Psyllid ID: psy7226

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
VALSSEVGFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQEEEEEKGKEEEEEEEKKKGKKKKEKEEEEKEENLVK
cccccccEEEcccccccEEEEEccccEEEccEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEcccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHccc
ccccccEEEEccccccccccccccccEEEccEEEcccccHHHHHHHHcHHHHHHHcccccEEEEEEccccccHHHHHHHHcHHHHHHHHHHHHHcEEEEEEEEEEcHHHHHHccccccccccccccccccccccccccccEEEEEEccccccccccHHHHEEccHHHHHHHHHccccccEEEEEccccccccccEEEEEEEEEEEEEEEEEcccccEcHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccccccccHHHHHHHc
valssevgfqnreRQQTKIWLFFDHQvfifdnifgpndsnetiFTEVLVPLINHMFNGINATLLAygqtgggktYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLlngnkevtlknwifnipqsdqrvqgppdpqtgpaspgngrsaaSLTVKKLDSLNSAVQLIVTGNENKVTAVTKMnaqssrshTICTIYLGAMAKLHLVDLagseqlfslsdnylLRNEARKINLSLHYLeqeeeeekgkEEEEEEEKKKGKKKKEKEEEEKEENLVK
valssevgfqnrerQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIvtgnenkvtavtkmnaqssrsHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHyleqeeeeekgkeeeeeeekkkgkkkkekeeeekeenlvk
VALSSEVGFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQeeeeekgkeeeeeeekkkgkkkkekeeeekeeNLVK
****************TKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNI************************************LNSAVQLIVTGNENKVTAVTK*******SHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYL**************************************
*************************QVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTL************************ASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQLF*****YLLRNEARKINLSLHYLEQEEEEEKGKE***************************
********FQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSD***********************SLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLE*************************************
****SEVGFQNRE*Q*TKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIF**********GPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQ******NYLLRNEARKINLSLHYLEQEEEEEKGKEEEEEEEKKKGKKKKEKEEEEKEENLVK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VALSSEVGFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMIMKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLGAMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q6ZMV9 814 Kinesin-like protein KIF6 yes N/A 0.763 0.261 0.335 3e-29
P33174 1231 Chromosome-associated kin no N/A 0.612 0.138 0.344 7e-24
Q90640 1225 Chromosome-associated kin no N/A 0.620 0.141 0.322 8e-23
O95239 1232 Chromosome-associated kin no N/A 0.609 0.137 0.339 2e-22
Q0DV28 945 Armadillo repeat-containi yes N/A 0.684 0.202 0.332 2e-22
Q2VIQ3 1234 Chromosome-associated kin no N/A 0.609 0.137 0.334 6e-22
Q5R4H3 702 Kinesin-like protein KIF3 no N/A 0.698 0.277 0.300 9e-22
Q4R628 702 Kinesin-like protein KIF3 N/A N/A 0.698 0.277 0.300 1e-21
Q6NWW5 1356 Kinesin-like protein KIF2 no N/A 0.695 0.143 0.329 1e-21
Q9Y496 699 Kinesin-like protein KIF3 no N/A 0.698 0.278 0.300 1e-21
>sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 131/259 (50%), Gaps = 46/259 (17%)

Query: 8   GFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYG 67
           GF N +R+  K         F F  IF  + + ET+F  +  P+   +  G N T+ AYG
Sbjct: 47  GFVNNKRESYK---------FKFQRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYG 97

Query: 68  QTGGGKTYTVS---------AMIMKTLQHVMQRCNKDD-----VYMSYLQLYSEKCYDLL 113
           QTG GKT+T++          +I +TL ++ ++  KD       ++SYL++Y+E  YDLL
Sbjct: 98  QTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLL 157

Query: 114 NGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIV 173
           +   E +    + ++P+            T    P       +LT+ +  +   A+ L+ 
Sbjct: 158 DPRHEAS---SLEDLPKV-----------TILEDPDQNIHLKNLTLHQATTEEEALNLLF 203

Query: 174 TGNENKVTAVTKMNAQSSRSHTICTIYLGA---------MAKLHLVDLAGSEQLFSLSDN 224
            G+ N++ A T MN  S+RSH I TI+L +          AKLHLVDLAGSE++      
Sbjct: 204 LGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVG 263

