Psyllid ID: psy7233


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---
MKLERSTLSLEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS
ccccccccHHHHHHHccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccHHHHHHHHHcccEEEEEccccEEEcccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccccccEEcHHHHHHHHHHcccccccEEEEEccHHHHHHHHHccccEEcccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHccccEEEccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHccccEEEEccccccHHHHHccccccccccccccccEEEccHHHHHHHHcc
ccccHcHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHcHHHHHHHHHccHHHHHHHHHcccEEEEEcccEEEccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHccccEccccccccccccccccHHHcccccccccEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccEcccccHHHHHHHHHcccccEEEccccHHHHHHHHHHccccHccEEEEcccccccHHHcccccccEEEEEcccccHHHHHHHccccccccccccccEEcccHHHHHHHHcc
mklerstlSLEAVRTNISNLILVCMCLKttfllippknqiCLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINlselsgdkqKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHlgfnaepneIIGTAYLAAQYLKKhldpkkkayivgssgiadelnlagienfgvgpdvmipgrdlktdheklnldphvGAVVVGFDSHISFPKLMKAACyltnpntlfvatntdesfpmgphvtvpgtGSMVAAVKtgaqrepvvigkpsKLIGSYLIEkynlnpertlmigdrgntdirlgynngFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSlgdmlpflss
mklerstlslEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTgaqrepvvigkpskLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAwsksedeeykSRVADYYLSslgdmlpflss
MKLERSTLSLEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWekleklqelqqYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS
*********LEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWS******YKSRVADYYLSSLG********
*********LEAVRTNISNLILVCMCLKTTFLLIPPKNQICL***********************************************DFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLS*
MKLERSTLSLEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS
*****STLSLEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLERSTLSLEAVRTNISNLILVCMCLKTTFLLIPPKNQICLWEKLEKLQELQQYFCHKFIALKCIVATSQTTVMKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query383 2.2.26 [Sep-21-2011]
Q8CHP8321 Phosphoglycolate phosphat yes N/A 0.778 0.928 0.420 2e-62
Q2T9S4321 Phosphoglycolate phosphat yes N/A 0.775 0.925 0.407 1e-60
A6NDG6321 Phosphoglycolate phosphat yes N/A 0.770 0.919 0.412 3e-58
Q5F4B1312 Phosphoglycolate phosphat yes N/A 0.778 0.955 0.410 1e-53
Q8VD52309 Pyridoxal phosphate phosp no N/A 0.736 0.912 0.342 2e-47
P60487292 Pyridoxal phosphate phosp no N/A 0.736 0.965 0.338 3e-47
Q3ZBF9296 Pyridoxal phosphate phosp no N/A 0.746 0.966 0.332 2e-46
Q96GD0296 Pyridoxal phosphate phosp no N/A 0.744 0.962 0.339 3e-46
Q00472298 4-nitrophenylphosphatase yes N/A 0.749 0.963 0.373 7e-46
P34492 526 Putative NipSnap protein no N/A 0.644 0.469 0.389 6e-41
>sp|Q8CHP8|PGP_MOUSE Phosphoglycolate phosphatase OS=Mus musculus GN=Pgp PE=2 SV=1 Back     alignment and function desciption
 Score =  239 bits (611), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 185/307 (60%), Gaps = 9/307 (2%)

Query: 82  ELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTR 141
            LS ++ K  L   DT+L DCDGVLW     + GA + + +L++ GK++ ++TNNS+KTR
Sbjct: 15  RLSAERAKLLLAEVDTLLFDCDGVLWRGETAVPGAPETLRALRARGKRLGFITNNSSKTR 74

Query: 142 EQLIVKLKHLGFNAEPN-----EIIGTAYLAAQYLKKHLD--PKKKAYIVGSSGIADELN 194
                KL+ LGF          E+ GTAY +A YL++ L   P  KAY++GS  +A EL 
Sbjct: 75  TAYAEKLRRLGFGGPVGPEAGLEVFGTAYCSALYLRQRLAGVPDPKAYVLGSPALAAELE 134

Query: 195 LAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPN 254
             G+ + GVGPDV+    D  +D   + L+P V AVVVGFD H S+ KL KA  YL  P+
Sbjct: 135 AVGVTSVGVGPDVL--HGDGPSDWLAVPLEPDVRAVVVGFDPHFSYMKLTKAVRYLQQPD 192

Query: 255 TLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNP 314
            L V TN D   P+     + GTG +V AV+  AQR+  +IGKPS+ I   + ++Y +NP
Sbjct: 193 CLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINP 252

Query: 315 ERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSL 374
           ERT+M+GDR +TDI LG     +T+L LTG +++E   +  +S+    K  V D+Y+ S+
Sbjct: 253 ERTVMVGDRLDTDILLGSTCSLKTILTLTGVSSLEDVKSNQESDCMFKKKMVPDFYVDSI 312

Query: 375 GDMLPFL 381
            D+LP L
Sbjct: 313 ADLLPAL 319





Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 8
>sp|Q2T9S4|PGP_BOVIN Phosphoglycolate phosphatase OS=Bos taurus GN=PGP PE=2 SV=1 Back     alignment and function description
>sp|A6NDG6|PGP_HUMAN Phosphoglycolate phosphatase OS=Homo sapiens GN=PGP PE=1 SV=1 Back     alignment and function description
>sp|Q5F4B1|PGP_CHICK Phosphoglycolate phosphatase OS=Gallus gallus GN=PGP PE=2 SV=1 Back     alignment and function description
>sp|Q8VD52|PLPP_RAT Pyridoxal phosphate phosphatase OS=Rattus norvegicus GN=Pdxp PE=1 SV=2 Back     alignment and function description
>sp|P60487|PLPP_MOUSE Pyridoxal phosphate phosphatase OS=Mus musculus GN=Pdxp PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBF9|PLPP_BOVIN Pyridoxal phosphate phosphatase OS=Bos taurus GN=PDXP PE=1 SV=1 Back     alignment and function description
>sp|Q96GD0|PLPP_HUMAN Pyridoxal phosphate phosphatase OS=Homo sapiens GN=PDXP PE=1 SV=2 Back     alignment and function description
>sp|Q00472|PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho2 PE=4 SV=2 Back     alignment and function description
>sp|P34492|YMQ1_CAEEL Putative NipSnap protein K02D10.1 OS=Caenorhabditis elegans GN=K02D10.1 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query383
91080661305 PREDICTED: similar to 4-nitrophenylphosp 0.793 0.996 0.560 4e-91
193596731311 PREDICTED: pyridoxine-5'-phosphate oxida 0.788 0.971 0.531 8e-84
157123469317 4-nitrophenylphosphatase [Aedes aegypti] 0.772 0.933 0.541 6e-83
195022018316 GH14463 [Drosophila grimshawi] gi|193898 0.780 0.946 0.526 2e-82
357628542302 putative 4-nitrophenylphosphatase [Danau 0.767 0.973 0.530 1e-81
170040775306 4-nitrophenylphosphatase [Culex quinquef 0.780 0.977 0.531 7e-81
195128395316 GI13608 [Drosophila mojavensis] gi|19392 0.772 0.936 0.528 8e-81
195328487315 GM24299 [Drosophila sechellia] gi|194119 0.778 0.946 0.521 2e-80
195591187315 GD12368 [Drosophila simulans] gi|1941973 0.778 0.946 0.521 3e-80
195494715315 GE22109 [Drosophila yakuba] gi|194181058 0.778 0.946 0.514 5e-80
>gi|91080661|ref|XP_974660.1| PREDICTED: similar to 4-nitrophenylphosphatase [Tribolium castaneum] gi|270005498|gb|EFA01946.1| hypothetical protein TcasGA2_TC007560 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  341 bits (874), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 223/307 (72%), Gaps = 3/307 (0%)

Query: 75  MKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVT 134
           M +I LS+ + ++ K F +SFDTVL DCDGVLWL+NE ISG+  V+N L+ LGK+IF+VT
Sbjct: 1   MSVIFLSKQTKEEFKKFFSSFDTVLFDCDGVLWLDNEPISGSVPVVNRLRELGKRIFFVT 60

Query: 135 NNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELN 194
           NNSTK R +  VK K + FN E +EII TAYLAA YLK ++D K+  Y+VGS GI  EL+
Sbjct: 61  NNSTKMRNEFAVKAKRMNFNIETDEIISTAYLAAAYLK-NMDFKQSVYVVGSRGITQELD 119

Query: 195 LAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPN 254
             GI+++GVGPDV+     L    E   ++  VGAV+VG+D H S+ K+MKAA YL NPN
Sbjct: 120 AVGIKHYGVGPDVL--QNALVHVIENFQMESDVGAVIVGYDEHFSYVKMMKAASYLNNPN 177

Query: 255 TLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNP 314
            LF+ATNTDE FPM   + +PGTG++V+AV+T AQR P+V+GKP+  I   LI+KY + P
Sbjct: 178 CLFIATNTDERFPMSTDLVIPGTGAIVSAVETCAQRSPIVVGKPNPYIVDDLIKKYGIVP 237

Query: 315 ERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSL 374
           +RTLMIGDR NTDI LG   GFQTLLVL+G TT+++A+A   S  +E K  VAD+YL  L
Sbjct: 238 KRTLMIGDRVNTDILLGTRCGFQTLLVLSGVTTLKEAVALKNSHKKEDKEMVADFYLEKL 297

Query: 375 GDMLPFL 381
           GD+LP L
Sbjct: 298 GDILPLL 304




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193596731|ref|XP_001950741.1| PREDICTED: pyridoxine-5'-phosphate oxidase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157123469|ref|XP_001660159.1| 4-nitrophenylphosphatase [Aedes aegypti] gi|108874389|gb|EAT38614.1| AAEL009503-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195022018|ref|XP_001985501.1| GH14463 [Drosophila grimshawi] gi|193898983|gb|EDV97849.1| GH14463 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|357628542|gb|EHJ77837.1| putative 4-nitrophenylphosphatase [Danaus plexippus] Back     alignment and taxonomy information
>gi|170040775|ref|XP_001848163.1| 4-nitrophenylphosphatase [Culex quinquefasciatus] gi|167864374|gb|EDS27757.1| 4-nitrophenylphosphatase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195128395|ref|XP_002008649.1| GI13608 [Drosophila mojavensis] gi|193920258|gb|EDW19125.1| GI13608 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195328487|ref|XP_002030946.1| GM24299 [Drosophila sechellia] gi|194119889|gb|EDW41932.1| GM24299 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195591187|ref|XP_002085324.1| GD12368 [Drosophila simulans] gi|194197333|gb|EDX10909.1| GD12368 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195494715|ref|XP_002094957.1| GE22109 [Drosophila yakuba] gi|194181058|gb|EDW94669.1| GE22109 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query383
FB|FBgn0036760330 CG5567 [Drosophila melanogaste 0.778 0.903 0.514 6.3e-76
ZFIN|ZDB-GENE-030131-6240306 pgp "phosphoglycolate phosphat 0.778 0.973 0.471 1.3e-66
UNIPROTKB|Q5F4B1312 PGP "Phosphoglycolate phosphat 0.775 0.951 0.418 7.3e-59
MGI|MGI:1914328321 Pgp "phosphoglycolate phosphat 0.775 0.925 0.428 3.2e-58
RGD|1307773321 Pgp "phosphoglycolate phosphat 0.775 0.925 0.428 3.2e-58
UNIPROTKB|Q2T9S4321 PGP "Phosphoglycolate phosphat 0.767 0.915 0.414 1.6e-56
UNIPROTKB|A6NDG6321 PGP "Phosphoglycolate phosphat 0.775 0.925 0.421 1.6e-56
FB|FBgn0052487320 CG32487 [Drosophila melanogast 0.762 0.912 0.405 7.2e-52
DICTYBASE|DDB_G0284737303 DDB_G0284737 "putative phospho 0.765 0.966 0.389 1.2e-51
ZFIN|ZDB-GENE-080723-69308 zgc:194409 "zgc:194409" [Danio 0.762 0.948 0.394 3.1e-51
FB|FBgn0036760 CG5567 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 765 (274.4 bits), Expect = 6.3e-76, P = 6.3e-76
 Identities = 155/301 (51%), Positives = 205/301 (68%)

Query:    79 NLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNST 138
             NL ELS  K  ++L  FD+V+TDCDGVLW+  + + G+  VMN LK +GK I++ TNNST
Sbjct:    23 NLLELSSAKVTEWLAGFDSVITDCDGVLWIYGQALEGSVDVMNQLKGMGKSIYFCTNNST 82

Query:   139 KTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGI 198
             KTR +L+ K   LGF+ + N II TA+  A YLK+  +  K+ +++GS GI  EL+  GI
Sbjct:    83 KTRSELLKKGVELGFHIKENGIISTAHATAAYLKRR-NFSKRVFVIGSEGITKELDAVGI 141

Query:   199 ENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFV 258
             ++  VGP+ M  G   +   + L LD  +GAVVVGFD H SFPK+MKAA YL +P  LFV
Sbjct:   142 QHTEVGPEPM-KGSLAEFMAQHLKLDTDIGAVVVGFDEHFSFPKMMKAASYLNDPECLFV 200

Query:   259 ATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTL 318
             ATNTDE FPM P++ VPG+GS V A++T A+R+PVVIGKP+  I   L+ +  ++P RTL
Sbjct:   201 ATNTDERFPM-PNMIVPGSGSFVRAIQTCAERDPVVIGKPNPAICESLVTEKKIDPSRTL 259

Query:   319 MIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDML 378
             MIGDR NTDI LG+N GFQTLLV +G   ++    W  S+D E K  + D YL  LGD+L
Sbjct:   260 MIGDRANTDILLGFNCGFQTLLVGSGIHQLKDVERWKLSQDPEEKKLIPDVYLPKLGDLL 319

Query:   379 P 379
             P
Sbjct:   320 P 320




GO:0003869 "4-nitrophenylphosphatase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
ZFIN|ZDB-GENE-030131-6240 pgp "phosphoglycolate phosphatase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F4B1 PGP "Phosphoglycolate phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1914328 Pgp "phosphoglycolate phosphatase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307773 Pgp "phosphoglycolate phosphatase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9S4 PGP "Phosphoglycolate phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6NDG6 PGP "Phosphoglycolate phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0052487 CG32487 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284737 DDB_G0284737 "putative phosphoric monoester hydrolase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080723-69 zgc:194409 "zgc:194409" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2FZX0NAGD_STAA8No assigned EC number0.31780.61090.9034yesN/A
Q5HHF6NAGD_STAACNo assigned EC number0.31780.61090.9034yesN/A
Q49W68NAGD_STAS1No assigned EC number0.30880.61350.9073yesN/A
P19881PNPP_YEAST3, ., 1, ., 3, ., 4, 10.35220.62660.7692yesN/A
Q7A6K4NAGD_STAANNo assigned EC number0.31780.61090.9034yesN/A
Q7A1D4NAGD_STAAWNo assigned EC number0.31780.61090.9034yesN/A
Q8CPW3NAGD_STAESNo assigned EC number0.30230.61090.9034yesN/A
Q8CHP8PGP_MOUSE3, ., 1, ., 3, ., 1, 80.42010.77800.9283yesN/A
Q99VE8NAGD_STAAMNo assigned EC number0.31780.61090.9034yesN/A
Q6GIF9NAGD_STAARNo assigned EC number0.31780.61090.9034yesN/A
Q6GAZ7NAGD_STAASNo assigned EC number0.31780.61090.9034yesN/A
Q2T9S4PGP_BOVIN3, ., 1, ., 3, ., 1, 80.40700.77540.9252yesN/A
Q4L4U2NAGD_STAHJNo assigned EC number0.30260.60830.8859yesN/A
Q00472PNPP_SCHPO3, ., 1, ., 3, ., 4, 10.37330.74930.9630yesN/A
Q5HQN3NAGD_STAEQNo assigned EC number0.30620.61090.9034yesN/A
A6NDG6PGP_HUMAN3, ., 1, ., 3, ., 1, 80.41290.77020.9190yesN/A
Q5F4B1PGP_CHICK3, ., 1, ., 3, ., 1, 80.41050.77800.9551yesN/A
Q2YWR1NAGD_STAABNo assigned EC number0.31390.61090.9034yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.766
3rd Layer3.1.3.74LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
TIGR01452279 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho 8e-90
PLN02645311 PLN02645, PLN02645, phosphoglycolate phosphatase 6e-79
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 8e-68
TIGR01460236 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super 5e-56
pfam13344101 pfam13344, Hydrolase_6, Haloacid dehalogenase-like 6e-35
TIGR01457249 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfam 3e-34
PRK10444248 PRK10444, PRK10444, UMP phosphatase; Provisional 1e-24
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 1e-14
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 2e-12
TIGR01458257 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam 2e-11
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 2e-09
TIGR01459242 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class 1e-07
COG0546220 COG0546, Gph, Predicted phosphatases [General func 1e-07
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 2e-05
COG0241181 COG0241, HisB, Histidinol phosphatase and related 6e-05
COG2179175 COG2179, COG2179, Predicted hydrolase of the HAD s 2e-04
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hy 2e-04
TIGR01662132 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, 4e-04
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 5e-04
TIGR01533266 TIGR01533, lipo_e_P4, 5'-nucleotidase, lipoprotein 0.002
>gnl|CDD|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
 Score =  271 bits (695), Expect = 8e-90
 Identities = 109/282 (38%), Positives = 164/282 (58%), Gaps = 5/282 (1%)

Query: 96  DTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNA 155
              + DCDGVLWL   ++ GA ++++ L   GK   +VTNNSTK+R +  +K   LGFN 
Sbjct: 3   QGFIFDCDGVLWLGERVVPGAPELLDRLARAGKAALFVTNNSTKSRAEYALKFARLGFNG 62

Query: 156 EPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLK 215
              ++  +A  AA+ L++  D  K  Y++G  G+  EL+ AGI   G        G   +
Sbjct: 63  LAEQLFSSALCAARLLRQPPDAPKAVYVIGEEGLRAELDAAGIRLAGDPSAG--DGAAPR 120

Query: 216 TDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGPHVTVP 275
                + L+ +VGAVVVG+D H S+ KL +A  +L  P  LFVATN D   P+      P
Sbjct: 121 GSGAFMKLEENVGAVVVGYDEHFSYAKLREACAHLREPGCLFVATNRDPWHPLSDGSRTP 180

Query: 276 GTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNNG 335
           GTGS+VAA++T + R+P+V+GKPS  +   + E ++++P RTLM+GDR  TDI  G+  G
Sbjct: 181 GTGSLVAAIETASGRQPLVVGKPSPYMFECITENFSIDPARTLMVGDRLETDILFGHRCG 240

Query: 336 FQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDM 377
             T+LVL+G + +E+A  +  +   +    V DY + SL D+
Sbjct: 241 MTTVLVLSGVSRLEEAQEYLAAGQHDL---VPDYVVESLADL 279


PGP is an essential enzyme in the glycolate salvage pathway in higher organisms (photorespiration in plants). Phosphoglycolate results from the oxidase activity of RubisCO in the Calvin cycle when concentrations of carbon dioxide are low relative to oxygen. In mammals, PGP is found in many tissues, notably in red blood cells where P-glycolate is and important activator of the hydrolysis of 2,3-bisphosphoglycerate, a major modifier of the oxygen affinity of hemoglobin. Pyridoxal phosphate (PLP, Vitamin B6) phosphatase is involved in the degradation of PLP in mammals and is widely distributed in human tissues including erythrocyes. The enzymes described here are members of the Haloacid dehalogenase superfamily of hydrolase enzymes (pfam00702). Unlike the bacterial PGP equivalog (TIGR01449), which is a member of class (subfamily) I, these enzymes are members of class (subfamily) II. These two families have almost certainly arisen from convergent evolution (although these two ancestors may themselves have diverged from a more distant HAD superfamily progenitor). The primary seed sequence for this model comes from Chlamydomonas reinhardtii, a photosynthetic alga. The enzyme has been purified and characterized and these data are fully consistent with the assignment of function as a PGPase involved in photorespiration. The second seed, from Homo sapiens chromosome 22 has been characterized as a pyridoxal phosphatase. Biochemical characterization of partially purified PGP's from various tissues including red blood cells have been performed while one gene for PGP has been localized to chromosome 16p13.3. The sequence used here maps to chromosome 22. There is indeed a related gene on chromosome 16 (and it is expressed, since EST's are found) which shows 46% identity and 59% positives by BLAST2 (E=1e-66). The chromosome 16 gene is not in evidence in nraa but translated from the genomic sequence would score 372.4 (E=7.9e-113) versus This model, well above trusted. The third seed, from C. elegans, is only supported by sequence similarity. This model is limited to eukaryotic species including S. pombe and S. cerevisiae, although several archaea score between the trusted and noise cutoffs. This model is closely related to a family of bacterial sequences including the E. coli NagD and B. subtilus AraL genes which are characterized by the ability to hydrolyze para-nitrophenylphosphate (pNPPases or NPPases). The chlamydomonas PGPase d. Length = 279

>gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|130524 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>gnl|CDD|182466 PRK10444, PRK10444, UMP phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|223319 COG0241, HisB, Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233452 TIGR01533, lipo_e_P4, 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 383
KOG2882|consensus306 100.0
COG0647269 NagD Predicted sugar phosphatases of the HAD super 100.0
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 100.0
PRK10444248 UMP phosphatase; Provisional 100.0
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 100.0
PLN02645311 phosphoglycolate phosphatase 100.0
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 100.0
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 100.0
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 100.0
KOG3040|consensus262 100.0
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.97
COG0546220 Gph Predicted phosphatases [General function predi 99.86
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.86
PRK13288214 pyrophosphatase PpaX; Provisional 99.86
PRK13226229 phosphoglycolate phosphatase; Provisional 99.86
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.85
KOG1618|consensus389 99.85
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.85
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.84
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.84
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.84
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.84
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.83
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.83
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 99.83
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.82
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.82
PRK13223272 phosphoglycolate phosphatase; Provisional 99.81
PRK11587218 putative phosphatase; Provisional 99.81
PLN02575381 haloacid dehalogenase-like hydrolase 99.8
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.8
PRK09449224 dUMP phosphatase; Provisional 99.79
PLN02940 382 riboflavin kinase 99.79
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.79
PRK13222226 phosphoglycolate phosphatase; Provisional 99.79
PRK13225273 phosphoglycolate phosphatase; Provisional 99.78
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.77
PRK14988224 GMP/IMP nucleotidase; Provisional 99.76
PRK06769173 hypothetical protein; Validated 99.76
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.75
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.75
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.75
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.75
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.73
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.73
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.71
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.71
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.71
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.71
KOG3085|consensus237 99.7
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.7
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.68
PHA02597197 30.2 hypothetical protein; Provisional 99.68
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.67
PLN02811220 hydrolase 99.65
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.63
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.62
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.62
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.61
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.57
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.56
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.56
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.55
KOG2914|consensus222 99.53
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.51
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.49
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.48
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.48
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.47
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.46
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.44
PLN02954224 phosphoserine phosphatase 99.44
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.41
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.4
PRK01158230 phosphoglycolate phosphatase; Provisional 99.39
PHA02530300 pseT polynucleotide kinase; Provisional 99.35
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.34
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.33
PRK10513270 sugar phosphate phosphatase; Provisional 99.32
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.31
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.31
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.3
PRK10976266 putative hydrolase; Provisional 99.3
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.3
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.29
PRK11133322 serB phosphoserine phosphatase; Provisional 99.28
PLN02887580 hydrolase family protein 99.28
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.28
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.26
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.24
KOG3109|consensus244 99.21
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.21
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.19
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 99.19
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.18
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.16
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.16
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.15
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 99.15
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.14
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.12
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 99.08
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 99.07
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 99.06
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.06
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 99.05
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 99.03
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.94
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 98.93
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 98.92
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.88
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 98.86
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 98.74
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 98.74
PTZ00445219 p36-lilke protein; Provisional 98.74
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 98.73
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.7
PTZ00174247 phosphomannomutase; Provisional 98.7
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.65
PLN02382 413 probable sucrose-phosphatase 98.59
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 98.55
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 98.54
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 98.44
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 98.39
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 98.31
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 98.3
COG4229229 Predicted enolase-phosphatase [Energy production a 98.29
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.22
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 98.19
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.18
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.14
PLN02580384 trehalose-phosphatase 98.14
PRK10671834 copA copper exporting ATPase; Provisional 98.13
PRK08238 479 hypothetical protein; Validated 98.12
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.07
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.07
PLN03017366 trehalose-phosphatase 98.05
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.05
PLN02151354 trehalose-phosphatase 98.04
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 98.01
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 97.97
PHA03398303 viral phosphatase superfamily protein; Provisional 97.93
PF06437408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 97.86
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 97.84
KOG2961|consensus190 97.83
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 97.82
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 97.78
PLN02423245 phosphomannomutase 97.6
PRK11590211 hypothetical protein; Provisional 97.56
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.4
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.38
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.34
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.32
COG4087152 Soluble P-type ATPase [General function prediction 97.11
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 96.96
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 96.9
KOG1615|consensus227 96.81
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.64
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 96.54
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 96.39
COG2503274 Predicted secreted acid phosphatase [General funct 96.28
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.22
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 96.19
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 95.97
PLN03063797 alpha,alpha-trehalose-phosphate synthase (UDP-form 95.93
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 95.83
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 95.69
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.21
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 95.18
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 95.16
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 95.14
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 95.07
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 94.57
COG4996164 Predicted phosphatase [General function prediction 94.49
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 94.49
COG4359220 Uncharacterized conserved protein [Function unknow 94.35
TIGR024681050 sucrsPsyn_pln sucrose phosphate synthase/possible 94.11
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 93.97
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 93.26
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 93.06
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 92.55
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 92.44
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 92.14
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 92.13
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 90.77
PRK11587218 putative phosphatase; Provisional 90.59
KOG2630|consensus254 90.55
KOG2470|consensus510 89.85
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 89.36
PLN03064934 alpha,alpha-trehalose-phosphate synthase (UDP-form 89.2
COG0637221 Predicted phosphatase/phosphohexomutase [General f 88.67
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 88.36
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 88.3
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 87.55
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 87.54
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 87.52
COG4030315 Uncharacterized protein conserved in archaea [Func 87.47
KOG2116|consensus738 86.69
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 86.66
KOG0207|consensus 951 86.56
PLN02423245 phosphomannomutase 86.43
KOG3189|consensus252 86.32
PLN02645 311 phosphoglycolate phosphatase 85.71
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 85.64
PLN02770248 haloacid dehalogenase-like hydrolase family protei 85.5
PLN03190 1178 aminophospholipid translocase; Provisional 85.33
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 85.09
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 85.04
PRK13288214 pyrophosphatase PpaX; Provisional 84.64
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 84.35
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 84.3
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 84.13
COG4850373 Uncharacterized conserved protein [Function unknow 84.02
KOG2961|consensus190 83.63
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 83.27
PRK14010 673 potassium-transporting ATPase subunit B; Provision 83.02
PRK14988224 GMP/IMP nucleotidase; Provisional 82.43
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 82.32
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 82.22
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 81.87
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 81.56
COG3700237 AphA Acid phosphatase (class B) [General function 81.48
COG4087152 Soluble P-type ATPase [General function prediction 81.44
COG3700237 AphA Acid phosphatase (class B) [General function 81.34
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 81.3
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 80.54
>KOG2882|consensus Back     alignment and domain information
Probab=100.00  E-value=3e-46  Score=346.03  Aligned_cols=290  Identities=52%  Similarity=0.856  Sum_probs=264.2

Q ss_pred             hhHHHhhcCCCEEEEecCCceecCCccChhHHHHHHHHHHcCceEEEEcCCCCCCHHHHHHHHHhcCCC-CCcCcccchH
Q psy7233          86 DKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFN-AEPNEIIGTA  164 (383)
Q Consensus        86 ~~~~~~~~~~kaViFDlDGTL~d~~~~~p~A~eal~~l~~~Gi~v~ivTn~~~~~~~~~~~~L~~lG~~-i~~~~i~~s~  164 (383)
                      ++..+++..|++|+||+|||||.+..++||+.++++.|++.|+.+.++|||+.++++++.++++++|+. +..++|++++
T Consensus        13 ~~~~e~l~~~DtfifDcDGVlW~g~~~ipGs~e~l~~L~~~gK~i~fvTNNStksr~~y~kK~~~lG~~~v~e~~i~ssa   92 (306)
T KOG2882|consen   13 EEARELLDSFDTFIFDCDGVLWLGEKPIPGSPEALNLLKSLGKQIIFVTNNSTKSREQYMKKFAKLGFNSVKEENIFSSA   92 (306)
T ss_pred             HHHHHHHhhcCEEEEcCCcceeecCCCCCChHHHHHHHHHcCCcEEEEeCCCcchHHHHHHHHHHhCccccCcccccChH
Confidence            677889999999999999999999999999999999999999999999999999999999999999999 9999999999


Q ss_pred             HHHHHHHHhcCC-CCCeEEEEeCcchHHHHHHcCCcccccCCCCCCCCCCCcccccccCCCCCccEEEEeccCCCChhhH
Q psy7233         165 YLAAQYLKKHLD-PKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKL  243 (383)
Q Consensus       165 ~~~~~~l~~~~~-~~~~~~~ig~~~l~~~l~~~gi~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~Vv~g~~~~~~~~~l  243 (383)
                      .+.++|+.+. . .++++|++|++++.+++++.|++..+.+++.... -...+.+.....++.+.+|++|++.+++|.++
T Consensus        93 ~~~a~ylk~~-~~~~k~Vyvig~~gi~~eL~~aG~~~~g~~~~~~~~-~~~~~~~~~~~~d~~VgAVvvg~D~hfsy~KL  170 (306)
T KOG2882|consen   93 YAIADYLKKR-KPFGKKVYVIGEEGIREELDEAGFEYFGGGPDGKDT-DGAKSFVLSIGLDPDVGAVVVGYDEHFSYPKL  170 (306)
T ss_pred             HHHHHHHHHh-CcCCCeEEEecchhhhHHHHHcCceeecCCCCcccc-cccccchhhcCCCCCCCEEEEecccccCHHHH
Confidence            9999999888 5 6789999999999999999999988777665432 01112333444577799999999999999999


Q ss_pred             HHHHHHhhCCCCEEEEecCCCCCCCCCCccccCcchHHHHHHHhcCCCccccCCCCHHHHHHHHHHcCCCCCcEEEEecC
Q psy7233         244 MKAACYLTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDR  323 (383)
Q Consensus       244 ~~~l~~L~~~g~~~i~tn~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~gKP~p~~~~~al~~lgi~p~e~l~IGDs  323 (383)
                      ..++.+|++++..+++||.|...|...+..++|.|+++..+..++++++...|||++.+++.+.++.++.|++++||||+
T Consensus       171 ~kA~~yLqnP~clflatn~D~~~p~~~~~~ipG~G~~v~av~~~t~R~P~v~GKP~~~m~~~l~~~~~i~psRt~mvGDR  250 (306)
T KOG2882|consen  171 MKALNYLQNPGCLFLATNRDATTPPTPGVEIPGAGSFVAAVKFATGRQPIVLGKPSTFMFEYLLEKFNIDPSRTCMVGDR  250 (306)
T ss_pred             HHHHHHhCCCCcEEEeccCccccCCCCCeeccCCccHHHHHHHHhcCCCeecCCCCHHHHHHHHHHcCCCcceEEEEccc
Confidence            99999999999999999999988866777999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHHHHHHcCCcEEEEcCCCCChHHHHhcccccchhhcCCCccEEeCCHhhHHHhhh
Q psy7233         324 GNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLS  382 (383)
Q Consensus       324 ~~~DI~~A~~aGl~tv~V~~G~~~~~~~~~~~~~~~~~~~~~~pd~vi~sl~eL~~~l~  382 (383)
                      +.+||.-|+++|++|++|.+|.+..++....+     ..+...|||+++++.++.+.++
T Consensus       251 L~TDIlFG~~~G~~TLLvltGv~~led~~~~~-----~~~~~~PDyy~~~l~d~~~~~~  304 (306)
T KOG2882|consen  251 LDTDILFGKNCGFKTLLVLSGVTTLEDILEAQ-----GDNKMVPDYYADSLGDLLPLLN  304 (306)
T ss_pred             chhhhhHhhccCcceEEEecCcCcHHHHHhcc-----cccCCCCchHHhhHHHHhhhcc
Confidence            99999999999999999999999999888753     2357789999999999988764



>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>KOG3040|consensus Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>KOG1618|consensus Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>KOG3085|consensus Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>KOG2914|consensus Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>KOG3109|consensus Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>KOG2961|consensus Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>KOG1615|consensus Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>KOG2630|consensus Back     alignment and domain information
>KOG2470|consensus Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG2116|consensus Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>KOG0207|consensus Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>KOG3189|consensus Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>COG4850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2961|consensus Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
2cfs_A298 Crystal Structure Of Human Pyridoxal 5'-Phosphate P 2e-47
2oyc_A306 Crystal Structure Of Human Pyridoxal Phosphate Phos 3e-46
2cfr_A298 Crystal Structure Of Human Pyridoxal 5'-Phosphate P 7e-46
1zjj_A263 Crystal Structure Of Hypothetical Protein Ph1952 Fr 2e-29
3qgm_A268 P-Nitrophenyl Phosphatase From Archaeoglobus Fulgid 2e-26
1vjr_A271 Crystal Structure Of 4-nitrophenylphosphatase (tm17 1e-24
1yv9_A264 Crystal Structure Of A Had-Like Phosphatase From En 1e-24
1pw5_A253 Putative Nagd Protein Length = 253 2e-24
3epr_A264 Crystal Structure Of Putative Had Superfamily Hydro 8e-23
3pdw_A266 Crystal Structure Of Putative P-Nitrophenyl Phospha 5e-22
1ydf_A257 Crystal Structure Of A Had-like Phosphatase From St 2e-20
2c4n_A250 Nagd From E.Coli K-12 Strain Length = 250 4e-20
1wvi_A257 Crystal Structure Of Putative Phosphatase From Stre 5e-18
1ys9_A254 Crystal Sructure Of Phosphatase Spy1043 From Strept 8e-18
2hx1_A284 Crystal Structure Of Possible Sugar Phosphatase, Ha 6e-13
2ho4_A259 Crystal Structure Of Protein From Mouse Mm.236127 L 1e-10
3hlt_A266 The Crystal Structure Of Human Haloacid Dehalogenas 2e-09
2x4d_A271 Crystal Structure Of Human Phospholysine Phosphohis 4e-04
>pdb|2CFS|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 Back     alignment and structure

Iteration: 1

Score = 186 bits (471), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 104/306 (33%), Positives = 159/306 (51%), Gaps = 21/306 (6%) Query: 77 LINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNN 136 + L G +D L VL DCDGVLW + GA +++ L GK +V+NN Sbjct: 3 MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNN 62 Query: 137 STKTREQLIVKLKHLGFNA-EPNEIIGTAYLAAQYLKKHL----DPKKKAYIVGSSGIAD 191 S + R +L ++ LGF ++ +A AA+ L++ L D +++G G+ Sbjct: 63 SRRARPELALRFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRA 122 Query: 192 ELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLT 251 EL AG+ + G D P V AV+VG+D H SF KL +A +L Sbjct: 123 ELRAAGLR---------LAGDPSAGD----GAAPRVRAVLVGYDEHFSFAKLREACAHLR 169 Query: 252 NPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYN 311 +P L VAT+ D P+ PGTGS+ AAV+T + R+ +V+GKPS + + E ++ Sbjct: 170 DPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFS 229 Query: 312 LNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYL 371 ++P RTLM+GDR TDI G+ G T+L LTG + +E+A A+ + + V YY+ Sbjct: 230 IDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDL---VPHYYV 286 Query: 372 SSLGDM 377 S+ D+ Sbjct: 287 ESIADL 292
>pdb|2OYC|A Chain A, Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Length = 306 Back     alignment and structure
>pdb|2CFR|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 Back     alignment and structure
>pdb|1ZJJ|A Chain A, Crystal Structure Of Hypothetical Protein Ph1952 From Pyrococcus Horikoshii Ot3 Length = 263 Back     alignment and structure
>pdb|3QGM|A Chain A, P-Nitrophenyl Phosphatase From Archaeoglobus Fulgidus Length = 268 Back     alignment and structure
>pdb|1VJR|A Chain A, Crystal Structure Of 4-nitrophenylphosphatase (tm1742) From Thermotoga Maritima At 2.40 A Resolution Length = 271 Back     alignment and structure
>pdb|1YV9|A Chain A, Crystal Structure Of A Had-Like Phosphatase From Enterococcus Faecalis V583 Length = 264 Back     alignment and structure
>pdb|1PW5|A Chain A, Putative Nagd Protein Length = 253 Back     alignment and structure
>pdb|3EPR|A Chain A, Crystal Structure Of Putative Had Superfamily Hydrolase From Streptococcus Agalactiae Length = 264 Back     alignment and structure
>pdb|3PDW|A Chain A, Crystal Structure Of Putative P-Nitrophenyl Phosphatase From Bacillus Subtilis Length = 266 Back     alignment and structure
>pdb|1YDF|A Chain A, Crystal Structure Of A Had-like Phosphatase From Streptococcus Pneumoniae Length = 257 Back     alignment and structure
>pdb|2C4N|A Chain A, Nagd From E.Coli K-12 Strain Length = 250 Back     alignment and structure
>pdb|1WVI|A Chain A, Crystal Structure Of Putative Phosphatase From Streptococcus Mutans Ua159 Length = 257 Back     alignment and structure
>pdb|1YS9|A Chain A, Crystal Sructure Of Phosphatase Spy1043 From Streptococcus Pyogenes Length = 254 Back     alignment and structure
>pdb|2HX1|A Chain A, Crystal Structure Of Possible Sugar Phosphatase, Had Superfamily (Zp_00311070.1) From Cytophaga Hutchinsonii Atcc 33406 At 2.10 A Resolution Length = 284 Back     alignment and structure
>pdb|2HO4|A Chain A, Crystal Structure Of Protein From Mouse Mm.236127 Length = 259 Back     alignment and structure
>pdb|3HLT|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 2 (Hdhd2) Length = 266 Back     alignment and structure
>pdb|2X4D|A Chain A, Crystal Structure Of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 1e-123
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 1e-109
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 1e-106
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 1e-105
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 1e-105
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 1e-104
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 1e-100
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 1e-100
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 2e-99
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 4e-96
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 7e-84
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 4e-52
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3ib6_A189 Uncharacterized protein; structural genomics, unkn 9e-08
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 2e-07
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 1e-06
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 1e-06
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 2e-06
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 6e-06
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 1e-05
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 2e-05
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 2e-05
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 2e-05
2o2x_A218 Hypothetical protein; structural genomics, joint c 2e-05
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 4e-05
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 6e-05
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 7e-05
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 8e-05
3sd7_A240 Putative phosphatase; structural genomics, haloaci 1e-04
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 2e-04
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 2e-04
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 2e-04
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 2e-04
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 Back     alignment and structure
 Score =  356 bits (916), Expect = e-123
 Identities = 106/312 (33%), Positives = 159/312 (50%), Gaps = 21/312 (6%)

Query: 75  MKLINLSELSGDKQKDFLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVT 134
           M L     L G   +D L     VL DCDGVLW     + GA +++  L   GK   +V+
Sbjct: 1   MSLARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVS 60

Query: 135 NNSTKTREQLIVKLKHLGFNA-EPNEIIGTAYLAAQYLKKHL----DPKKKAYIVGSSGI 189
           NNS + R +L ++   LGF      ++  +A  AA+ L++ L    D     +++G  G+
Sbjct: 61  NNSRRARPELALRFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGL 120

Query: 190 ADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACY 249
             EL  AG+   G  P                   P V AV+VG+D H SF KL +A  +
Sbjct: 121 RAELRAAGLRLAG-DPS------------AGDGAAPRVRAVLVGYDEHFSFAKLREACAH 167

Query: 250 LTNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEK 309
           L +P  L VAT+ D   P+      PGTGS+ AAV+T + R+ +V+GKPS  +   + E 
Sbjct: 168 LRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITEN 227

Query: 310 YNLNPERTLMIGDRGNTDIRLGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADY 369
           ++++P RTLM+GDR  TDI  G+  G  T+L LTG + +E+A A+  +   +       Y
Sbjct: 228 FSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLV---PHY 284

Query: 370 YLSSLGDMLPFL 381
           Y+ S+ D+   L
Sbjct: 285 YVESIADLTEGL 296


>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Length = 176 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Length = 211 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query383
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 100.0
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 100.0
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 100.0
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 100.0
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 100.0
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 100.0
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 100.0
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 100.0
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 100.0
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.98
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.97
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.96
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.87
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.87
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.87
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.86
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.86
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.86
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.85
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.85
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.85
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.85
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.85
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.84
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.84
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.83
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.83
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.83
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.83
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.83
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.82
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.82
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.82
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.82
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.82
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.81
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.81
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.81
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.81
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.81
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.8
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.8
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.8
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.8
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.79
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.79
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.79
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.79
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.79
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.79
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.78
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.78
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.78
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.78
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.77
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.77
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.77
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.76
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.76
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.76
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.74
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.73
1te2_A226 Putative phosphatase; structural genomics, phospha 99.73
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.72
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.72
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.72
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.71
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.69
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.68
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.67
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.67
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.67
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.66
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.66
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.65
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.64
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.63
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.63
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.62
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.62
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.62
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.61
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.6
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.6
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.6
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.59
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.59
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.58
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.58
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.57
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.56
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.54
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.54
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.53
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.53
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.52
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.52
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.51
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.5
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.5
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.5
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.49
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.47
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.47
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.46
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.46
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.45
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.44
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.44
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.44
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.44
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.43
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.43
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.42
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.38
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.37
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 99.35
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.34
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.32
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 98.98
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.3
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.29
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.28
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.28
3fvv_A232 Uncharacterized protein; unknown function, structu 99.24
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.23
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.22
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 99.14
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.12
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 99.11
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.11
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 99.08
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.03
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.0
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 98.83
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 98.81
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 98.66
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.61
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 98.59
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.54
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 98.05
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 98.05
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.03
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.0
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 97.85
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 97.77
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.58
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.05
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 96.05
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 95.99
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 95.87
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.55
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 95.13
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 95.12
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 94.72
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 94.66
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 94.66
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 93.96
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 93.96
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 93.27
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 93.14
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 92.84
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 91.64
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 91.22
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 90.63
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 89.23
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 88.09
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 81.93
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 81.66
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 81.47
3fvv_A232 Uncharacterized protein; unknown function, structu 81.42
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 81.11
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 80.66
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
Probab=100.00  E-value=2.4e-36  Score=283.32  Aligned_cols=262  Identities=30%  Similarity=0.471  Sum_probs=224.1

Q ss_pred             CCEEEEecCCceecCCccChhHHHHHHHHHHcCceEEEEcCCCCCCHHHHHHHHHhcCCCCCcCcccchHHHHHHHHHhc
Q psy7233          95 FDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQYLKKH  174 (383)
Q Consensus        95 ~kaViFDlDGTL~d~~~~~p~A~eal~~l~~~Gi~v~ivTn~~~~~~~~~~~~L~~lG~~i~~~~i~~s~~~~~~~l~~~  174 (383)
                      +|+|+||+||||+++...++++.++++++++.|++++++||++.++...+.+.|..+|++...+++++++.....++.+.
T Consensus         1 ik~i~~D~DGtL~~~~~~~~~~~~~l~~l~~~g~~~~~~T~r~~~~~~~~~~~l~~lg~~~~~~~i~~~~~~~~~~l~~~   80 (263)
T 1zjj_A            1 MVAIIFDMDGVLYRGNRAIPGVRELIEFLKERGIPFAFLTNNSTKTPEMYREKLLKMGIDVSSSIIITSGLATRLYMSKH   80 (263)
T ss_dssp             CEEEEEECBTTTEETTEECTTHHHHHHHHHHHTCCEEEEESCCSSCHHHHHHHHHTTTCCCCGGGEEEHHHHHHHHHHHH
T ss_pred             CeEEEEeCcCceEeCCEeCccHHHHHHHHHHCCCeEEEEeCCCCCCHHHHHHHHHHCCCCCChhhEEecHHHHHHHHHHh
Confidence            36899999999999988899999999999999999999999999999999999999999988899999999999999887


Q ss_pred             CCCCCeEEEEeCcchHHHHHHcCCcccccCCCCCCCCCCCcccccccCCCCCccEEEEeccCCCChhhHHHHHHHhhCCC
Q psy7233         175 LDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPN  254 (383)
Q Consensus       175 ~~~~~~~~~ig~~~l~~~l~~~gi~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~Vv~g~~~~~~~~~l~~~l~~L~~~g  254 (383)
                       .++.+++++|.+++.+.+++.|++.....++.       .+      ..+.+++|++|++....|+++.+++..|+ +|
T Consensus        81 -~~~~~v~viG~~~l~~~l~~~G~~~~~~~~~~-------~~------~~~~~~~v~~g~~~~~~~~~~~~~l~~L~-~g  145 (263)
T 1zjj_A           81 -LDPGKIFVIGGEGLVKEMQALGWGIVTLDEAR-------QG------SWKEVKHVVVGLDPDLTYEKLKYATLAIR-NG  145 (263)
T ss_dssp             -SCCCCEEEESCHHHHHHHHHHTSCBCCHHHHH-------TT------GGGGCCEEEECCCTTCBHHHHHHHHHHHH-TT
T ss_pred             -CCCCEEEEEcCHHHHHHHHHcCCeeccCCccc-------cc------ccCCCCEEEEecCCCCCHHHHHHHHHHHH-CC
Confidence             56788999999999999999999765200000       00      01236789999999999999999999999 79


Q ss_pred             CEEEEecCCCCCCCCCCccccCcchHHHHHHHhcCCCccccCCCCHHHHHHHHHHcCCCCCcEEEEecCchhhHHHHHHc
Q psy7233         255 TLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREPVVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIRLGYNN  334 (383)
Q Consensus       255 ~~~i~tn~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~gKP~p~~~~~al~~lgi~p~e~l~IGDs~~~DI~~A~~a  334 (383)
                      .++++||++..++.... ...+.+.+..+|+.+.+.++...+||+|.+|+.++++  ++|++++||||++.+||.+|+++
T Consensus       146 ~~~i~tn~~~~~~~~~~-~l~~~~~l~~~~~~~~~~~~~~~~KP~~~~~~~~~~~--~~~~~~~~VGD~~~~Di~~A~~a  222 (263)
T 1zjj_A          146 ATFIGTNPDATLPGEEG-IYPGAGSIIAALKVATNVEPIIIGKPNEPMYEVVREM--FPGEELWMVGDRLDTDIAFAKKF  222 (263)
T ss_dssp             CEEEESCCCSEEEETTE-EEECHHHHHHHHHHHHCCCCEECSTTSHHHHHHHHHH--STTCEEEEEESCTTTHHHHHHHT
T ss_pred             CEEEEECCCccccCCCC-CcCCcHHHHHHHHHHhCCCccEecCCCHHHHHHHHHh--CCcccEEEECCChHHHHHHHHHc
Confidence            99999999887663223 3344477889999999988888999999999999999  99999999999976999999999


Q ss_pred             CCcEEEEcCCCCChHHHHhcccccchhhcCCCccEEeCCHhhHHHhhhC
Q psy7233         335 GFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLSS  383 (383)
Q Consensus       335 Gl~tv~V~~G~~~~~~~~~~~~~~~~~~~~~~pd~vi~sl~eL~~~l~~  383 (383)
                      |+++++|.+|.+..+++...         ...|+++++++.+|.++|++
T Consensus       223 G~~~i~v~~g~~~~~~~~~~---------~~~p~~~~~~l~el~~~l~~  262 (263)
T 1zjj_A          223 GMKAIMVLTGVSSLEDIKKS---------EYKPDLVLPSVYELIDYLKT  262 (263)
T ss_dssp             TCEEEEESSSSCCHHHHTTC---------SSCCSEEESSGGGGGGGGC-
T ss_pred             CCeEEEECCCCCChHHHHhc---------CCCCCEEECCHHHHHHHHhh
Confidence            99999999998877665531         24799999999999998763



>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 383
d1vjra_261 c.108.1.14 (A:) Hypothetical protein TM1742 {Therm 4e-43
d1wvia_253 c.108.1.14 (A:) Putative phosphatase SMU.1415c {St 3e-42
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 1e-37
d2c4na1250 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId 2e-35
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 1e-05
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 1e-05
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 5e-04
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 0.003
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 0.004
d2o2xa1209 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 0.004
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NagD-like
domain: Hypothetical protein TM1742
species: Thermotoga maritima [TaxId: 2336]
 Score =  149 bits (375), Expect = 4e-43
 Identities = 72/292 (24%), Positives = 140/292 (47%), Gaps = 35/292 (11%)

Query: 91  FLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKH 150
            L+  +  + D DG  +L++ L+ G+ + + +LK   K+  + TNNS+   +  + KL++
Sbjct: 3   VLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRN 62

Query: 151 LGFNAEPNEIIGTAYLAAQYLKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIP 210
           +G +   + ++ +  + A+++ K    + + +++G+  +       G             
Sbjct: 63  MGVDVPDDAVVTSGEITAEHMLKRF-GRCRIFLLGTPQLKKVFEAYGHVID--------- 112

Query: 211 GRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYLTNPNTLFVATNTDESFPMGP 270
                        + +   VV+GFD  +++ +L KA   L      ++AT+ D + P   
Sbjct: 113 -------------EENPDFVVLGFDKTLTYERLKKACILL-RKGKFYIATHPDINCPSK- 157

Query: 271 HVTVPGTGSMVAAVKTGAQREPVVIGK-PSKLIGSYLIEKYNLNPERTLMIGDRGNTDIR 329
              VP  GS++AA++    R+P +I   P+ L+   + EK+ +  ER  M+GDR  TD++
Sbjct: 158 EGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVK 217

Query: 330 LGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFL 381
           LG N G  ++LVLTG+TT          ED E      D+   +LG++   +
Sbjct: 218 LGKNAGIVSILVLTGETT---------PEDLERAETKPDFVFKNLGELAKAV 260


>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query383
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 100.0
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 100.0
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 100.0
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 100.0
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.88
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.87
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.87
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.87
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.87
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.85
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.84
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.84
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.83
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.83
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.83
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.82
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.81
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.8
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.8
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.76
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.75
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.73
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.72
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.71
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.68
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.66
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.66
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.48
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.36
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.35
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.34
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.32
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.31
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 99.25
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.24
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.18
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.18
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.17
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.15
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.14
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.08
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.03
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.99
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.89
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.81
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 98.72
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.6
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.36
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.35
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.89
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 97.87
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.84
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.2
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 96.76
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 95.14
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 94.98
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 93.34
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 90.49
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 90.37
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 89.07
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 86.84
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 86.56
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 86.04
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 83.67
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 83.51
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 81.99
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NagD-like
domain: Hypothetical protein TM1742
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=3.7e-39  Score=299.68  Aligned_cols=258  Identities=28%  Similarity=0.517  Sum_probs=225.2

Q ss_pred             hhcCCCEEEEecCCceecCCccChhHHHHHHHHHHcCceEEEEcCCCCCCHHHHHHHHHhcCCCCCcCcccchHHHHHHH
Q psy7233          91 FLNSFDTVLTDCDGVLWLENELISGADQVMNSLKSLGKKIFYVTNNSTKTREQLIVKLKHLGFNAEPNEIIGTAYLAAQY  170 (383)
Q Consensus        91 ~~~~~kaViFDlDGTL~d~~~~~p~A~eal~~l~~~Gi~v~ivTn~~~~~~~~~~~~L~~lG~~i~~~~i~~s~~~~~~~  170 (383)
                      ++++||+|+||+||||+++..++|+|.++++.++++|++++++||+++++..++.+.+..+|+++.++++++++.....+
T Consensus         3 ~~~~ik~vlFDlDGTL~~~~~~i~~a~e~l~~l~~~g~~~~~~TN~~~~~~~~~~~~~~~~g~~~~~~~v~ts~~~~~~~   82 (261)
T d1vjra_           3 VLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEH   82 (261)
T ss_dssp             GGGGCCEEEECCBTTTEETTEECTTHHHHHHHHHHTTCEEEEEESCTTSCHHHHHHHHHHTTCCCCGGGEEEHHHHHHHH
T ss_pred             hHHhCCEEEEeCCCeeEECCccCchHHHHHHHHHHcCCCEEEEeCCCCCCHHHHHHHHHhhccccccceeccHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCeEEEEeCcchHHHHHHcCCcccccCCCCCCCCCCCcccccccCCCCCccEEEEeccCCCChhhHHHHHHHh
Q psy7233         171 LKKHLDPKKKAYIVGSSGIADELNLAGIENFGVGPDVMIPGRDLKTDHEKLNLDPHVGAVVVGFDSHISFPKLMKAACYL  250 (383)
Q Consensus       171 l~~~~~~~~~~~~ig~~~l~~~l~~~gi~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~Vv~g~~~~~~~~~l~~~l~~L  250 (383)
                      +.+. ....++++.+...+...+...+....                      ......++.+....+.|......+...
T Consensus        83 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (261)
T d1vjra_          83 MLKR-FGRCRIFLLGTPQLKKVFEAYGHVID----------------------EENPDFVVLGFDKTLTYERLKKACILL  139 (261)
T ss_dssp             HHHH-HCSCEEEEESCHHHHHHHHHTTCEEC----------------------SSSCSEEEECCCTTCCHHHHHHHHHHH
T ss_pred             HHHh-cCCceEEEecccchhHHHHhcCcccc----------------------hhhcceeEecCCcccchHHHHHHHHHh
Confidence            8876 56678899999999999988876654                      334566778888888887766666544


Q ss_pred             hCCCCEEEEecCCCCCCCCCCccccCcchHHHHHHHhcCCCc-cccCCCCHHHHHHHHHHcCCCCCcEEEEecCchhhHH
Q psy7233         251 TNPNTLFVATNTDESFPMGPHVTVPGTGSMVAAVKTGAQREP-VVIGKPSKLIGSYLIEKYNLNPERTLMIGDRGNTDIR  329 (383)
Q Consensus       251 ~~~g~~~i~tn~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~-~~~gKP~p~~~~~al~~lgi~p~e~l~IGDs~~~DI~  329 (383)
                      + .+.+++++|+|...+.... ...+.+.+...+....+..+ ...+||+|.+|..+++++|++|++++||||++.+||.
T Consensus       140 ~-~~~~~i~~~~d~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~KP~p~~~~~a~~~l~~~~~~~lmVGD~~~~DI~  217 (261)
T d1vjra_         140 R-KGKFYIATHPDINCPSKEG-PVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVK  217 (261)
T ss_dssp             T-TTCEEEESCCCSEECCTTS-CEECHHHHHHHHHHHHSCCCSEECSTTSTHHHHHHHHHHTCCGGGEEEEESCHHHHHH
T ss_pred             h-cCcceecccCCccccCCCC-cccccchhhHHHhhhcccccccccCCCcHHHHHHHHhhhccCchhcceecCChhHHHH
Confidence            4 5788899999988886554 56777888888887777654 5678999999999999999999999999999889999


Q ss_pred             HHHHcCCcEEEEcCCCCChHHHHhcccccchhhcCCCccEEeCCHhhHHHhhh
Q psy7233         330 LGYNNGFQTLLVLTGDTTMEKAIAWSKSEDEEYKSRVADYYLSSLGDMLPFLS  382 (383)
Q Consensus       330 ~A~~aGl~tv~V~~G~~~~~~~~~~~~~~~~~~~~~~pd~vi~sl~eL~~~l~  382 (383)
                      ||+++|+++|||.+|..+.+++...         ...|||+++|+.||.++|+
T Consensus       218 ga~~aG~~si~V~~G~~~~~~~~~~---------~~~PD~ii~~l~eL~~~l~  261 (261)
T d1vjra_         218 LGKNAGIVSILVLTGETTPEDLERA---------ETKPDFVFKNLGELAKAVQ  261 (261)
T ss_dssp             HHHHHTCEEEEESSSSCCHHHHHHC---------SSCCSEEESSHHHHHHHHC
T ss_pred             HHHHCCCcEEEECCCCCCHHHHhhc---------CCCCCEEECCHHHHHHHhC
Confidence            9999999999999999988876643         5589999999999999885



>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure