKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVV 386 (2245)
Q Consensus 307 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~~c~a~n~~g~~~~~~~~~~~~~~~~~~~p~~~~~~~v 386 (2245)
T Consensus 242 -------------------------------------------------------------------------------- 241 (816)
T 3dmk_A 242 -------------------------------------------------------------------------------- 241 (816)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred EeecCCeeEEEecCCCCCCCCCccEEEEEeeecCCCCcEEEeeeecCCceeecCCcccCceEEEEEEeecCCCCCCCCCC
Q psy7042 387 TQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSA 466 (2245)
Q Consensus 387 ~~~~~~~~~l~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~l~~~~~g~y~c~a~n~~g~~~~s~~ 466 (2245)
T Consensus 242 -------------------------------------------------------------------------------- 241 (816)
T 3dmk_A 242 -------------------------------------------------------------------------------- 241 (816)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CCcEEecCCcccCCCceecc--ccccccccccceeeEEEEeccCcCeEEEEeCCeec------CCCccEEEEeeCCeEEE
Q psy7042 467 SNSVQIKDPMAAKAPEIIVP--LRNANAIQNHNAQFQCTITGCPKPTISWLKGSREI------TPSARHHIFAEGDTYTL 538 (2245)
Q Consensus 467 ~~~v~~~~~~~~~~p~~~~~--~~~~~~~~g~~~~l~C~~~g~p~~~v~W~~~~~~i------~~~~~~~~~~~~~~~~L 538 (2245)
....+|.+... +....+.+|+.+.|.|.+.|.|.+.+.|+|++... ....+... .+. .|
T Consensus 242 ---------~~~~~P~i~~~~~~~~~~v~~g~~v~L~C~~~g~p~p~v~W~k~~~~~~~~~~~~~~~~~~~--~~~--~L 308 (816)
T 3dmk_A 242 ---------ISSAVPKVVSLAKFDMKTYSGSSTMALLCPAQGYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ--VSG--TL 308 (816)
T ss_dssp ---------CSCCCCBCCGGGGEEEEEECTTSCEEECCCCBCSSCCEEEEEEECTTSSCEEECCCSSSEEE--ETT--EE
T ss_pred ---------CCCCCCccccccCccceEEeCCCeEEEEEEeeecCCCeEEEEeCCCCCccCcceecCCceEe--ccc--eE
Confidence 00112333222 13456778999999999999999999999964322 12223221 222 89
Q ss_pred EEecccccCCceEEEEEEeCCCCCCcceeEeEecCCCCCCCCCcccceEeeCCCeEEEEEeeeecCCCeEEEEeCCeEee
Q psy7042 539 IINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIE 618 (2245)
Q Consensus 539 ~i~~v~~~d~G~Y~C~a~n~~g~~~~~~~l~v~~~p~~~~~p~~~~~~~~~~g~~~~l~C~~~g~p~~~i~W~~~~~~~~ 618 (2245)
.|.++..+|+|.|+|.|.|..|.....+.|.|..+|.+...+ ....+..|+.++|.|.+.|.|.+.++|+++|..+.
T Consensus 309 ~i~~v~~~D~G~Y~C~a~n~~g~~~~~~~l~V~~~~~~~~~~---~~~~v~~G~~v~l~C~~~g~p~~~v~W~k~g~~~~ 385 (816)
T 3dmk_A 309 IIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDP---PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIG 385 (816)
T ss_dssp EECSCCGGGCEEEEEEEECSSCEEEEEEEEEECEEEEEEEES---SEEECCTTSCEEEEEEEEEECCCEEEEEETTEECS
T ss_pred EECCCCHhHCEEEEEEEEcCCCceEEEEEEEEcCCCceeeCC---CceEecCCCCEEEEEEEeccCCCEEEEEECCEECC
Confidence 999999999999999999999988888888888766544333 23567889999999999999999999999998875
Q ss_pred ccCeEEEEecCCeEEEEEcCCCCCcCEEEEEEEEeCCCC
Q psy7042 619 SGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGM 657 (2245)
Q Consensus 619 ~~~~~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~g~ 657 (2245)
.. ...|.|.+++.+|.|.|+|.|.|..|.
T Consensus 386 ~~----------~~~L~i~~v~~~d~G~Y~C~a~n~~g~ 414 (816)
T 3dmk_A 386 HS----------ESVLRIESVKKEDKGMYQCFVRNDRES 414 (816)
T ss_dssp CC----------SSEEEESSCCGGGCEEEEEEEECSSCE
T ss_pred CC----------CCEEEEcCCCHHHCEEEEEEEECCCCc
Confidence 43 257999999999999999999987663
|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... | Back alignment and structure |
|---|
| >3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* | Back alignment and structure |
|---|
| >1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 2245 | ||||
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 1e-37 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 1e-34 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 3e-25 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 3e-25 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-22 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 9e-15 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 8e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 8e-09 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 2e-08 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 9e-07 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 8e-05 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 5e-04 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 8e-22 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-21 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 1e-20 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 1e-20 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-20 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 6e-19 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 9e-19 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 9e-19 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 9e-15 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 5e-11 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-10 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 1e-04 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 3e-21 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 4e-21 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 4e-21 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 6e-21 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-20 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-20 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 5e-20 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 5e-20 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 9e-18 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 4e-17 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 4e-17 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 3e-13 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-06 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-05 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 4e-20 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 3e-19 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 7e-18 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 7e-18 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 2e-17 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 2e-17 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 3e-15 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 1e-14 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 2e-08 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 1e-07 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 1e-19 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-18 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-18 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 6e-18 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 2e-16 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 2e-16 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 2e-16 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-16 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 2e-09 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 1e-07 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 4e-05 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-19 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 2e-19 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 3e-19 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 6e-18 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 1e-17 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 1e-17 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 4e-15 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 4e-15 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 5e-13 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 2e-12 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 3e-07 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 2e-04 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 3e-04 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 7e-19 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-18 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-18 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 2e-15 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 5e-15 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 5e-15 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 2e-14 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 4e-14 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 3e-13 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 5e-06 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 3e-05 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 0.003 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-18 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-18 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 4e-15 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 3e-12 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 5e-12 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-11 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-11 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-10 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 8e-05 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 1e-04 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 7e-04 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 2e-18 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 1e-17 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 4e-17 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 4e-17 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 2e-16 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 2e-16 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 8e-16 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 5e-13 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 5e-13 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 3e-08 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-17 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-17 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 7e-14 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 1e-13 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-13 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-13 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-13 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 8e-13 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 3e-05 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 3e-04 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 2e-17 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 3e-17 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 3e-17 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 7e-17 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-15 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-15 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 8e-15 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 9e-15 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 6e-13 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-07 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 2e-06 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 4e-05 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 3e-17 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 3e-17 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 3e-17 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 3e-17 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 4e-17 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 4e-14 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 2e-13 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 3e-12 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 3e-12 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 1e-08 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 9e-05 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 4e-04 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 4e-17 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 4e-17 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 1e-16 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-14 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-14 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-13 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-13 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-09 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-06 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-05 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 0.004 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 4e-17 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 5e-17 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 8e-17 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 8e-17 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 8e-17 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 6e-15 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 6e-15 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 7e-15 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-13 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-13 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 4e-12 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-10 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 4e-05 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 6e-05 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 1e-16 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 4e-12 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 6e-12 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 6e-12 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 8e-12 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-10 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-10 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 3e-07 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 8e-06 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 1e-04 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 1e-16 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 1e-16 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 1e-13 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 1e-13 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 7e-11 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 2e-10 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 5e-09 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 5e-09 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 4e-05 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-16 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 4e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 5e-14 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-11 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-04 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 5e-04 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 7e-04 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 1e-16 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 2e-16 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 2e-16 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 2e-16 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 4e-16 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 4e-16 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-16 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-16 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 3e-15 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-13 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 2e-12 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 2e-12 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 3e-12 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-08 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-05 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-04 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 5e-16 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-15 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-15 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-15 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 2e-13 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 5e-12 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 5e-12 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-11 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 4e-11 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 5e-07 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-06 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 0.001 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 1e-15 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 9e-15 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 9e-15 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 3e-13 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 3e-13 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 2e-12 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 2e-10 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 1e-09 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 3e-05 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 1e-04 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 1e-15 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 1e-15 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 6e-15 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 6e-15 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 1e-13 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 8e-12 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 1e-09 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 2e-06 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 2e-06 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 1e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 4e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 6e-14 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 6e-14 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-13 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-11 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 7e-05 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 5e-04 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-15 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 2e-15 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 3e-15 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 3e-15 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-15 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-15 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-15 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-14 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-14 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-12 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 2e-08 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-06 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-06 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-06 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 5e-15 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 5e-15 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-14 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-13 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-13 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 6e-13 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 8e-13 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-08 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 8e-05 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-04 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 5e-15 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 5e-15 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 6e-15 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 7e-15 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 7e-15 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 4e-14 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 9e-14 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 9e-14 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 2e-13 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 5e-11 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 3e-04 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 8e-04 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 7e-15 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 7e-15 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 9e-15 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-12 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-12 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 5e-12 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-11 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-11 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-11 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-07 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-06 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-05 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 1e-14 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 1e-14 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 1e-14 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 5e-13 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 5e-13 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 8e-12 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 3e-11 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 5e-11 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 5e-11 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 4e-07 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 1e-06 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 6e-05 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-14 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-11 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-11 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 4e-11 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-10 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 3e-09 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 3e-09 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 7e-05 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 8e-05 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 4e-04 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 1e-14 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 1e-14 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 1e-14 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 2e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 2e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 2e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 2e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 5e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 5e-09 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 3e-05 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 2e-14 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 2e-14 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-14 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 3e-14 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 3e-14 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 1e-09 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 1e-09 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 6e-07 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 6e-05 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 3e-04 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 3e-04 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 7e-04 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 3e-14 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 3e-14 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 8e-12 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 8e-12 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-11 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-10 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-10 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 9e-10 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 1e-09 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-06 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-06 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 6e-14 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 6e-14 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 2e-13 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 1e-11 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 2e-11 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 8e-09 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 8e-09 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 3e-05 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 1e-04 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 3e-04 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 9e-14 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 5e-12 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 6e-12 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 6e-12 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 9e-12 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 9e-12 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 2e-11 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 1e-08 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 7e-05 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 5e-04 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-13 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 2e-13 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 2e-13 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-12 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-12 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 2e-11 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 2e-10 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-07 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 0.004 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 1e-13 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-13 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-13 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-11 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-11 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-10 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-10 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-10 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-08 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 0.001 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 0.001 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 1e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 1e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 2e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 2e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-12 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 2e-11 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-11 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-11 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 4e-08 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 9e-07 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 2e-05 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-13 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 5e-10 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 5e-10 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-08 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 3e-08 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 7e-08 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 7e-08 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 3e-05 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 9e-05 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 3e-04 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 2e-13 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 1e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 1e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 2e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 2e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 4e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 4e-09 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 6e-05 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 8e-05 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 0.004 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 2e-13 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 2e-13 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 8e-12 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 8e-12 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 3e-11 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 4e-07 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 4e-07 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 1e-06 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 2e-05 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 3e-13 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 2e-11 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 2e-11 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 5e-11 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 7e-11 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 7e-11 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 1e-10 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 1e-07 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 3e-06 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 4e-05 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 3e-13 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 3e-13 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 6e-11 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 6e-11 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 5e-08 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 2e-07 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 6e-04 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 3e-13 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 9e-13 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 9e-13 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 3e-12 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-11 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-11 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-10 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-10 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 5e-04 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 4e-13 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 4e-13 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 1e-10 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-10 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-10 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 5e-09 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 4e-07 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-06 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-06 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 5e-13 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 5e-13 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 5e-13 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 9e-12 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 6e-11 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 4e-10 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 3e-08 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 3e-08 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 5e-06 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 6e-06 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 3e-05 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 5e-13 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 5e-13 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 5e-13 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 5e-13 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 5e-13 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 4e-12 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 7e-11 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 7e-11 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 5e-10 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 7e-07 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 6e-05 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 2e-04 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 6e-13 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 6e-13 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 1e-10 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 2e-10 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 7e-10 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 6e-09 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 6e-09 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 7e-07 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 4e-05 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 0.003 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 7e-13 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 5e-12 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 2e-11 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 2e-11 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 3e-10 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 3e-10 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 4e-09 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 7e-07 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 9e-13 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 1e-11 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 1e-11 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 4e-11 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 2e-09 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 2e-09 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 3e-08 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 1e-05 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 1e-12 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 1e-12 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 5e-12 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 2e-08 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 5e-08 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 5e-08 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 5e-07 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 2e-05 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 1e-12 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-12 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-12 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 5e-11 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 5e-11 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-10 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 1e-06 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 2e-06 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 2e-06 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 3e-06 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 1e-12 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 2e-12 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 2e-12 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 1e-09 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 1e-09 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 1e-09 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 6e-09 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 1e-08 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 4e-04 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 0.002 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 2e-12 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-12 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-12 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 1e-10 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 4e-09 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-08 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-08 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-06 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-04 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 2e-04 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 5e-04 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 2e-12 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 1e-11 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 1e-11 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 7e-11 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 5e-09 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 5e-09 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 2e-08 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 9e-06 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 3e-05 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 3e-04 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 2e-12 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-11 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-11 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-11 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-11 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 1e-09 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-09 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 2e-08 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 2e-04 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 0.004 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 3e-12 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 3e-12 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 2e-11 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 2e-10 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 3e-10 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 3e-10 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 4e-10 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 1e-06 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 5e-05 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 5e-05 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 3e-12 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 3e-12 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-10 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 9e-09 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-08 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-08 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-07 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 3e-05 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 3e-12 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 5e-12 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 8e-12 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 9e-12 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 1e-10 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 8e-10 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 8e-10 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 5e-08 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 9e-08 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 9e-08 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 2e-05 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 4e-04 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 0.002 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 9e-12 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 9e-12 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-11 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 5e-11 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 5e-11 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-10 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-08 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 9e-08 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-07 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-06 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 9e-12 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 9e-12 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 8e-11 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 8e-11 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 3e-09 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 3e-06 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 4e-06 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 8e-05 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 8e-05 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 9e-12 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 2e-11 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 7e-11 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 7e-11 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 2e-10 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 1e-08 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 1e-08 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 4e-04 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 0.004 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 1e-11 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-11 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-11 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 4e-08 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-08 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-08 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 3e-07 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 4e-07 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 4e-07 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-11 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-10 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-10 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-09 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 6e-09 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 6e-09 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 5e-06 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-05 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 2e-05 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-11 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-10 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-10 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 4e-10 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 4e-10 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 1e-09 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-07 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-07 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 2e-11 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 2e-11 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 2e-11 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 2e-09 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 2e-09 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 1e-07 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 4e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-11 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-08 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-08 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 3e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 3e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-06 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-05 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-04 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 0.002 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 3e-11 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-10 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-10 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-09 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-08 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-08 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 5e-07 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 6e-07 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 3e-11 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 3e-11 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 2e-08 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 3e-08 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 6e-08 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 3e-11 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 3e-11 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 9e-11 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 1e-09 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 1e-09 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 3e-08 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 5e-08 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 2e-07 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 4e-11 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 4e-11 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 4e-11 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-10 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-10 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 3e-10 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 2e-09 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 3e-09 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 4e-09 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 8e-05 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 8e-05 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 7e-11 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 7e-11 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 7e-11 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 7e-11 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 5e-10 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 7e-08 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 1e-07 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 1e-07 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 3e-07 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 8e-05 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 0.003 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 0.003 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 8e-11 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 2e-07 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 3e-07 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 3e-07 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 8e-07 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 8e-07 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 1e-06 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 8e-11 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 8e-11 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 2e-09 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 2e-09 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 7e-08 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 1e-06 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 5e-05 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 9e-05 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 9e-05 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 9e-11 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 9e-11 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 7e-08 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 7e-08 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 2e-05 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 3e-04 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 6e-04 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 6e-04 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 9e-11 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-10 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-10 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-06 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 8e-06 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 0.004 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 2e-10 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 2e-10 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 2e-09 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 2e-09 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 5e-05 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 2e-10 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 2e-09 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 2e-09 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 5e-09 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 5e-09 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 7e-08 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 1e-07 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 3e-04 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-10 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-10 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-10 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 9e-10 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 9e-10 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 1e-08 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-08 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-04 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.002 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.002 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-10 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-08 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 7e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-06 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 5e-06 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 5e-06 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 3e-10 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 3e-10 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 8e-06 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 8e-06 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 3e-05 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 4e-04 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 4e-04 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 3e-10 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 4e-10 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 4e-10 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 4e-10 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 4e-10 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 1e-09 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 1e-09 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 3e-09 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 1e-08 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 1e-08 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 2e-04 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 4e-10 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 4e-09 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-07 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-07 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 6e-07 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 6e-07 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 7e-07 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 4e-06 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-04 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 4e-10 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 1e-07 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 1e-07 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 2e-05 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 2e-05 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 2e-05 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 3e-05 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 3e-05 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 5e-10 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 5e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 5e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 4e-08 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 6e-08 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 4e-07 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 0.002 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 5e-10 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 5e-10 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 2e-09 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 2e-09 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 2e-05 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 6e-05 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 5e-10 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 5e-10 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 8e-10 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 8e-10 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 0.001 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 0.001 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 0.002 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 6e-10 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 6e-10 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 6e-10 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 6e-09 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 9e-09 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 3e-08 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 3e-08 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 0.001 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 0.002 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 6e-10 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 3e-08 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 3e-08 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 3e-08 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 5e-08 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 5e-08 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 6e-06 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 6e-04 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 7e-10 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 7e-10 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-09 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-07 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-07 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-07 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-07 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-06 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 9e-04 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.004 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 8e-10 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 8e-10 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 7e-07 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 7e-07 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 1e-09 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 1e-09 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 9e-09 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 1e-07 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 1e-07 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 8e-06 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 8e-05 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 8e-05 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-09 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-09 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 4e-09 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 5e-09 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 5e-09 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-08 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-08 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-06 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 1e-09 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 1e-09 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 1e-05 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 1e-05 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 2e-05 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 3e-05 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 3e-05 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-09 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 2e-09 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 2e-09 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 1e-08 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 1e-08 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 2e-05 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 5e-04 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 5e-04 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 2e-09 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 2e-09 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 5e-09 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 5e-09 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 9e-05 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 7e-04 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 4e-09 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-08 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-08 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 4e-08 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 4e-08 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-07 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-07 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 4e-05 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 8e-04 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 0.001 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 4e-09 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 4e-09 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 2e-08 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 3e-07 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 3e-07 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 9e-06 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 4e-04 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 0.002 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 0.002 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 4e-09 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 5e-08 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 5e-08 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 7e-07 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 2e-06 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 2e-06 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 3e-06 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 5e-05 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 0.004 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 0.004 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 5e-09 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 5e-09 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 5e-09 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 2e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 2e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 3e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 6e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 3e-06 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 5e-04 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 0.004 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 5e-09 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 5e-09 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 6e-09 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 6e-09 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 1e-06 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 2e-06 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 7e-06 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 2e-05 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 7e-09 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 7e-09 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 7e-07 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 7e-07 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 3e-05 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 1e-04 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 1e-04 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 3e-04 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 4e-04 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 9e-09 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 9e-09 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 1e-08 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 1e-08 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 2e-05 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 6e-04 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 6e-04 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 1e-08 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 2e-08 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 2e-08 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 6e-08 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 1e-07 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 1e-07 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 1e-06 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 9e-05 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 4e-04 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 0.002 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-08 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-08 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-08 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-08 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-08 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-06 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-05 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-04 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 2e-08 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 2e-08 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 2e-07 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 2e-07 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 4e-04 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 7e-04 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 7e-04 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 2e-08 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 2e-08 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 3e-04 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 5e-04 | |
| d1erna2 | 105 | b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor | 2e-08 | |
| d1erna2 | 105 | b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor | 3e-06 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-08 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-08 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 5e-08 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 6e-08 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 1e-06 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-06 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-06 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 8e-04 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 4e-08 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 4e-08 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-07 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 8e-07 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 5e-04 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 6e-08 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 1e-07 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 8e-07 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 8e-07 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 4e-06 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 4e-06 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 1e-04 | |
| d1tiua_ | 89 | b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re | 7e-08 | |
| d1tiua_ | 89 | b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re | 7e-08 | |
| d1tiua_ | 89 | b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re | 8e-08 | |
| d1tiua_ | 89 | b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re | 8e-08 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 7e-08 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 9e-07 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 9e-07 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 4e-06 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 4e-06 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 3e-05 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 7e-05 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 8e-08 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 8e-08 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 1e-05 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 1e-05 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 4e-04 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 1e-07 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 1e-07 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 8e-05 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 8e-05 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 2e-07 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 2e-07 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 2e-06 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 4e-05 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 9e-05 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 9e-05 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 3e-07 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 3e-07 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 4e-05 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 4e-05 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 3e-07 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 3e-07 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 1e-05 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 6e-05 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 6e-05 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-07 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 7e-07 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-06 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-06 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-06 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 7e-06 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 7e-06 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-05 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-04 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 8e-07 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 8e-07 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 3e-06 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 3e-06 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 5e-05 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 5e-05 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 2e-04 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 2e-04 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 9e-07 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 9e-07 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 8e-06 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 8e-06 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 6e-04 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 0.004 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 0.004 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 1e-06 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 1e-06 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 0.001 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 0.001 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 3e-06 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 3e-06 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 1e-05 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 1e-05 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 2e-04 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 0.002 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 0.002 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 3e-06 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 3e-06 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 1e-04 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 1e-04 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 4e-06 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 4e-06 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 7e-05 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 7e-05 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 0.002 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 5e-06 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 9e-06 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 9e-06 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 6e-05 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 6e-05 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 3e-04 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 7e-06 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 7e-06 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 8e-06 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 3e-05 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 6e-05 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 6e-05 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 8e-05 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 2e-05 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 2e-05 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 3e-04 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 3e-04 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 0.001 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 0.003 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 5e-05 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 8e-05 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 8e-05 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 3e-04 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 3e-04 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 0.003 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 0.003 | |
| d1cs6a2 | 105 | b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall | 6e-05 | |
| d1cs6a2 | 105 | b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall | 6e-05 | |
| d1cs6a2 | 105 | b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall | 0.001 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 9e-05 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 9e-05 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 0.004 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 0.004 | |
| d1hnga1 | 98 | b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no | 2e-04 | |
| d1hnga1 | 98 | b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no | 2e-04 | |
| d1biha2 | 111 | b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecro | 2e-04 | |
| d1nbqa1 | 105 | b.1.1.1 (A:25-129) Junction adhesion molecule, JAM | 4e-04 | |
| d1nbqa1 | 105 | b.1.1.1 (A:25-129) Junction adhesion molecule, JAM | 4e-04 | |
| d3d85d3 | 94 | b.1.2.1 (D:212-305) The p40 domain of interleukin- | 4e-04 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 4e-04 | |
| d1vcaa2 | 90 | b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 | 0.004 | |
| d1vcaa2 | 90 | b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 | 0.004 | |
| d1gsma1 | 90 | b.1.1.4 (A:1-90) Mucosal addressin cell adhesion m | 0.004 | |
| d1gsma1 | 90 | b.1.1.4 (A:1-90) Mucosal addressin cell adhesion m | 0.004 |
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Twitchin, kinase domain species: California sea hare (Aplysia californica), twk43 [TaxId: 6500]
Score = 144 bits (363), Expect = 1e-37
Identities = 71/109 (65%), Positives = 87/109 (79%)
Query: 792 VSDYDQYVFDIYSKYVPQPVDIKTSSVYDHYDILEEIGTGAFGVVHRCRERKTGNIFAAK 851
++DYD++ DI+ KYVPQPV++K SVYD+YDILEE+G+GAFGVVHRC E+ TG +F AK
Sbjct: 1 INDYDKFYEDIWKKYVPQPVEVKQGSVYDYYDILEELGSGAFGVVHRCVEKATGRVFVAK 60
Query: 852 FIPVSHNLEKELIRKEIDIMNQLHHPKLINLHDAFEDDDEMVLIFEVLD 900
FI + L+K ++ EI IMNQLHHPKLINLHDAFED EMVLI E L
Sbjct: 61 FINTPYPLDKYTVKNEISIMNQLHHPKLINLHDAFEDKYEMVLILEFLS 109
|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 111 | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2245 | |||
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.63 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 99.62 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 99.61 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.61 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.6 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 99.56 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.55 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.55 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 99.54 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.54 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 99.53 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.51 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 99.49 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.46 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.46 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.45 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 99.43 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.41 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 99.41 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 99.4 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.4 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 99.39 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 99.39 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 99.38 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 99.38 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.38 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 99.38 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 99.37 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 99.37 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 99.36 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 99.36 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.35 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.35 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 99.35 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.35 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 99.35 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 99.34 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 99.34 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.34 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.34 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 99.33 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 99.33 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 99.32 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.32 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.31 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 99.31 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 99.31 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 99.31 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.31 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 99.3 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 99.3 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.3 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 99.3 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.3 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 99.29 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 99.29 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 99.29 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 99.29 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 99.28 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 99.27 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 99.27 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.27 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 99.27 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 99.26 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.26 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.26 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 99.26 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.25 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.25 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 99.24 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 99.24 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 99.23 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 99.23 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.22 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.22 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 99.22 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.21 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 99.2 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.2 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 99.19 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 99.18 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 99.18 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.17 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 99.16 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 99.15 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.14 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 99.12 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.11 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.11 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.1 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.1 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 99.1 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.09 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 99.09 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 99.09 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.08 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 99.08 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.08 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 99.08 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 99.07 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.06 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 99.06 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.06 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.04 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.04 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.02 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.01 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 99.01 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.01 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.01 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.0 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.0 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 99.0 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 98.99 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.99 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.99 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 98.99 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 98.99 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 98.98 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.98 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.97 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 98.97 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 98.97 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 98.96 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 98.96 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 98.95 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 98.95 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 98.95 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.94 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 98.94 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 98.94 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 98.94 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 98.93 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 98.93 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.92 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 98.92 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 98.92 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.9 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 98.9 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.88 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 98.87 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 98.86 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.86 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 98.85 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.85 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 98.85 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.84 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 98.83 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.82 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 98.82 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 98.82 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.81 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.8 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 98.79 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.79 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 98.79 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.78 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 98.78 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.77 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 98.76 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 98.76 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.75 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 98.75 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.74 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.74 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 98.74 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 98.73 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.72 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 98.72 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.71 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.71 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.71 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.7 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.7 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.7 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.69 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.68 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 98.68 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.68 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.68 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 98.67 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.65 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 98.65 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.65 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.64 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 98.63 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.63 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 98.62 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 98.62 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 98.61 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 98.61 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 98.6 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.6 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.6 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 98.6 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.6 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.6 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 98.6 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 98.59 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.59 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 98.59 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 98.59 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.59 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.58 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.58 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 98.57 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 98.57 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 98.57 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.57 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 98.56 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.56 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.56 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 98.56 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.55 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 98.55 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.54 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.54 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 98.54 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 98.54 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.53 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.53 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.53 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 98.53 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.53 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.52 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 98.52 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 98.52 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.52 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 98.52 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.52 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.51 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.51 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.5 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.5 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.5 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.5 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 98.49 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 98.48 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.48 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 98.46 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.46 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.45 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 98.45 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.44 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 98.43 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.38 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 98.38 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.37 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 98.35 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.35 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 98.31 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.3 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 98.3 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.28 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 98.28 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 98.25 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 98.25 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 98.24 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.24 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.21 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 98.21 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.19 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 98.19 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.18 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 98.17 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 98.16 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 98.15 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.15 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.14 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.14 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.14 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.13 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.12 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.1 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.09 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 98.09 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.09 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.09 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.08 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.08 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.07 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.07 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.06 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 98.05 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.05 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 98.04 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.04 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 98.03 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.02 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.02 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.02 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 98.01 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 98.0 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.0 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 98.0 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 97.99 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.99 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 97.98 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 97.97 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 97.97 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.95 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 97.95 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 97.95 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 97.95 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 97.94 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 97.94 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 97.94 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.93 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.92 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 97.92 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 97.91 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 97.89 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.89 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 97.89 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.89 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 97.88 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.88 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.88 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 97.87 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 97.87 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.86 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.86 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 97.86 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 97.85 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 97.85 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.84 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 97.84 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 97.83 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 97.82 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 97.82 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 97.8 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 97.8 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.8 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.79 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 97.79 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 97.79 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 97.79 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 97.79 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 97.78 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 97.78 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.77 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 97.77 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 97.77 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 97.76 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 97.76 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.75 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 97.75 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.75 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 97.74 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.74 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.73 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 97.73 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 97.73 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.73 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.72 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 97.72 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 97.71 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.71 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 97.71 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 97.71 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.68 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 97.68 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.68 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 97.68 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 97.68 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 97.66 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 97.64 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 97.64 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 97.64 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.63 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 97.63 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 97.62 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 97.62 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.62 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.61 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 97.6 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 97.59 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.58 | |
| d1muja1 | 100 | Class II MHC alpha chain, C-terminal domain {Mouse | 97.57 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 97.57 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.57 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.57 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.57 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 97.55 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 97.53 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.52 | |
| d1dr9a2 | 95 | CD80, second domain {Human (Homo sapiens) [TaxId: | 97.52 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 97.51 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 97.51 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.51 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.5 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 97.5 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.5 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.49 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.49 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.48 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.48 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 97.47 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 97.47 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.47 | |
| d1lk2b_ | 99 | beta2-microglobulin {Mouse (Mus musculus) [TaxId: | 97.47 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 97.47 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 97.47 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 97.47 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 97.46 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.45 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 97.45 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 97.44 | |
| d1k5nb_ | 100 | beta2-microglobulin {Human (Homo sapiens) [TaxId: | 97.42 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.42 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.41 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.37 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 97.36 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 97.35 | |
| d1muja1 | 100 | Class II MHC alpha chain, C-terminal domain {Mouse | 97.34 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 97.34 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 97.33 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.33 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.33 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 97.33 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.31 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.31 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.31 | |
| d1hdmb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 97.3 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.3 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.28 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.28 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 97.28 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.28 | |
| d1fnga1 | 101 | Class II MHC alpha chain, C-terminal domain {Mouse | 97.25 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 97.24 | |
| d1de4a1 | 94 | Hemochromatosis protein Hfe, alpha-3 domain {Human | 97.23 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.22 | |
| d1lk2b_ | 99 | beta2-microglobulin {Mouse (Mus musculus) [TaxId: | 97.21 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.21 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 97.21 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.2 | |
| d1dr9a2 | 95 | CD80, second domain {Human (Homo sapiens) [TaxId: | 97.2 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.19 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 97.18 | |
| d1uvqa1 | 99 | Class II MHC alpha chain, C-terminal domain {Human | 97.18 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 97.16 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.16 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 97.16 | |
| d1nfdb1 | 113 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.16 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.15 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 97.15 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.15 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 97.14 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.14 | |
| d2bnub1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.14 | |
| d1d5mb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 97.13 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 97.12 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.12 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.11 | |
| d1k5nb_ | 100 | beta2-microglobulin {Human (Homo sapiens) [TaxId: | 97.09 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.07 | |
| d1de4a1 | 94 | Hemochromatosis protein Hfe, alpha-3 domain {Human | 97.06 | |
| d1kxvc_ | 119 | Camelid IG heavy chain variable domain, VHh {Camel | 97.05 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.03 | |
| d1nlbh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.03 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.02 | |
| d1mjuh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.02 | |
| d1mfah1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.02 | |
| d1qnzh_ | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.01 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.01 | |
| d1pg7x1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.0 | |
| d7fabh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.0 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.0 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 96.99 | |
| d3b5ha2 | 80 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 96.98 | |
| d1jpth1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 96.97 | |
| d1fltx_ | 95 | Second domain of the Flt-1 receptor {Human (Homo s | 96.96 | |
| d2jelh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 96.96 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 96.95 | |
| d1a2yb_ | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 96.93 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 96.92 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 96.92 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.92 |
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Twitchin species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=99.63 E-value=3.3e-16 Score=146.15 Aligned_cols=95 Identities=29% Similarity=0.456 Sum_probs=89.3
Q ss_pred CceEEeeccceeeecCccEEEEEEEEeeCCCeEEEeeCCEeeCCCCcEEEEEeCcEEEEEEcCCCCCCCeEEEEEEEeCC
Q psy7042 2087 APEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKG 2166 (2245)
Q Consensus 2087 ~p~~~~~~~~~~~~~g~~v~l~C~~~g~P~p~i~W~~~g~~l~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~N~~ 2166 (2245)
.|.|...+.++.+.+|+++.|.|.+.|.|.|.|+|+|||+.|..+.++.+..+++.+.|.|.++..+|+|.|+|.|.|.+
T Consensus 1 ~P~f~~~p~~~~v~~G~~~~l~C~~~g~P~p~v~W~~~~~~l~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~ 80 (97)
T d1koaa1 1 QPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSY 80 (97)
T ss_dssp SCEEEECCCCCEEETTSCEEEEEEEECSSCCEEEEEETTEECCSBTTBBCCCSTTEEEEEESCCCSGGGSCEEEEEEETT
T ss_pred CCEEEEeCCCEEEeCCCcEEEEEEEEEcCCCEEEEEEeeeccceeeEEEEEecCCeeEEEeCCCceecCEEEEEEEEECC
Confidence 38899999999999999999999999999999999999999999989988888989999999999999999999999999
Q ss_pred ceeeEEEEEEEEcCC
Q psy7042 2167 GVKSTKAELIIMTAP 2181 (2245)
Q Consensus 2167 G~~~~~~~l~V~~~p 2181 (2245)
|..+.++.|.|...+
T Consensus 81 G~~~~~~~l~V~~~~ 95 (97)
T d1koaa1 81 GTKEEIVFLNVTRHS 95 (97)
T ss_dssp EEEEEEECCEEECSC
T ss_pred CEEEEEEEEEEeecC
Confidence 999999999997543
|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|