Query: 225 YLLRNEARKINLSLHYLEQ 243
             L  EA+ INLSLHYLEQ
Sbjct: 264 GHLLTEAKYINLSLHYLEQ 282

Homo sapiens (taxid: 9606)
>sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=2 SV=3 Back     alignment and function description
>sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 Back     alignment and function description
>sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 Back     alignment and function description
>sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 Back     alignment and function description
>sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 Back     alignment and function description
>sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 Back     alignment and function description
>sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 Back     alignment and function description
>sp|Q6NWW5|KIF24_MOUSE Kinesin-like protein KIF24 OS=Mus musculus GN=Kif24 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
431838400 539 Kinesin-like protein KIF6 [Pteropus alec 0.763 0.395 0.339 9e-28
297290775 762 PREDICTED: kinesin family member 6 [Maca 0.763 0.279 0.339 1e-27
332823976 797 PREDICTED: kinesin family member 6 isofo 0.763 0.267 0.339 1e-27
355561667 818 hypothetical protein EGK_14869, partial 0.763 0.260 0.339 1e-27
402866920 656 PREDICTED: kinesin-like protein KIF6-lik 0.763 0.324 0.339 1e-27
355748531 818 hypothetical protein EGM_13569, partial 0.763 0.260 0.339 1e-27
332823974 814 PREDICTED: kinesin family member 6 isofo 0.763 0.261 0.339 1e-27
109071037 818 PREDICTED: kinesin family member 6 isofo 0.763 0.260 0.339 1e-27
109071041 846 PREDICTED: kinesin family member 6 isofo 0.763 0.251 0.339 1e-27
380810568 818 kinesin-like protein KIF6 [Macaca mulatt 0.763 0.260 0.339 1e-27
>gi|431838400|gb|ELK00332.1| Kinesin-like protein KIF6 [Pteropus alecto] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 132/259 (50%), Gaps = 46/259 (17%)

Query: 8   GFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYG 67
           GF N +R+  K         F F  IF  + + ETIF  +  P+   +  G N T+ AYG
Sbjct: 47  GFVNNKRESYK---------FKFQRIFDQDANQETIFENIAKPVAESVLAGYNGTIFAYG 97

Query: 68  QTGGGKTYTVS---------AMIMKTLQHVMQRCNKDD-----VYMSYLQLYSEKCYDLL 113
           QTG GKT+T++          +I +TL ++ ++  KD       ++SYL++Y+E  YDLL
Sbjct: 98  QTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQSQKDSSKIYTTHISYLEIYNECGYDLL 157

Query: 114 NGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIV 173
           +   E +    + ++P+            T    P       +L++ +  +   A+ L+ 
Sbjct: 158 DPRHEAS---SLEDLPKV-----------TILEDPDQNIHLKNLSLHQATTEEEALNLLF 203

Query: 174 TGNENKVTAVTKMNAQSSRSHTICTIYLGA---------MAKLHLVDLAGSEQLFSLSDN 224
            G+ N++ A T MN  S+RSH I TI+L +          AKLHLVDLAGSE++      
Sbjct: 204 LGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVG 263

Query: 225 YLLRNEARKINLSLHYLEQ 243
            LL  EA+ INLSLHYLEQ
Sbjct: 264 GLLLTEAKYINLSLHYLEQ 282

Source: Pteropus alecto

Species: Pteropus alecto

Genus: Pteropus

Family: Pteropodidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|297290775|ref|XP_002803772.1| PREDICTED: kinesin family member 6 [Macaca mulatta] Back     alignment and taxonomy information
>gi|332823976|ref|XP_518451.3| PREDICTED: kinesin family member 6 isoform 2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|355561667|gb|EHH18299.1| hypothetical protein EGK_14869, partial [Macaca mulatta] Back     alignment and taxonomy information
>gi|402866920|ref|XP_003897619.1| PREDICTED: kinesin-like protein KIF6-like [Papio anubis] Back     alignment and taxonomy information
>gi|355748531|gb|EHH53014.1| hypothetical protein EGM_13569, partial [Macaca fascicularis] Back     alignment and taxonomy information
>gi|332823974|ref|XP_003311326.1| PREDICTED: kinesin family member 6 isoform 1 [Pan troglodytes] Back     alignment and taxonomy information
>gi|109071037|ref|XP_001117160.1| PREDICTED: kinesin family member 6 isoform 3 [Macaca mulatta] Back     alignment and taxonomy information
>gi|109071041|ref|XP_001117155.1| PREDICTED: kinesin family member 6 isoform 2 [Macaca mulatta] Back     alignment and taxonomy information
>gi|380810568|gb|AFE77159.1| kinesin-like protein KIF6 [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
UNIPROTKB|F6VGH2 758 KIF6 "Kinesin-like protein KIF 0.763 0.281 0.339 3.4e-25
UNIPROTKB|E7EUN7 797 KIF6 "Kinesin-like protein KIF 0.763 0.267 0.339 3.8e-25
UNIPROTKB|Q6ZMV9 814 KIF6 "Kinesin-like protein KIF 0.763 0.261 0.339 3.9e-25
UNIPROTKB|E2RDT0 726 KIF6 "Uncharacterized protein" 0.763 0.293 0.339 5.1e-25
UNIPROTKB|F1PDV6 746 KIF6 "Uncharacterized protein" 0.763 0.285 0.339 5.4e-25
RGD|621070 452 Kif6 "kinesin family member 6" 0.763 0.471 0.335 7e-25
UNIPROTKB|E9PSL8 548 Kif6 "Protein Kif6" [Rattus no 0.763 0.388 0.335 1.7e-24
UNIPROTKB|E1C6E9 486 Gga.21593 "Uncharacterized pro 0.763 0.438 0.324 8.4e-24
ZFIN|ZDB-GENE-061027-130 693 kif6 "kinesin family member 6" 0.763 0.307 0.335 3.1e-23
UNIPROTKB|F1RVQ6 403 KIF6 "Uncharacterized protein" 0.616 0.426 0.358 2.7e-21
UNIPROTKB|F6VGH2 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 296 (109.3 bits), Expect = 3.4e-25, P = 3.4e-25
 Identities = 88/259 (33%), Positives = 133/259 (51%)

Query:     8 GFQNRERQQTKIWLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYG 67
             GF N +R+  K         F F  IF  + + ET+F  +  P+   +  G N T+ AYG
Sbjct:    47 GFVNNKRESYK---------FKFQRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYG 97

Query:    68 QTGGGKTYTVSA---------MIMKTLQHVMQRCNKDD--VY---MSYLQLYSEKCYDLL 113
             QTG GKT+T++          +I +TL ++ ++  KD   +Y   +SYL++Y+E  YDLL
Sbjct:    98 QTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLL 157

Query:   114 NGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIV 173
             +   E +    + ++P+    +   PD               +LT+ +  +   A+ L+ 
Sbjct:   158 DPRHEASS---LEDLPKVT--ILEDPDQNI---------HLKNLTLHQATTEEEALNLLF 203

Query:   174 TGNENKVTAVTKMNAQSSRSHTICTIYLGAM---------AKLHLVDLAGSEQLFSLSDN 224
              G+ N++ A T MN  S+RSH I TI+L +          AKLHLVDLAGSE++      
Sbjct:   204 LGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVG 263

Query:   225 YLLRNEARKINLSLHYLEQ 243
               L  EA+ INLSLHYLEQ
Sbjct:   264 GHLLTEAKYINLSLHYLEQ 282
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
UNIPROTKB|E7EUN7 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZMV9 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDT0 KIF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDV6 KIF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621070 Kif6 "kinesin family member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSL8 Kif6 "Protein Kif6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6E9 Gga.21593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061027-130 kif6 "kinesin family member 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVQ6 KIF6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 7e-49
cd00106328 cd00106, KISc, Kinesin motor domain 7e-49
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 3e-45
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 1e-41
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 2e-39
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 6e-35
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 2e-34
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 3e-34
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 5e-33
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 9e-33
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 1e-32
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 2e-31
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-31
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 3e-28
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 3e-26
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-24
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 5e-24
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 1e-15
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 4e-08
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 9e-07
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 0.003
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.004
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information 
 Score =  164 bits (417), Expect = 7e-49
 Identities = 78/242 (32%), Positives = 116/242 (47%), Gaps = 48/242 (19%)

Query: 24  DHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVS----- 78
             + F FD +F P  + E ++ E   PL+  +  G N T+ AYGQTG GKTYT+      
Sbjct: 38  REKTFTFDRVFDPEATQEFVYEETAKPLVESVLEGYNVTIFAYGQTGSGKTYTMEGDPPE 97

Query: 79  ---AMIMKTLQHVMQRCNKD-------DVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNI 128
               +I + L+ + +R  +         V +SYL++Y+EK YDLL+ +            
Sbjct: 98  EEPGIIPRALEDLFERIEERKERKWSFSVRVSYLEIYNEKIYDLLSPSS----------- 146

Query: 129 PQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNA 188
            +   R++   DP+ G    G       LT  ++ S    ++L+  GN+N+  A T MN 
Sbjct: 147 KKKKLRIR--EDPKKGVYVKG-------LTEVEVTSAEEVLELLELGNKNRTVASTNMNE 197

Query: 189 QSSRSHTICTIYL----------GAMAKLHLVDLAGSEQLFS--LSDNYLLRNEARKINL 236
           +SSRSH I TI +              KL+LVDLAGSE+      +    L+ EA  IN 
Sbjct: 198 ESSRSHAIFTITVEQRNRDTDGSVKTGKLNLVDLAGSERASKTGAAGGRRLK-EAANINK 256

Query: 237 SL 238
           SL
Sbjct: 257 SL 258

Length = 326
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG4280|consensus 574 100.0
KOG0245|consensus 1221 100.0
KOG0243|consensus 1041 100.0
KOG0240|consensus 607 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
KOG0242|consensus 675 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
KOG0239|consensus670 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
KOG0247|consensus 809 100.0
KOG0246|consensus 676 100.0
KOG0241|consensus 1714 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
KOG0244|consensus 913 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 98.05
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 95.75
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.58
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.62
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.39
PRK06893229 DNA replication initiation factor; Validated 94.33
PRK12377248 putative replication protein; Provisional 93.13
PF04851184 ResIII: Type III restriction enzyme, res subunit; 92.47
PRK14086617 dnaA chromosomal replication initiation protein; P 92.45
PRK06526254 transposase; Provisional 92.26
PRK08116268 hypothetical protein; Validated 91.93
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 91.88
PRK06620214 hypothetical protein; Validated 91.83
PRK08084235 DNA replication initiation factor; Provisional 91.51
PRK07952244 DNA replication protein DnaC; Validated 91.16
PRK14088440 dnaA chromosomal replication initiation protein; P 91.13
PRK05642234 DNA replication initiation factor; Validated 91.03
PRK08727233 hypothetical protein; Validated 90.38
PRK00149450 dnaA chromosomal replication initiation protein; R 90.21
TIGR00362405 DnaA chromosomal replication initiator protein Dna 89.94
PRK06835329 DNA replication protein DnaC; Validated 89.85
PRK00411 394 cdc6 cell division control protein 6; Reviewed 89.76
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 89.71
PRK09087226 hypothetical protein; Validated 89.58
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 88.9
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 88.76
PRK10436462 hypothetical protein; Provisional 88.74
PRK08181269 transposase; Validated 88.65
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 88.25
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 88.17
TIGR02533486 type_II_gspE general secretory pathway protein E. 88.1
PRK08903227 DnaA regulatory inactivator Hda; Validated 87.75
PRK08939306 primosomal protein DnaI; Reviewed 87.69
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 87.61
PF1324576 AAA_19: Part of AAA domain 87.46
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 87.42
COG1484254 DnaC DNA replication protein [DNA replication, rec 86.79
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 86.38
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 86.09
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 86.08
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 85.85
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 85.72
smart00382148 AAA ATPases associated with a variety of cellular 85.36
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 85.36
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 85.23
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 85.18
PRK14087450 dnaA chromosomal replication initiation protein; P 85.04
PRK13833323 conjugal transfer protein TrbB; Provisional 84.95
PF12846304 AAA_10: AAA-like domain 84.69
KOG0729|consensus435 84.11
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 83.84
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 83.55
PRK12422445 chromosomal replication initiation protein; Provis 83.53
PRK13894319 conjugal transfer ATPase TrbB; Provisional 83.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 83.36
COG0593408 DnaA ATPase involved in DNA replication initiation 83.13
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 82.96
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 82.94
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 82.57
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 82.47
KOG2543|consensus 438 82.38
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 82.31
PRK13851344 type IV secretion system protein VirB11; Provision 82.23
PRK06921266 hypothetical protein; Provisional 81.91
PF1104449 TMEMspv1-c74-12: Plectrovirus spv1-c74 ORF 12 tran 81.37
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 81.34
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 80.76
PRK09183259 transposase/IS protein; Provisional 80.16
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.5e-62  Score=463.26  Aligned_cols=215  Identities=33%  Similarity=0.489  Sum_probs=201.8

Q ss_pred             ceeEeeecccCCCCCCcceehhhhHHhHHhhhcchhhhhhhhcccCCCceEeeh-------HHHHHHHHHHHHHcCc---
Q psy7226          25 HQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVS-------AMIMKTLQHVMQRCNK---   94 (279)
Q Consensus        25 ~~~f~FD~Vf~~~a~Q~~vf~~~~~plv~~~l~G~n~~i~aYG~tgSGKTyTm~-------Gii~r~l~~lf~~~~~---   94 (279)
                      .+.|+||.||+++++|++||+.++.|+|+++++|||+||||||||||||||||.       |||||++.+||.++..   
T Consensus        51 ~~~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~~~~~GiiPraf~~LF~~I~~~~~  130 (574)
T KOG4280|consen   51 PKSFTFDAVFDSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPDPELRGLIPRAFEHLFRHIDERKE  130 (574)
T ss_pred             CCCceeeeeecCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCChhhCCchhHHHHHHHHHHHhccc
Confidence            557999999999999999999999999999999999999999999999999998       8999999999998876   


Q ss_pred             ---cchhhhHHHHhhhhhhhhcCCCeeeEEeceeeeccCCCccccCCCCCCCCCCCCCCCcccccchhhhccccccceeE
Q psy7226          95 ---DDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQL  171 (279)
Q Consensus        95 ---~~v~vS~~EIy~E~v~DLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~~~v~s~~e~~~l  171 (279)
                         |.|++||+|||||.|+|||++.                     ....+.+++++..|++|.|++++.|.++++++.+
T Consensus       131 ~~~f~vrvS~lEiYnE~i~DLL~~~---------------------~~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~  189 (574)
T KOG4280|consen  131 KTRFLVRVSYLEIYNESIRDLLSPV---------------------NPKGLELREDPKCGVYVENLSEMDVESAEDAQQL  189 (574)
T ss_pred             cceEEEEeehHHHHhHHHHHHhCcc---------------------CcCCceeeEcCCCceEecCcceeecCCHHHHHHH
Confidence               7799999999999999999954                     2267899999999999999999999999999999


Q ss_pred             EEecccceeeEEEeecccccCceeeeeeehh------------hhhhhhhccccCccceecccchhhhhhhhcccccccc
Q psy7226         172 IVTGNENKVTAVTKMNAQSSRSHTICTIYLG------------AMAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLH  239 (279)
Q Consensus       172 l~~g~~~R~~~~t~~n~~SSRSH~i~~i~v~------------~~s~l~~VDLAGsEr~~~~~~~g~r~~E~~~IN~SL~  239 (279)
                      |..|..+|.+++|.||..|||||+||+|+|.            +.|||+|||||||||..+++++|.|++|+.+||+||+
T Consensus       190 l~~G~~nR~vgat~mn~~SsRSH~ift~~i~~~~~~~~~~~~~~~~rlnlvDLagsEr~~~tga~G~rlkEa~~IN~SLs  269 (574)
T KOG4280|consen  190 LVVGLANRRVGATSMNEESSRSHAIFTIHIESSEKSDGGLMSGRSSKLNLVDLAGSERQSKTGAEGERLKEATNINLSLS  269 (574)
T ss_pred             HHHHHhhcchhhccCCcccccceEEEEEEEEeecccCCCccccccceeeeeeccchhhhcccCccchhhhhhcccchhHH
Confidence            9999999999999999999999999999997            5799999999999999999999999999999999999


Q ss_pred             hhhhhHHHhcCchhHHHHHHh
Q psy7226         240 YLEQEEEEEKGKEEEEEEEKK  260 (279)
Q Consensus       240 aL~~vi~aL~~~~~~~~~~~~  260 (279)
                      +||+||.||+++.+.=...+.
T Consensus       270 ~LG~vI~aLvd~~~~HIPYRd  290 (574)
T KOG4280|consen  270 ALGNVISALVDGSKTHIPYRD  290 (574)
T ss_pred             HHHHHHHHHhccccCCCCcch
Confidence            999999999999874333333

>KOG0245|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF11044 TMEMspv1-c74-12: Plectrovirus spv1-c74 ORF 12 transmembrane protein; InterPro: IPR022743 This is a group of proteins expressed by Plectroviruses Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 4e-20
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 8e-20
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 2e-19
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 3e-19
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 4e-19
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 5e-19
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 5e-19
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 5e-19
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 5e-19
4a1z_A368 Eg5-1 Length = 368 5e-19
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 5e-19
4a28_A368 Eg5-2 Length = 368 7e-19
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-18
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-18
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-18
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 2e-18
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 4e-18
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 9e-18
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 2e-17
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-17
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 2e-17
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 2e-17
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 5e-17
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 5e-17
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 8e-17
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 2e-16
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 5e-16
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 6e-16
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 1e-15
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 2e-15
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 2e-15
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 2e-15
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 5e-15
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 6e-15
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 6e-15
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 8e-15
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 9e-15
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 9e-15
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 9e-15
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 9e-15
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 1e-14
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 1e-14
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 1e-14
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 1e-14
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 2e-14
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 2e-14
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 2e-14
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-14
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 4e-14
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 4e-14
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 5e-14
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 7e-14
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 8e-13
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 2e-12
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 4e-12
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 6e-12
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 112/245 (45%), Gaps = 53/245 (21%)
Query: 28  FIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVS--------- 78
           F FD  FGP      +++ V+ PLI  + NG N T+ AYGQTG GKT+T+          
Sbjct: 69  FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKS 128
Query: 79  --------AMIMKTLQHVMQRCNKDDV----YMSYLQLYSEKCYDLLNGNKEVTLKNWIF 126
                    +I + L H+       +V     +SYL+LY+E+  DLL+ +   T K  IF
Sbjct: 129 SWEDDSDIGIIPRALSHLFDELRMMEVEYTMRISYLELYNEELCDLLSTDD--TTKIRIF 186
Query: 127 NIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKM 186
           +    D   +G    Q     P             + S +   +L+  G E + TA T M
Sbjct: 187 D----DSTKKGSVIIQGLEEIP-------------VHSKDDVYKLLEKGKERRKTATTLM 229
Query: 187 NAQSSRSHTICTIYLG------------AMAKLHLVDLAGSEQLFSLSDNYLLR-NEARK 233
           NAQSSRSHT+ +I +              + KL+LVDLAGSE +    +   +R  E   
Sbjct: 230 NAQSSRSHTVFSIVVHIRENGIEGEDMLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVN 289
Query: 234 INLSL 238
           IN SL
Sbjct: 290 INQSL 294
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.85
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 96.07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.73
2qgz_A308 Helicase loader, putative primosome component; str 92.07
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 90.57
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.61
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 88.98
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.11
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 87.51
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.29
2r62_A268 Cell division protease FTSH homolog; ATPase domain 86.63
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 86.36
3bos_A242 Putative DNA replication factor; P-loop containing 86.35
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 86.19
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 85.2
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 85.13
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 85.09
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 84.63
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.16
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 82.09
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 81.81
2chg_A226 Replication factor C small subunit; DNA-binding pr 81.62
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 81.55
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 81.34
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 80.73
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 80.71
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 80.68
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 80.6
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 80.38
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-63  Score=453.76  Aligned_cols=211  Identities=28%  Similarity=0.387  Sum_probs=197.9

Q ss_pred             EEEeeceeEeeecccCCCCCCcceehhhhHHhHHhhhcchhhhhhhhcccCCCceEeeh---------HHHHHHHHHHHH
Q psy7226          20 WLFFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVS---------AMIMKTLQHVMQ   90 (279)
Q Consensus        20 ~~~~~~~~f~FD~Vf~~~a~Q~~vf~~~~~plv~~~l~G~n~~i~aYG~tgSGKTyTm~---------Gii~r~l~~lf~   90 (279)
                      ++..+.+.|.||+||+++++|++||+.++.|+|+++++|||+||||||||||||||||.         |||||++++||.
T Consensus        38 ~~~~~~~~f~FD~Vf~~~~sQ~~Vy~~~~~plv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~  117 (325)
T 1bg2_A           38 TVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFN  117 (325)
T ss_dssp             EEEETTEEEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHH
T ss_pred             eEEECCEEEECCeEeCCCCCHHHHHHHHhhhhHHHHhCCCeEEEEEECCCCCCCceEecccCCCcccCccHHHHHHHHHH
Confidence            34557889999999999999999999999999999999999999999999999999997         799999999998


Q ss_pred             HcCc------cchhhhHHHHhhhhhhhhcCCCeeeEEeceeeeccCCCccccCCCCCCCCCCCCCCCcccccchhhhccc
Q psy7226          91 RCNK------DDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLDS  164 (279)
Q Consensus        91 ~~~~------~~v~vS~~EIy~E~v~DLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~~~v~s  164 (279)
                      .+..      +.|++||+|||||+++|||++.                      ...+.+++++.+++++.|++++.|.+
T Consensus       118 ~i~~~~~~~~~~v~vS~~EIYnE~v~DLL~~~----------------------~~~l~i~e~~~~~~~v~gl~~~~v~s  175 (325)
T 1bg2_A          118 YIYSMDENLEFHIKVSYFEIYLDKIRDLLDVS----------------------KTNLSVHEDKNRVPYVKGCTERFVCS  175 (325)
T ss_dssp             HHHHHCSSEEEEEEEEEEEEETTEEEESSCTT----------------------CCSBCEEECTTSCEEETTCCCEEECS
T ss_pred             HHHhccCCceEEEEEEEEEEecCeeeecccCC----------------------CCCceEEECCCCCEEecCceEEeCCC
Confidence            7743      8899999999999999999843                      15678889999999999999999999


Q ss_pred             cccceeEEEecccceeeEEEeecccccCceeeeeeehh---------hhhhhhhccccCccceecccchhhhhhhhcccc
Q psy7226         165 LNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLG---------AMAKLHLVDLAGSEQLFSLSDNYLLRNEARKIN  235 (279)
Q Consensus       165 ~~e~~~ll~~g~~~R~~~~t~~n~~SSRSH~i~~i~v~---------~~s~l~~VDLAGsEr~~~~~~~g~r~~E~~~IN  235 (279)
                      ++|++++|..|.++|.+++|.+|..|||||+||+|++.         ..|+|+|||||||||..++++.|.|++|+..||
T Consensus       176 ~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~skl~lVDLAGSEr~~~t~~~g~rl~E~~~IN  255 (325)
T 1bg2_A          176 PDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNIN  255 (325)
T ss_dssp             HHHHHHHHHHHHHHTTTTCSCHHHHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCSCCCCCCSSSCTTSCCCCCCC
T ss_pred             HHHHHHHHHHHHhhCceeecCCCCCCCCCeEEEEEEEEEEecCCCcEEEEEEEEEECCCCCcccccCCccccchHHHHHH
Confidence            99999999999999999999999999999999999996         358999999999999999999999999999999


Q ss_pred             cccchhhhhHHHhcCch
Q psy7226         236 LSLHYLEQEEEEEKGKE  252 (279)
Q Consensus       236 ~SL~aL~~vi~aL~~~~  252 (279)
                      +||++|++||.||++++
T Consensus       256 ~SL~aLg~vI~aL~~~~  272 (325)
T 1bg2_A          256 KSLSALGNVISALAEGS  272 (325)
T ss_dssp             HHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHcCC
Confidence            99999999999999863
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 3e-23
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-21
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 2e-21
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 7e-21
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 8e-20
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 2e-17
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 5e-16
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-15
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-14
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]

 Score = 95.4 bits (236), Expect = 3e-23
 Identities = 57/228 (25%), Positives = 90/228 (39%), Gaps = 11/228 (4%)

Query: 22  FFDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVSAMI 81
           + ++Q F FD  F    SNE ++     PL+  +F G  AT  AYGQTG GKT+T+   +
Sbjct: 76  YLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDL 135

Query: 82  MKTLQHVMQRCNKDDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQR-VQGPPD 140
               Q+  +          +L     +       N  + +    F I       +     
Sbjct: 136 SGKSQNASKGIYAMASRDVFLLKNQPRYR-----NLNLEVYVTFFEIYNGKVFDLLNKKA 190

Query: 141 PQTGPASPGNGRSAASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIY 200
                           L    +   +  +++I  G+  + +  T  N+ SSRSH    I 
Sbjct: 191 KLRVLEDSRQQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQIL 250

Query: 201 LG----AMAKLHLVDLAGSEQL-FSLSDNYLLRNEARKINLSLHYLEQ 243
           L        K  LVDLAG+E+   + S +   R E  +IN SL  L++
Sbjct: 251 LRTKGRLHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKE 298
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.29
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.2
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.91
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.7
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.88
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.62
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.99
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.13
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.1
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.39
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.38
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 83.34
d1okkd2207 GTPase domain of the signal recognition particle r 83.28
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 83.1
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 82.67
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 81.26
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 80.8
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 80.71
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 80.58
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 80.53
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 80.44
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 80.21
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]

Probab=100.00  E-value=7.1e-57  Score=415.75  Aligned_cols=208  Identities=30%  Similarity=0.413  Sum_probs=173.1

Q ss_pred             eeceeEeeecccCCCCCCcceehhhhHHhHHhhhcchhhhhhhhcccCCCceEeeh------------HHHHHHHHHHHH
Q psy7226          23 FDHQVFIFDNIFGPNDSNETIFTEVLVPLINHMFNGINATLLAYGQTGGGKTYTVS------------AMIMKTLQHVMQ   90 (279)
Q Consensus        23 ~~~~~f~FD~Vf~~~a~Q~~vf~~~~~plv~~~l~G~n~~i~aYG~tgSGKTyTm~------------Gii~r~l~~lf~   90 (279)
                      ...+.|.||+||+++++|++||+.++.|+|+++++|||+||||||||||||||||+            ||+||++++||.
T Consensus        77 ~~~~~f~FD~vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tifaYGqTGSGKTyTm~G~~~~~~~~~~~Giipr~~~~lf~  156 (362)
T d1v8ka_          77 LENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFL  156 (362)
T ss_dssp             EEEEEEECSEEECTTCCHHHHHHHTTHHHHHHHHTTCEEEEEEEESTTSSHHHHHHCBC----CBGGGSHHHHHHHHHHH
T ss_pred             cCceeEeCCeecCCCCCHHHHHHHHHHHHHHHHHhccCceEEeeccCCCCCceeeeecCCCCcccccCCeeeehhhhHHH
Confidence            34678999999999999999999999999999999999999999999999999997            699999999998


Q ss_pred             HcCc-------cchhhhHHHHhhhhhhhhcCCCeeeEEeceeeeccCCCccccCCCCCCCCCCCCCCCcccccchhhhcc
Q psy7226          91 RCNK-------DDVYMSYLQLYSEKCYDLLNGNKEVTLKNWIFNIPQSDQRVQGPPDPQTGPASPGNGRSAASLTVKKLD  163 (279)
Q Consensus        91 ~~~~-------~~v~vS~~EIy~E~v~DLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~~~v~  163 (279)
                      .+..       +.|++||+|||||+++|||.+...                       ..+++++.+++++.|++++.|.
T Consensus       157 ~~~~~~~~~~~~~v~vS~~EIyne~i~DLL~~~~~-----------------------~~~~~~~~~~~~v~gl~e~~v~  213 (362)
T d1v8ka_         157 LKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAK-----------------------LRVLEDSRQQVQVVGLQEYLVT  213 (362)
T ss_dssp             HHTSHHHHTTCCEEEEEEEEEETTEEEETTTTTEE-----------------------EEEEECSSCCEEEETCCCEEES
T ss_pred             HhhcccccccchhheeeeeeecCCeEEecccCCcc-----------------------ccccccccCCcccCCCEEEEec
Confidence            7754       789999999999999999986532                       3345777889999999999999


Q ss_pred             ccccceeEEEecccceeeEEEeecccccCceeeeeeehh----hhhhhhhccccCccceecccc-hhhhhhhhccccccc
Q psy7226         164 SLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYLG----AMAKLHLVDLAGSEQLFSLSD-NYLLRNEARKINLSL  238 (279)
Q Consensus       164 s~~e~~~ll~~g~~~R~~~~t~~n~~SSRSH~i~~i~v~----~~s~l~~VDLAGsEr~~~~~~-~g~r~~E~~~IN~SL  238 (279)
                      +++|+..++..|..+|.+++|.+|..|||||+||+|.+.    ..++|+|||||||||..++.. .+.+++|+..||+||
T Consensus       214 s~~e~~~~l~~g~~~R~~~~T~~N~~SSRSH~i~~i~i~~~~~~~~~l~~VDLAGsEr~~~~~~~~~~~~~E~~~IN~SL  293 (362)
T d1v8ka_         214 CADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSL  293 (362)
T ss_dssp             SHHHHHHHHHHHHHTCC--------CCCSSEEEEEEEEESSSSEEEEEEEEECCCCCC------------TTHHHHHHHH
T ss_pred             CHHHHHHHHhccccccccccccCcccCcceeeEEEEEEEecceeeeeEeeeecccccccccccccchhhhhhhhhhcccH
Confidence            999999999999999999999999999999999999997    568999999999999988754 457889999999999


Q ss_pred             chhhhhHHHhcCchh
Q psy7226         239 HYLEQEEEEEKGKEE  253 (279)
Q Consensus       239 ~aL~~vi~aL~~~~~  253 (279)
                      ++|++||.||++++.
T Consensus       294 ~~L~~vi~aL~~~~~  308 (362)
T d1v8ka_         294 LALKECIRALGQNKA  308 (362)
T ss_dssp             HHHHHHHHHHTC---
T ss_pred             HHHHHHHHHHhcCCC
Confidence            999999999997654
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure