Psyllid ID: psy7214


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLGQSDNLTKKDSNEQSVKPIQQMTRTKSTKFSTQLKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVKKEISHLH
ccccccccccccccccccEEEccccccEEEEEccccccccEEEEEEEccccEEcccccEEEEEEEccccccEEEcccccHHHHHHcccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHccccccHHHHHHHHccccccccccEEEEEEccccccccEEcccccEEEEEEEEEEEEcccccc
ccccccccEcccccccccEEEEEcccEEEEEEcccccccccEEEEEEccccEEcccccEEEEEEEcccccEEEEcccHHHHHHHcccccccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccEccccEEEEEEccccccccHccccccEEEEEEEEEEEHHHHccc
dpyyngpfkrtsgtrddpnlvRSAFKSrlvgcvceedQYHIVWMWVEadmprrcacghwfkLKLICRGGVHVAIGSNWSKWILSSVgylgqsdnltkkdsneqsvkpiqqmtrtkstkFSTQLKASTLCGQLDMALesllptpgsllsklvlgrdpkvhhfnrfrirfgsggnrterlqgkgnvfqATRLVVVKKEISHLH
dpyyngpfkrtsgtrddpnlvRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLGQSdnltkkdsneqsvkpiqqmtrtkstkfsTQLKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNrfrirfgsggnrterlqgkgnvfqatrlvvvkkeishlh
DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLGQSDNLTKKDSNEQSVKPIQQMTRTKSTKFSTQLKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVKKEISHLH
********************VRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLG***********************************STLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVK*******
DPYYNG*FK****TRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVG***************************************TLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGG******QGKGNVFQATRLVVVKKEIS***
DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLGQSDNLTK*************************LKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVKKEISHLH
*PYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYL*Q*D**T*******S************TKFSTQLKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVKKEIS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWFKLKLICRGGVHVAIGSNWSKWILSSVGYLGQSDNLTKKDSNEQSVKPIQQMTRTKSTKFSTQLKASTLCGQLDMALESLLPTPGSLLSKLVLGRDPKVHHFNRFRIRFGSGGNRTERLQGKGNVFQATRLVVVKKEISHLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
P19536128 Cytochrome c oxidase subu yes N/A 0.308 0.484 0.476 4e-11
P12075129 Cytochrome c oxidase subu yes N/A 0.308 0.480 0.476 4e-11
P00428129 Cytochrome c oxidase subu yes N/A 0.308 0.480 0.476 6e-11
P10606129 Cytochrome c oxidase subu yes N/A 0.308 0.480 0.492 9e-11
Q5S3G4129 Cytochrome c oxidase subu yes N/A 0.308 0.480 0.476 9e-11
Q5REG2129 Cytochrome c oxidase subu yes N/A 0.308 0.480 0.492 1e-10
Q710D6128 Cytochrome c oxidase subu N/A N/A 0.308 0.484 0.444 5e-10
Q9SSB8171 Cytochrome c oxidase subu yes N/A 0.293 0.345 0.348 8e-05
Q9LW15176 Cytochrome c oxidase subu no N/A 0.293 0.335 0.333 0.0001
>sp|P19536|COX5B_MOUSE Cytochrome c oxidase subunit 5B, mitochondrial OS=Mus musculus GN=Cox5b PE=1 SV=1 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 1   DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCA-CGHW 59
           DPY   P K  SGT++DPNLV S    R+VGC+CEED   ++W W+     +RC  CG  
Sbjct: 59  DPYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTH 118

Query: 60  FKL 62
           +KL
Sbjct: 119 YKL 121




This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Mus musculus (taxid: 10090)
>sp|P12075|COX5B_RAT Cytochrome c oxidase subunit 5B, mitochondrial OS=Rattus norvegicus GN=Cox5b PE=1 SV=2 Back     alignment and function description
>sp|P00428|COX5B_BOVIN Cytochrome c oxidase subunit 5B, mitochondrial OS=Bos taurus GN=COX5B PE=1 SV=2 Back     alignment and function description
>sp|P10606|COX5B_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens GN=COX5B PE=1 SV=2 Back     alignment and function description
>sp|Q5S3G4|COX5B_PIG Cytochrome c oxidase subunit 5B, mitochondrial OS=Sus scrofa GN=COX5B PE=2 SV=1 Back     alignment and function description
>sp|Q5REG2|COX5B_PONAB Cytochrome c oxidase subunit 5B, mitochondrial OS=Pongo abelii GN=COX5B PE=2 SV=1 Back     alignment and function description
>sp|Q710D6|COX5B_VULVU Cytochrome c oxidase subunit 5B, mitochondrial OS=Vulpes vulpes GN=COX5B PE=1 SV=1 Back     alignment and function description
>sp|Q9SSB8|CX5B2_ARATH Cytochrome c oxidase subunit 5b-2, mitochondrial OS=Arabidopsis thaliana GN=COX5B-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW15|CX5B1_ARATH Cytochrome c oxidase subunit 5b-1, mitochondrial OS=Arabidopsis thaliana GN=COX5B-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
289740249120 cytochrome c oxidase subunit Vb COX4 [Gl 0.308 0.516 0.564 5e-17
58386537119 AGAP008724-PA [Anopheles gambiae str. PE 0.308 0.521 0.612 8e-17
170037183119 cytochrome c oxidase, subunit VB [Culex 0.308 0.521 0.612 9e-17
288856322122 cytochrome c oxidase subunit 5B, mitocho 0.308 0.508 0.629 1e-16
157119566119 cytochrome c oxidase, subunit VB, putati 0.308 0.521 0.612 2e-16
193620134128 PREDICTED: cytochrome c oxidase subunit 0.318 0.5 0.562 5e-16
307168272 470 Cytochrome c oxidase subunit 5B, mitocho 0.308 0.131 0.532 9e-16
269146716119 cytochrome c oxidase subunit Vb/COX4 [Si 0.308 0.521 0.564 2e-15
240848562128 cytochrome c oxidase subunit 5B, mitocho 0.308 0.484 0.564 2e-15
195118826120 GI20346 [Drosophila mojavensis] gi|19391 0.308 0.516 0.532 2e-15
>gi|289740249|gb|ADD18872.1| cytochrome c oxidase subunit Vb COX4 [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 51/62 (82%)

Query: 1   DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWF 60
           +P+    FKR +GT+++PNL+ SAF++R+VGC+CEEDQ ++ WMW++ D P+RC CGHWF
Sbjct: 53  NPFDMKVFKRGAGTKENPNLIPSAFEARIVGCICEEDQTYVQWMWLQKDSPKRCECGHWF 112

Query: 61  KL 62
           KL
Sbjct: 113 KL 114




Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|58386537|ref|XP_314835.2| AGAP008724-PA [Anopheles gambiae str. PEST] gi|55239920|gb|EAA10211.2| AGAP008724-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170037183|ref|XP_001846439.1| cytochrome c oxidase, subunit VB [Culex quinquefasciatus] gi|167880193|gb|EDS43576.1| cytochrome c oxidase, subunit VB [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|288856322|ref|NP_001165813.1| cytochrome c oxidase subunit 5B, mitochondrial [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157119566|ref|XP_001659427.1| cytochrome c oxidase, subunit VB, putative [Aedes aegypti] gi|157134235|ref|XP_001663201.1| cytochrome c oxidase, subunit VB, putative [Aedes aegypti] gi|108870556|gb|EAT34781.1| AAEL013007-PA [Aedes aegypti] gi|108875295|gb|EAT39520.1| AAEL008697-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|193620134|ref|XP_001950954.1| PREDICTED: cytochrome c oxidase subunit 5B, mitochondrial-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307168272|gb|EFN61486.1| Cytochrome c oxidase subunit 5B, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|269146716|gb|ACZ28304.1| cytochrome c oxidase subunit Vb/COX4 [Simulium nigrimanum] Back     alignment and taxonomy information
>gi|240848562|ref|NP_001155834.1| cytochrome c oxidase subunit 5B, mitochondrial [Acyrthosiphon pisum] gi|239788733|dbj|BAH71033.1| ACYPI010196 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195118826|ref|XP_002003937.1| GI20346 [Drosophila mojavensis] gi|193914512|gb|EDW13379.1| GI20346 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
FB|FBgn0031830154 CoVb "Cytochrome c oxidase sub 0.308 0.402 0.532 1.6e-17
FB|FBgn0031831154 CG11043 [Drosophila melanogast 0.308 0.402 0.492 9.1e-13
RGD|620608129 Cox5b "cytochrome c oxidase su 0.308 0.480 0.476 1.5e-12
UNIPROTKB|P00428129 COX5B "Cytochrome c oxidase su 0.308 0.480 0.476 3.1e-12
UNIPROTKB|Q5S3G4129 COX5B "Cytochrome c oxidase su 0.308 0.480 0.476 5e-12
UNIPROTKB|P10606129 COX5B "Cytochrome c oxidase su 0.308 0.480 0.492 6.4e-12
UNIPROTKB|B7ZDP5128 cox5b "Cytochrome c oxidase po 0.308 0.484 0.444 2.2e-11
UNIPROTKB|E2RHV9129 COX5B "Uncharacterized protein 0.308 0.480 0.444 2.2e-11
WB|WBGene00000371132 cco-1 [Caenorhabditis elegans 0.268 0.409 0.425 4.5e-11
UNIPROTKB|P90849132 cco-1 "Protein CCO-1" [Caenorh 0.268 0.409 0.425 4.5e-11
FB|FBgn0031830 CoVb "Cytochrome c oxidase subunit Vb" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 33/62 (53%), Positives = 48/62 (77%)

Query:     1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCACGHWF 60
             +P+    FKR +GT+++PNL+ SAF +R+VGC+CEEDQ ++ WMW++    +RC CGHWF
Sbjct:    87 NPFDMKVFKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRCECGHWF 146

Query:    61 KL 62
             KL
Sbjct:   147 KL 148




GO:0005739 "mitochondrion" evidence=ISS
GO:0004129 "cytochrome-c oxidase activity" evidence=ISS
GO:0005751 "mitochondrial respiratory chain complex IV" evidence=ISS
GO:0006123 "mitochondrial electron transport, cytochrome c to oxygen" evidence=ISS
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0031831 CG11043 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|620608 Cox5b "cytochrome c oxidase subunit Vb" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P00428 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5S3G4 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P10606 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZDP5 cox5b "Cytochrome c oxidase polypeptide Vb" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHV9 COX5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00000371 cco-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P90849 cco-1 "Protein CCO-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
cd0092497 cd00924, Cyt_c_Oxidase_Vb, Cytochrome c oxidase su 5e-28
pfam01215136 pfam01215, COX5B, Cytochrome c oxidase subunit Vb 2e-15
PLN02294174 PLN02294, PLN02294, cytochrome c oxidase subunit V 2e-08
>gnl|CDD|238464 cd00924, Cyt_c_Oxidase_Vb, Cytochrome c oxidase subunit Vb Back     alignment and domain information
 Score =  100 bits (252), Expect = 5e-28
 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 1  DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHW 59
          D +   P K   GT++DPNLV SAF  R+VGC+CE D + ++WMW+E   P+RC  CGH 
Sbjct: 29 DDFDMKPLKGPFGTKEDPNLVPSAFDKRIVGCICEPDSHDVIWMWLEKGKPKRCPECGHV 88

Query: 60 FKLK 63
          FKL 
Sbjct: 89 FKLV 92


Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region. Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A. The abnormally extended conformation is stable only in the CcO assembly. Length = 97

>gnl|CDD|201667 pfam01215, COX5B, Cytochrome c oxidase subunit Vb Back     alignment and domain information
>gnl|CDD|177931 PLN02294, PLN02294, cytochrome c oxidase subunit Vb Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
PF01215136 COX5B: Cytochrome c oxidase subunit Vb This family 100.0
PLN02294174 cytochrome c oxidase subunit Vb 99.98
cd0092497 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. 99.97
KOG3352|consensus153 99.97
PTZ00043268 cytochrome c oxidase subunit; Provisional 99.93
PF1027640 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z 95.96
KOG3456|consensus120 94.45
COG439162 Uncharacterized protein conserved in bacteria [Fun 80.89
>PF01215 COX5B: Cytochrome c oxidase subunit Vb This family consists of chains F and S ; InterPro: IPR002124 Cytochrome c oxidase (1 Back     alignment and domain information
Probab=100.00  E-value=1.2e-33  Score=227.05  Aligned_cols=74  Identities=41%  Similarity=0.862  Sum_probs=50.6

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeC-CCCCcceEEEEEecCCceee-cCCcEEEEEEecCCCCcccc
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVC-EEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRGGVHVAI   74 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtG-peDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~g~~~~~   74 (201)
                      |||||+|+++++||+||||||||++++|||||+| ++|+|+|+||||++|+|+|| +||+||||+++|+++++|.|
T Consensus        61 D~Fd~~~~~~~~GT~e~P~lVpS~~~~RiVGC~g~~~~sH~v~W~~l~~g~~~RCpeCG~~fkL~~vg~~~~~h~h  136 (136)
T PF01215_consen   61 DPFDMKPLKAPFGTKEDPILVPSYFDERIVGCTGEPDDSHDVIWFWLHKGKPQRCPECGQVFKLKYVGPEGDHHHH  136 (136)
T ss_dssp             -TT--S--B----SSSS-CEEEESSSCEEEEESSSTT-SSS-EEEEEETTSEEEETTTEEEEEEEE----------
T ss_pred             CcccccCccCCCCCccCCeEccCCCCceEEeeccCCCCcceeEEEEEeCCCccCCCCCCeEEEEEEcCCCCCCCCC
Confidence            8999999988899999999999999999999999 66888999999999999999 89999999999999988864



9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....

>PLN02294 cytochrome c oxidase subunit Vb Back     alignment and domain information
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb Back     alignment and domain information
>KOG3352|consensus Back     alignment and domain information
>PTZ00043 cytochrome c oxidase subunit; Provisional Back     alignment and domain information
>PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3456|consensus Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2y69_F129 Bovine Heart Cytochrome C Oxidase Re-Refined With M 5e-12
1occ_F98 Structure Of Bovine Heart Cytochrome C Oxidase At T 1e-11
>pdb|2Y69|F Chain F, Bovine Heart Cytochrome C Oxidase Re-Refined With Molecular Oxygen Length = 129 Back     alignment and structure

Iteration: 1

Score = 67.4 bits (163), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHW 59 DPY K TSGT++DPNLV S R+VGC+CEED ++W W+ +RC +CG Sbjct: 60 DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTH 119 Query: 60 FKL 62 +KL Sbjct: 120 YKL 122
>pdb|1OCC|F Chain F, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2y69_F129 Cytochrome C oxidase subunit 5B; electron transpor 1e-24
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoredu 1e-24
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-prot 1e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Length = 129 Back     alignment and structure
 Score = 92.8 bits (230), Expect = 1e-24
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 1   DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCA-CGHW 59
           DPY     K TSGT++DPNLV S    R+VGC+CEED   ++W W+     +RC  CG  
Sbjct: 60  DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTH 119

Query: 60  FKLK 63
           +KL 
Sbjct: 120 YKLV 123


>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Length = 98 Back     alignment and structure
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-prot 100.0
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoredu 99.98
2y69_F129 Cytochrome C oxidase subunit 5B; electron transpor 99.97
2jrr_A67 Uncharacterized protein; solution structure, SIR90 98.0
2jvm_A80 Uncharacterized protein; alpha+beta, structural ge 97.56
2jz8_A87 Uncharacterized protein BH09830; zinc binding, str 93.06
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 80.72
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.7e-36  Score=223.65  Aligned_cols=74  Identities=26%  Similarity=0.458  Sum_probs=51.2

Q ss_pred             CCCCCCCCC-CCCCCCCCCeeeecCCCceeEeeeC-CCCCcceEEEEEecCCceee-cCCcEEEEEEecCCCCcccc
Q psy7214           1 DPYYNGPFK-RTSGTRDDPNLVRSAFKSRLVGCVC-EEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRGGVHVAI   74 (201)
Q Consensus         1 DPFDMkPLk-s~~GTKEDPiLVPS~~deRIVGCtG-peDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~g~~~~~   74 (201)
                      |||||+|++ +++||+||||||||++++|||||+| |+|+|+|+||||++|+|+|| +||+||||+++|+++++|.|
T Consensus         4 D~fd~~p~~~~~~GT~e~P~lVpS~~~~RiVGC~g~p~d~h~v~W~~l~~g~~~RC~eCG~~fkL~~vg~~~~~hhh   80 (80)
T 2odx_A            4 DVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH   80 (80)
T ss_dssp             ---------------CCSCSEECCSSSSCCEEESSSTTCCSCCEEECCCTTCEEECSSSCCEEEECCCC--------
T ss_pred             CcccccccccCCCCCccCCeEecCCCCCeEEeeeCCCCCcceEEEEEecCCCCeECCCCCeEEEEEEcCCCCCCCCC
Confidence            899999995 6899999999999999999999999 59999999999999999999 99999999999999998764



>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Back     alignment and structure
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1v54f_98 g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow 9e-27
>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Cytochrome c oxidase Subunit F
domain: Cytochrome c oxidase Subunit F
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 96.0 bits (239), Expect = 9e-27
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 1  DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRCA-CGHW 59
          DPY     K TSGT++DPNLV S    R+VGC+CEED   ++W W+     +RC  CG  
Sbjct: 29 DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTH 88

Query: 60 FKLK 63
          +KL 
Sbjct: 89 YKLV 92


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1v54f_98 Cytochrome c oxidase Subunit F {Cow (Bos taurus) [ 99.98
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 84.5
>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Cytochrome c oxidase Subunit F
domain: Cytochrome c oxidase Subunit F
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.98  E-value=2.4e-33  Score=212.23  Aligned_cols=65  Identities=46%  Similarity=0.947  Sum_probs=63.0

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeCCCCCcceEEEEEecCCceee-cCCcEEEEEEe
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHWFKLKLI   65 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtGpeDSH~VvWf~L~KGkP~RC-ECGqwFKLv~v   65 (201)
                      |||||+|+++++||+||||||||++++|||||+|++|+|+|+||||++|+|+|| +||+||||++.
T Consensus        29 D~fd~~~~~~~~GTke~P~lVpS~~~~RiVGC~~~~D~h~v~W~~l~~g~p~RC~eCG~~fkL~~~   94 (98)
T d1v54f_          29 DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH   94 (98)
T ss_dssp             CTTCCSCCCCCCCCSSSCEEEECSSSEEEEEECCSTTCSCCEEEEEESSSCEECTTTCCEEEEECC
T ss_pred             ChhhccCCcCCCCCCcCCcEecCCCCceEEeecCCCCCceeEEEEEeCCCCcccCCCCcEEEEeec
Confidence            899999999999999999999999999999999999999999999999999999 89999999843



>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure