Psyllid ID: psy7232

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
YDLLNGNKEVTLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVVK
cccccccccHHHHHHHHcccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEEcccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHEEEEEccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcc
cccccccccEEEEEEEEcHHHHHHccccccccEEEEEccccccEEccccHHEEccHHHHHHHHHccccccEEEEEccccccccccEEEEEEEEEEcEEEEEEccccccccccccccccccccHHHccHHHHHHHHHHHHHHcccccccHHHcHHHHHcHHHcccccEEEEEEEEccEHHHHHHHHHHHHHHHHHHccEccccccccHHHHHHHHHHHHHccc
ydllngnkevtlknwifnlpqsdqraqgspdpqtgpaspgngrsgaslTVKKLDSLNSAVQLIVTGNENKVTAVTKMnaqssrshtICTIYFGAVAKLHLVDlagseqlfslsdnylLRNEARKINLSLHYLEQVMIAldepnrhhipyrnstLTSILkdslggngiTSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQgnfvqeqdsyhyyHHVIVVK
ydllngnkevtLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSAVQLIvtgnenkvTAVTKmnaqssrsHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNfvqeqdsyhYYHHVIVVK
YDLLNGNKEVTLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVVK
*********VTLKNWIFN**************************************NSAVQLIVTGNENKVTAVTK******RSHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVV*
*D*****KEVTLKNWIFNLPQSDQ*****************GRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVT*****SSRSHTICTIYFGAVAKLHLVDLAGSEQL**********NEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVI*V*
YDLLNGNKEVTLKNWIFNLPQS***********************ASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVVK
YDLLNGNKEVTLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAVAKLHLVDLAG*************RNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVVK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YDLLNGNKEVTLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAVAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIVVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q6ZMV9 814 Kinesin-like protein KIF6 yes N/A 0.684 0.186 0.472 9e-34
O43093 935 Kinesin heavy chain OS=Sy N/A N/A 0.675 0.160 0.408 7e-23
P46872 699 Kinesin-II 85 kDa subunit no N/A 0.626 0.198 0.417 2e-22
P46873 699 Osmotic avoidance abnorma yes N/A 0.725 0.230 0.414 2e-22
P21613 967 Kinesin heavy chain OS=Do N/A N/A 0.675 0.155 0.396 3e-22
Q29DY1 797 Kinesin-like protein Klp6 no N/A 0.648 0.180 0.409 5e-22
Q9WV04 790 Kinesin-like protein KIF9 no N/A 0.608 0.170 0.417 7e-22
P46867 784 Kinesin-like protein Klp6 no N/A 0.648 0.183 0.409 7e-22
Q54UC9 1193 Kinesin-related protein 3 yes N/A 0.653 0.121 0.402 7e-22
P34540 815 Kinesin heavy chain OS=Ca no N/A 0.666 0.181 0.394 8e-22
>sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 9/161 (5%)

Query: 48  LTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAV---------AKL 98
           LT+ +  +   A+ L+  G+ N++ A T MN  S+RSH I TI+  +          AKL
Sbjct: 187 LTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKL 246

Query: 99  HLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSIL 158
           HLVDLAGSE++        L  EA+ INLSLHYLEQV+IAL E +R HIPYRNS +TS+L
Sbjct: 247 HLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTSVL 306

Query: 159 KDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSN 199
           +DSLGGN +T+MIA +S+++ N  ++++T +FAQR   + N
Sbjct: 307 RDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKN 347

Homo sapiens (taxid: 9606)
>sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1 Back     alignment and function description
>sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 Back     alignment and function description
>sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 Back     alignment and function description
>sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 Back     alignment and function description
>sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 Back     alignment and function description
>sp|Q9WV04|KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus GN=Kif9 PE=2 SV=2 Back     alignment and function description
>sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 Back     alignment and function description
>sp|Q54UC9|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1 Back     alignment and function description
>sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
328781407 620 PREDICTED: kinesin 9 [Apis mellifera] 0.711 0.254 0.497 1e-35
340718665 579 PREDICTED: kinesin-like protein KIF6-lik 0.711 0.272 0.502 3e-35
350404997 579 PREDICTED: kinesin-like protein KIF6-lik 0.711 0.272 0.502 3e-35
353228668 577 putative krp3 [Schistosoma mansoni] 0.761 0.292 0.444 9e-34
256070883 596 krp3 [Schistosoma mansoni] 0.761 0.283 0.444 9e-34
449495697 1168 PREDICTED: kinesin-like protein KIF6 [Ta 0.689 0.130 0.475 8e-33
363731542 667 PREDICTED: kinesin family member 6 [Gall 0.684 0.227 0.472 2e-32
326915318 683 PREDICTED: kinesin-like protein KIF6-lik 0.684 0.222 0.472 2e-32
383848883 794 PREDICTED: kinesin-like protein KIF6-lik 0.729 0.204 0.473 2e-32
392342273 906 PREDICTED: kinesin family member 6 [Ratt 0.684 0.167 0.465 2e-32
>gi|328781407|ref|XP_394791.3| PREDICTED: kinesin 9 [Apis mellifera] Back     alignment and taxonomy information
 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 115/167 (68%), Gaps = 9/167 (5%)

Query: 48  LTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIY-----FGAV----AKL 98
           LT   + ++  A++L++ G+ N+VTA T MN QSSRSH I TI      FGA     AK+
Sbjct: 60  LTFYCVKNIEDALELLLLGDNNRVTAETPMNPQSSRSHCIFTIVVSTKQFGAEQYKRAKV 119

Query: 99  HLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSIL 158
           HLVDLAGSE+++  S    +  EA+ INLSLHYLEQV++ L + +  HIPYRNS LTSIL
Sbjct: 120 HLVDLAGSERVYKCSITGTILTEAKHINLSLHYLEQVIVCLGQESMGHIPYRNSLLTSIL 179

Query: 159 KDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNF 205
           +DSLGGN IT+M+A +++  +N  +T++T +FAQR   + NYL+ N 
Sbjct: 180 RDSLGGNCITAMLATLNITSFNLEETVSTCRFAQRVALIKNYLKLNL 226

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340718665|ref|XP_003397784.1| PREDICTED: kinesin-like protein KIF6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404997|ref|XP_003487286.1| PREDICTED: kinesin-like protein KIF6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|353228668|emb|CCD74839.1| putative krp3 [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|256070883|ref|XP_002571771.1| krp3 [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|449495697|ref|XP_002197619.2| PREDICTED: kinesin-like protein KIF6 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|363731542|ref|XP_003640993.1| PREDICTED: kinesin family member 6 [Gallus gallus] Back     alignment and taxonomy information
>gi|326915318|ref|XP_003203966.1| PREDICTED: kinesin-like protein KIF6-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|383848883|ref|XP_003700077.1| PREDICTED: kinesin-like protein KIF6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|392342273|ref|XP_001062736.2| PREDICTED: kinesin family member 6 [Rattus norvegicus] gi|392350545|ref|XP_343525.4| PREDICTED: kinesin family member 6 [Rattus norvegicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
UNIPROTKB|E1C6E9 486 Gga.21593 "Uncharacterized pro 0.689 0.314 0.469 4.7e-32
RGD|621070452 Kif6 "kinesin family member 6" 0.689 0.338 0.469 7.7e-32
UNIPROTKB|E9PSL8 548 Kif6 "Protein Kif6" [Rattus no 0.689 0.279 0.469 1.7e-31
UNIPROTKB|F1N880 665 Gga.21593 "Uncharacterized pro 0.689 0.230 0.469 2.7e-31
UNIPROTKB|E2QRG3 653 KIF6 "Kinesin-like protein KIF 0.689 0.234 0.475 4.1e-31
UNIPROTKB|H0Y718 689 KIF6 "Kinesin-like protein KIF 0.689 0.222 0.475 4.9e-31
UNIPROTKB|F1RVQ6 403 KIF6 "Uncharacterized protein" 0.689 0.379 0.469 5.4e-31
UNIPROTKB|F6VGH2 758 KIF6 "Kinesin-like protein KIF 0.689 0.201 0.475 6.5e-31
UNIPROTKB|E7EUN7 797 KIF6 "Kinesin-like protein KIF 0.689 0.191 0.475 7.4e-31
UNIPROTKB|Q6ZMV9 814 KIF6 "Kinesin-like protein KIF 0.689 0.187 0.475 7.8e-31
UNIPROTKB|E1C6E9 Gga.21593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 4.7e-32, P = 4.7e-32
 Identities = 76/162 (46%), Positives = 109/162 (67%)

Query:    47 SLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFGAV---------AK 97
             +L++++  +   A+ L+  G+ N++ A T MN  S+RSH I TI+  +          +K
Sbjct:   185 NLSLQQASNEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHISSKEPGSPTIRHSK 244

Query:    98 LHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSI 157
             LHLVDLAGSE++        L  EA+ INLSLHYLEQV+IAL E NR HIPYRNS +TS+
Sbjct:   245 LHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSV 304

Query:   158 LKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSN 199
             L+DSLGGN +T+MIA +S+D+ N  ++++T +FAQR   + N
Sbjct:   305 LRDSLGGNCMTTMIATLSLDKRNIEESISTCRFAQRVALIKN 346
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
RGD|621070 Kif6 "kinesin family member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSL8 Kif6 "Protein Kif6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N880 Gga.21593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRG3 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y718 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVQ6 KIF6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6VGH2 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUN7 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZMV9 KIF6 "Kinesin-like protein KIF6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 3e-48
cd00106328 cd00106, KISc, Kinesin motor domain 1e-44
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-43
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 1e-42
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 7e-37
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 4e-35
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 1e-34
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 2e-34
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 2e-32
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 4e-32
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 2e-31
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 4e-31
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 2e-30
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 1e-28
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 3e-27
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 9e-25
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 7e-22
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 1e-21
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 3e-16
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information 
 Score =  160 bits (408), Expect = 3e-48
 Identities = 78/206 (37%), Positives = 103/206 (50%), Gaps = 35/206 (16%)

Query: 1   YDLLNGNKEV-TLKNWIFNLPQSDQRAQGSPDPQTGPASPGNGRSGASLTVKKLDSLNSA 59
           YDLL+ + +   L+                 DP+ G    G       LT  ++ S    
Sbjct: 139 YDLLSPSSKKKKLRIR--------------EDPKKGVYVKG-------LTEVEVTSAEEV 177

Query: 60  VQLIVTGNENKVTAVTKMNAQSSRSHTICTIYF----------GAVAKLHLVDLAGSEQL 109
           ++L+  GN+N+  A T MN +SSRSH I TI                KL+LVDLAGSE+ 
Sbjct: 178 LELLELGNKNRTVASTNMNEESSRSHAIFTITVEQRNRDTDGSVKTGKLNLVDLAGSERA 237

Query: 110 FS--LSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGI 167
                +    L+ EA  IN SL  L  V+ AL E    HIPYR+S LT +L+DSLGGN  
Sbjct: 238 SKTGAAGGRRLK-EAANINKSLSALGNVINALAENQSSHIPYRDSKLTRLLQDSLGGNSK 296

Query: 168 TSMIAVVSMDRYNQHQTLATLKFAQR 193
           T MIA +S    N  +TL+TL+FA R
Sbjct: 297 TLMIANISPSDSNYEETLSTLRFASR 322

Length = 326
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG4280|consensus 574 100.0
KOG0245|consensus 1221 100.0
KOG0243|consensus 1041 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
KOG0240|consensus 607 100.0
KOG0242|consensus 675 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
KOG0241|consensus 1714 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0246|consensus 676 100.0
KOG0247|consensus 809 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0239|consensus670 100.0
KOG0244|consensus 913 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 91.34
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-58  Score=420.75  Aligned_cols=212  Identities=37%  Similarity=0.402  Sum_probs=204.8

Q ss_pred             ceeEEeeeeeccccccccCCCCCC---CCCCCCCCCCeeecCceEEEcCCHHHHHHHHHhhhhccchhhcccCCCCCCcc
Q psy7232           9 EVTLKNWIFNLPQSDQRAQGSPDP---QTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSH   85 (222)
Q Consensus         9 ~~~~~~~i~~~~~~~~~~~~~~~~---~~~~~~~~~~~~v~~l~~~~v~s~~~~~~ll~~g~~~R~~~~t~~n~~ssRsH   85 (222)
                      .|.|++|+.|+|++.++||+.+.+   ..++++|..|++|+||+++.|.+++|+..+|..|..+|++++|.+|..|||||
T Consensus       133 ~f~vrvS~lEiYnE~i~DLL~~~~~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~~SsRSH  212 (574)
T KOG4280|consen  133 RFLVRVSYLEIYNESIRDLLSPVNPKGLELREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNEESSRSH  212 (574)
T ss_pred             eEEEEeehHHHHhHHHHHHhCccCcCCceeeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCcccccce
Confidence            599999999999999999999855   56788999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEee------------ecceeeeecCCCccccccCcchhhhHhHHhhhhcHHHHHHHHHHhcCCCCCCcCCCCch
Q psy7232          86 TICTIYFGA------------VAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNST  153 (222)
Q Consensus        86 ~i~~i~v~~------------~s~l~~VDLaGsEr~~~~~~~~~~~~E~~~iN~Sl~~L~~vi~~L~~~~~~~vpyr~Sk  153 (222)
                      +||+|+|++            .|+|+|||||||||..++++.|++++|+.+||+||++||+||.+|.++++.|||||||+
T Consensus       213 ~ift~~i~~~~~~~~~~~~~~~~rlnlvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aLvd~~~~HIPYRdSk  292 (574)
T KOG4280|consen  213 AIFTIHIESSEKSDGGLMSGRSSKLNLVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISALVDGSKTHIPYRDSK  292 (574)
T ss_pred             EEEEEEEEeecccCCCccccccceeeeeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHHhccccCCCCcchhH
Confidence            999999987            68999999999999999999999999999999999999999999999887799999999


Q ss_pred             hHhhhhhccCCCCceEEEEEecCCCCCHHHHHHHHHHHHHhcccccccccccccccchHHHhhhhhc
Q psy7232         154 LTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVIV  220 (222)
Q Consensus       154 LT~lL~d~lgg~~~t~~I~~vsp~~~~~~eTl~TL~fa~~~~~i~~~~~~n~~~~~~~~~~~~~~~~  220 (222)
                      ||+||||+|||||+|+||+||+|+..+++||++||+||+|+|.|+|.|++|+....+.+.+|+.+|.
T Consensus       293 LT~LLqdSLGGN~kT~mianvsp~~~~~~ETlsTLrfA~Rak~I~nk~~ined~~~~~~~~lq~ei~  359 (574)
T KOG4280|consen  293 LTRLLQDSLGGNSKTTMIANVSPSSDNYEETLSTLRFAQRAKAIKNKPVINEDPKDALLRELQEEIE  359 (574)
T ss_pred             HHHHHHHHcCCCceEEEEEecCchhhhhHHHHHHHHHHHHHHHhhccccccCCcchhhHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999998875

>KOG0245|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 1e-22
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 2e-22
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 4e-22
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 7e-22
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 2e-21
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 4e-21
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 3e-20
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 4e-20
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 1e-19
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 2e-19
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 2e-19
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 2e-19
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 2e-19
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 2e-19
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 2e-19
4a1z_A368 Eg5-1 Length = 368 2e-19
4a28_A368 Eg5-2 Length = 368 2e-19
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 2e-19
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 3e-19
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 3e-19
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-19
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-19
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 5e-19
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 6e-19
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 1e-18
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 2e-18
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 3e-18
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 6e-18
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 5e-17
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 6e-16
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 8e-16
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 1e-15
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 3e-15
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 4e-15
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 7e-15
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 4e-14
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 5e-14
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 6e-14
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 1e-13
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 1e-13
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 1e-13
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 1e-13
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 3e-13
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-13
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 6e-13
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 6e-13
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 7e-13
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 7e-13
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 1e-12
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 3e-12
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 3e-12
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 3e-12
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 3e-12
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 4e-12
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 4e-12
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 1e-11
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 1e-11
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 7e-04
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 78/146 (53%), Gaps = 12/146 (8%)
Query: 66  GNENKVTAVTKMNAQSSRSHTICTIYFGA------------VAKLHLVDLAGSEQLFSLS 113
           GN+N+    T MN  SSRSH I  I                V KL+LVDLAGSE+     
Sbjct: 210 GNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTG 269
Query: 114 DNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDSLGGNGITSMIAV 173
                  EA KINLSL  L  V+ AL +    HIPYR+S LT +L+DSLGGN  T M+A 
Sbjct: 270 AQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVAN 329
Query: 174 VSMDRYNQHQTLATLKFAQRTLRVSN 199
           V    YN  +TL TL++A R   + N
Sbjct: 330 VGPASYNVEETLTTLRYANRAKNIKN 355
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 8e-55
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 8e-50
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-49
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 2e-47
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 6e-47
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 6e-47
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 1e-46
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 7e-46
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 7e-46
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-45
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 3e-45
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 3e-45
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 6e-45
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 6e-45
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 1e-44
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 2e-44
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 3e-44
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 4e-44
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 5e-44
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 7e-44
3u06_A412 Protein claret segregational; motor domain, stalk 9e-44
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 1e-43
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 1e-43
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 2e-43
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 9e-43
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-39
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 1e-27
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 3e-25
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.97
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.96
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 96.12
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-58  Score=408.29  Aligned_cols=211  Identities=35%  Similarity=0.426  Sum_probs=178.6

Q ss_pred             CCcceeEEeeeeeccccccccCCCCCC---CCCCCCCCCCeeecCceEEEcCCHHHHHHHHHhhhhccchhhcccCCCCC
Q psy7232           6 GNKEVTLKNWIFNLPQSDQRAQGSPDP---QTGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSS   82 (222)
Q Consensus         6 ~~~~~~~~~~i~~~~~~~~~~~~~~~~---~~~~~~~~~~~~v~~l~~~~v~s~~~~~~ll~~g~~~R~~~~t~~n~~ss   82 (222)
                      ...++.|++|++|+|+|.++|||.+.+   ..+++++.++++|+||+++.|.|++|++++|..|.++|.+++|.+|..||
T Consensus       147 ~~~~~~v~vS~~EIYnE~i~DLL~~~~~~~l~i~e~~~~~v~v~gl~~~~v~s~~e~~~ll~~g~~~R~~~~T~~N~~SS  226 (372)
T 3b6u_A          147 QNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSS  226 (372)
T ss_dssp             SSCEEEEEEEEEEEETTEEEETTSSCTTCCBCEEEETTTEEEETTCCCEECCSHHHHHHHHHHHHHHHTTTCSSHHHHHH
T ss_pred             cCCceEEEEEEEEEeCCEEEECCCCCCCCCceEEECCCCcEecCCCEEEEecCHHHHHHHHHHHHHhcCcccccCCCCCC
Confidence            345799999999999999999998754   45677899999999999999999999999999999999999999999999


Q ss_pred             CcccceeEEEee------------ecceeeeecCCCccccccCcchhhhHhHHhhhhcHHHHHHHHHHhcCCCCCCcCCC
Q psy7232          83 RSHTICTIYFGA------------VAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYR  150 (222)
Q Consensus        83 RsH~i~~i~v~~------------~s~l~~VDLaGsEr~~~~~~~~~~~~E~~~iN~Sl~~L~~vi~~L~~~~~~~vpyr  150 (222)
                      |||+||+|+|.+            .|+|+|||||||||..++++.|.+++|+..||+||++|++||.+|.+++..|||||
T Consensus       227 RSH~If~i~v~~~~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~~~hvPyR  306 (372)
T 3b6u_A          227 RSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYR  306 (372)
T ss_dssp             TSEEEEEEEEEEEC-----CCCEEEEEEEEEECCCCCE----------EEEGGGCCHHHHHHHHHHHHHHCC---CCCGG
T ss_pred             cceEEEEEEEEEeecCCCCCcceEEEEEEEEECCCCccccccCcchhhhhhHhhhhhhHHHHHHHHHHHhcCCCCCCccc
Confidence            999999999975            47899999999999999999999999999999999999999999998776899999


Q ss_pred             CchhHhhhhhccCCCCceEEEEEecCCCCCHHHHHHHHHHHHHhcccccccccccccccchHHHhh
Q psy7232         151 NSTLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYH  216 (222)
Q Consensus       151 ~SkLT~lL~d~lgg~~~t~~I~~vsp~~~~~~eTl~TL~fa~~~~~i~~~~~~n~~~~~~~~~~~~  216 (222)
                      |||||+||+|+||||++|+||+||||...+++||++||+||+|+++|+|.|++|+......+++|+
T Consensus       307 dSkLT~lLqdsLgGnskt~mIa~vsP~~~~~~ETlsTLrfA~rak~I~n~~~~n~~~~~~~~~~~~  372 (372)
T 3b6u_A          307 DSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQ  372 (372)
T ss_dssp             GSHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCBCCCCCCC-----------
T ss_pred             ccHHHHHHHHhcCCCccEEEEEEeCCcccCHHHHHHHHHHHHHHhhccccceecCChHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999998888888774
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 1e-33
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 3e-32
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-32
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 8e-32
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 5e-30
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-29
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 8e-29
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 7e-27
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 5e-26
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]

 Score =  121 bits (304), Expect = 1e-33
 Identities = 52/156 (33%), Positives = 81/156 (51%), Gaps = 7/156 (4%)

Query: 49  TVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQSSRSHTICTIYFG----AVAKLHLVDLA 104
               +   +  +++I  G+  + +  T  N+ SSRSH    I          K  LVDLA
Sbjct: 208 QEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLA 267

Query: 105 GSEQL-FSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNSTLTSILKDS-L 162
           G+E+   + S +   R E  +IN SL  L++ + AL + N+ H P+R S LT +L+DS +
Sbjct: 268 GNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQ-NKAHTPFRESKLTQVLRDSFI 326

Query: 163 GGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVS 198
           G N  T MIA++S    +   TL TL++A R   +S
Sbjct: 327 GENSRTCMIAMISPGISSCEYTLNTLRYADRVKELS 362
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=6.7e-52  Score=365.91  Aligned_cols=210  Identities=31%  Similarity=0.361  Sum_probs=184.9

Q ss_pred             CcceeEEeeeeeccccccccCCCCCCC-----CCCCCCCCCeeecCceEEEcCCHHHHHHHHHhhhhccchhhcccCCCC
Q psy7232           7 NKEVTLKNWIFNLPQSDQRAQGSPDPQ-----TGPASPGNGRSGASLTVKKLDSLNSAVQLIVTGNENKVTAVTKMNAQS   81 (222)
Q Consensus         7 ~~~~~~~~~i~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~v~~l~~~~v~s~~~~~~ll~~g~~~R~~~~t~~n~~s   81 (222)
                      ..+++|+++++|+|++.++||+.+...     ...+++.++++|+|+++++|.|++|+..+|..|..+|..++|.+|..|
T Consensus       119 ~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~s  198 (364)
T d1sdma_         119 KFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQS  198 (364)
T ss_dssp             TEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSCEEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHH
T ss_pred             cccceEEEEEEEEeccccccccCcccccccccceeecccCccccccceeeeeCCHHHHHHHhhccceeeccccccccccc
Confidence            347899999999999999999987653     335578899999999999999999999999999999999999999999


Q ss_pred             CCcccceeEEEee---------ecceeeeecCCCccccccCcchhhhHhHHhhhhcHHHHHHHHHHhcCCCCCCcCCCCc
Q psy7232          82 SRSHTICTIYFGA---------VAKLHLVDLAGSEQLFSLSDNYLLRNEARKINLSLHYLEQVMIALDEPNRHHIPYRNS  152 (222)
Q Consensus        82 sRsH~i~~i~v~~---------~s~l~~VDLaGsEr~~~~~~~~~~~~E~~~iN~Sl~~L~~vi~~L~~~~~~~vpyr~S  152 (222)
                      ||||+||+|++.+         .++|+||||||+||..++++.+.+++|+..||+||.+|++||.+|++++ .|||||+|
T Consensus       199 sRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-~~ipyR~S  277 (364)
T d1sdma_         199 SRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGN-QHIPYRNH  277 (364)
T ss_dssp             HHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHHHTC-SCCCGGGC
T ss_pred             cccceEEEEEEEEeccCcceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHHcCC-CcCCchhh
Confidence            9999999999976         6899999999999999999999999999999999999999999999876 89999999


Q ss_pred             hhHhhhhhccCCCCceEEEEEecCCCCCHHHHHHHHHHHHHhcccccccccccccccchHHHhhhhh
Q psy7232         153 TLTSILKDSLGGNGITSMIAVVSMDRYNQHQTLATLKFAQRTLRVSNYLQGNFVQEQDSYHYYHHVI  219 (222)
Q Consensus       153 kLT~lL~d~lgg~~~t~~I~~vsp~~~~~~eTl~TL~fa~~~~~i~~~~~~n~~~~~~~~~~~~~~~  219 (222)
                      |||++|+|+|||+|+|+||+||||...+++||++||+||++|++|+|.|++|....  .+.+++.++
T Consensus       278 kLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~--~~~~l~~~i  342 (364)
T d1sdma_         278 KLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSK--EVARLKKLV  342 (364)
T ss_dssp             HHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECH--HHHHHHTTT
T ss_pred             hhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCHH--HHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999997543  345555443
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure