Psyllid ID: psy7262

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840

MTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDIERMVNDAEKYKAEDEKQKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWKGGERKKSDKNSTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCNPFE

cccccccccccccccEEEEEccccccccEEEEEEcccccccccccccccEEccccccccccccEEEEEEEEcccccEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHcccEEEHHHHHHHccccccEEEEccccHHHHHHHHHHHHccHHHccccccccccccccEEcccccEEEEEEEccEEEEEEccccccccccEEEEccccccccHHHHHHccccccccccccccccccccccHHHHHcccccccEEEccccccEEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHcccccccEEEcccccEEccEEEEEcccccHHHHHHcccccccccccEEEEccccHHHHHHHcccccccccccccccEEEEEEccccccccccccccccEEcccccccEEEEEccccccccccHHHHcccccccccccccccEEEccccccccccHHHHccccEEEEccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHccccccccccccHHHHHccEEEEEEEccccccccccEEEEEcccccccEEEcccEEEEEccccEEEEEEEEcccc

EEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcccccccEEEccEEEcccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEcccHHHHHcHcccccccccccccccEEEEEccccEEEEEEEEccEEEEcccccccccEEccEEEccccEEEcHHHHccccccHHHEEccHHHccccccccHHHHHHHHHcccEEEEEccEEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccccccccEEEEEEEEccccEEEEEEEEEccEEEccccEEEEEEEEccccEEEEEEEEEcHHHHHHHcccEEEEEEEEEccccEEEEEEEEEccEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHccEEEEEcHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccHHHHHcccccEccccEEEEEcccEHcEcccccccccccccEEcc

mtalikrnttiptkqtqtfttysdnqpgvLIQVYEgeramtkdnnllgkfeltsippaprgvpqievtfdidangiLNVTAIEKstgkenkititndrgrlskEDIERMVNDAEKYKAEDEKQKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPiitklyqgsggapvqpfttTQVLCSKLftfhqfypksscflhnfnivghssdanfesfwkggerkksdknsTDLFLEVLANVIKRQKFLVTYLLKSfacgpedyifdksasltiVDQKFYRSQQLKCFAQnfshftnfipshpvsFITSALQGVFQHGKVEIiandqgnrttpsyvaftdteRLIGdaaknqvamnpnntifdakrligrkfedatvqadmkhwpfevvsdggkpkikveykgeaktffpeEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVitvpayfndsqrqatkdsgtiaGLNVLRIINEPTAAAIAYGLdkkvgstagsgerNVLIFDlgggtfdvsILTIEdgifegsgerNVLIFDlgggtfdvsILTIeeyfplrswgsgernVLIFDlgggtfdvsILTIEDGIFEvkstagdthlggedfdnRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRtlssstqasiEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFfngkelnksinpdeAVAYGAAVQAAILhgdkseevqdlllldvtplslgietaggvsysqSQLGWLLIFYVCNPFE

mtalikrnttiptkqtqtfttysdnqpgVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTaiekstgkenkititndrgrlskedIERMVNDAekykaedekqkAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWKGgerkksdknsTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVeiiandqgnrttPSYVAFTDTERLIGDaaknqvamnpnnTIFDAKRLIGRKFEDAtvqadmkhwpfevvsdggkpKIKVEykgeaktffpeevSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFkrkykkdlttnkralRRLRTACErakrtlssstqasieidslfEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIvlvggstriPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCNPFE

MTALIKRNttiptkqtqtfttYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDIERMVNDAEKYKAEDEKQKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWKGGERKKSDKNSTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEavaygaavqaaILHGDKSEEVQDlllldvtplslGIETAGGVSYSQSQLGWLLIFYVCNPFE

******************FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIE****************************************************YCFN******************RTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWK***********TDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTAC*************SIEIDSLFEGVDFYTSITRARFEELNADLFRGTM************DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCN***

MTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDIERMVNDAE****************NSLESYCFNMKS*******************LDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPI************************************SCFLHNFNIVGHSSDANFE***************TDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVG***GSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD**LGGEDFDNRMVNHFVQEFKRKYKK**T***RALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCNP**

MTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDIERMVNDAEKYKAEDEKQKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWKG********NSTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACE***********ASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCNPFE

MTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDIERMVNDAEKYKAEDEKQKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSG***********VLCSKLFTFHQFYPKSSCFLHNFNIVGHSS**N**SFWKG**RK*SDKNSTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQ*F**FTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKV****GSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVC**F*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSxxxxxxxxxxxxxxxxxxxxxKAVISAKNSLESYCFNMKSTVEDEKLKDKISDAERTQILDKCNDVIKWLDANQLAEKEEFEHKQKELEAICNPIITKLYQGSGGAPVQPFTTTQVLCSKLFTFHQFYPKSSCFLHNFNIVGHSSDANFESFWKGGERKKSDKNSTDLFLEVLANVIKRQKFLVTYLLKSFACGPEDYIFDKSASLTIVDQKFYRSQQLKCFAQNFSHFTNFIPSHPVSFITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVSYSQSQLGWLLIFYVCNPFE

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		840
UNIPROTKB\|Q7SX63		634	HSP70 "Heat shock protein 70"	0.261	0.347	0.813	2e-184
UNIPROTKB\|P54652		639	HSPA2 "Heat shock-related 70 k	0.246	0.323	0.838	1.1e-183
UNIPROTKB\|E2QX84		637	HSPA2 "Uncharacterized protein	0.246	0.324	0.838	1.1e-183
UNIPROTKB\|F1SA70		636	LOC100621324 "Uncharacterized	0.246	0.325	0.838	1.1e-183
MGI\|MGI:96243		633	Hspa2 "heat shock protein 2" [	0.246	0.327	0.838	1.1e-183
RGD\|620664		633	Hspa2 "heat shock protein 2" [	0.246	0.327	0.838	1.1e-183
UNIPROTKB\|P34933		636	HSPA2 "Heat shock-related 70 k	0.246	0.325	0.838	2.9e-183
UNIPROTKB\|Q9TUG3		636	HSPA2 "Heat shock-related 70 k	0.246	0.325	0.838	6.1e-183
UNIPROTKB\|P08106		634	P08106 "Heat shock 70 kDa prot	0.261	0.347	0.8	2.3e-181
ZFIN\|ZDB-GENE-040426-1221		647	hsc70 "heat shock cognate 70"	0.260	0.338	0.826	3.6e-174

UNIPROTKB\|Q7SX63 HSP70 "Heat shock protein 70" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

 Score = 914 (326.8 bits), Expect = 2.0e-184, Sum P(2) = 2.0e-184
 Identities = 179/220 (81%), Positives = 192/220 (87%)

Query:   601 SGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 660
             +GE+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFV+EFKRK+
Sbjct:   193 AGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVEEFKRKH 252

Query:   661 KKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADL 720
             K+D+  NKRA+RRLRTACERAKRTLSSSTQASIEIDSLFEG+DFYTSITRARFEELNADL
Sbjct:   253 KRDIAGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADL 312

Query:   721 FRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEXX 780
             FRGT+EPVEK+LRDAK+DK QI +IVLVGGSTRIPK+QKLLQDFFNGKELNKSINPDE  
Sbjct:   313 FRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAV 372

Query:   781 XXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGV 820
                      IL GDKSE VQD           GIETAGGV
Sbjct:   373 AYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGV 412

GO:0005524 "ATP binding" evidence=IEA

GO:0000795 "synaptonemal complex" evidence=IEA

GO:0001673 "male germ cell nucleus" evidence=IEA

GO:0005739 "mitochondrion" evidence=IEA

GO:0007141 "male meiosis I" evidence=IEA

GO:0007286 "spermatid development" evidence=IEA

GO:0031662 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G2/M" evidence=IEA

GO:0036128 "CatSper complex" evidence=IEA

GO:0051861 "glycolipid binding" evidence=IEA

GO:0070194 "synaptonemal complex disassembly" evidence=IEA

GO:0009986 "cell surface" evidence=ISS

GO:0005515 "protein binding" evidence=IPI

GO:0009408 "response to heat" evidence=IDA

UNIPROTKB\|P54652 HSPA2 "Heat shock-related 70 kDa protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QX84 HSPA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SA70 LOC100621324 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:96243 Hspa2 "heat shock protein 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|620664 Hspa2 "heat shock protein 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P34933 HSPA2 "Heat shock-related 70 kDa protein 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9TUG3 HSPA2 "Heat shock-related 70 kDa protein 2" [Capra hircus (taxid:9925)]	Back alignment and assigned GO terms

UNIPROTKB\|P08106 P08106 "Heat shock 70 kDa protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1221 hsc70 "heat shock cognate 70" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		840
PTZ00009		653	PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro	0.0
pfam00012		598	pfam00012, HSP70, Hsp70 protein	0.0
cd10241		374	cd10241, HSPA5-like_NBD, Nucleotide-binding domain	0.0
PRK00290		627	PRK00290, dnaK, molecular chaperone DnaK; Provisio	1e-170
cd10233		376	cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding	1e-151
TIGR02350		595	TIGR02350, prok_dnaK, chaperone protein DnaK	1e-150
cd10233		376	cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding	1e-148
COG0443		579	COG0443, DnaK, Molecular chaperone [Posttranslatio	1e-135
cd11733		377	cd11733, HSPA9-like_NBD, Nucleotide-binding domain	1e-130
cd10228		381	cd10228, HSPA4_like_NDB, Nucleotide-binding domain	1e-128
PTZ00009		653	PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro	1e-123
cd11734		373	cd11734, Ssq1_like_NBD, Nucleotide-binding domain	1e-115
cd10235		339	cd10235, HscC_like_NBD, Nucleotide-binding domain	1e-108
cd10230		388	cd10230, HYOU1-like_NBD, Nucleotide-binding domain	8e-95
PTZ00186		657	PTZ00186, PTZ00186, heat shock 70 kDa precursor pr	8e-94
cd10234		376	cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d	2e-88
pfam00012		598	pfam00012, HSP70, Hsp70 protein	1e-87
cd10170		369	cd10170, HSP70_NBD, Nucleotide-binding domain of t	3e-86
cd10170		369	cd10170, HSP70_NBD, Nucleotide-binding domain of t	3e-80
PRK00290		627	PRK00290, dnaK, molecular chaperone DnaK; Provisio	2e-79
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	3e-79
cd10234		376	cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d	9e-78
CHL00094		621	CHL00094, dnaK, heat shock protein 70	5e-77
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	6e-72
PRK13410		668	PRK13410, PRK13410, molecular chaperone DnaK; Prov	9e-72
TIGR02350		595	TIGR02350, prok_dnaK, chaperone protein DnaK	2e-71
PLN03184		673	PLN03184, PLN03184, chloroplast Hsp70; Provisional	1e-69
CHL00094		621	CHL00094, dnaK, heat shock protein 70	6e-69
PRK13410		668	PRK13410, PRK13410, molecular chaperone DnaK; Prov	7e-69
PRK05183		616	PRK05183, hscA, chaperone protein HscA; Provisiona	1e-66
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	1e-65
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	5e-65
cd11738		383	cd11738, HSPA4L_NBD, Nucleotide-binding domain of	5e-65
cd11737		383	cd11737, HSPA4_NBD, Nucleotide-binding domain of H	6e-64
TIGR01991		599	TIGR01991, HscA, Fe-S protein assembly chaperone H	5e-62
PLN03184		673	PLN03184, PLN03184, chloroplast Hsp70; Provisional	6e-61
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	2e-60
cd10236		355	cd10236, HscA_like_NBD, Nucleotide-binding domain	3e-60
cd11732		377	cd11732, HSP105-110_like_NBD, Nucleotide-binding d	2e-59
COG0443		579	COG0443, DnaK, Molecular chaperone [Posttranslatio	9e-59
cd10238		375	cd10238, HSPA14-like_NBD, Nucleotide-binding domai	3e-58
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	2e-57
PRK05183		616	PRK05183, hscA, chaperone protein HscA; Provisiona	2e-57
CHL00094		621	CHL00094, dnaK, heat shock protein 70	2e-56
cd10237		417	cd10237, HSPA13-like_NBD, Nucleotide-binding domai	7e-55
cd10236		355	cd10236, HscA_like_NBD, Nucleotide-binding domain	6e-53
TIGR01991		599	TIGR01991, HscA, Fe-S protein assembly chaperone H	5e-52
cd10238		375	cd10238, HSPA14-like_NBD, Nucleotide-binding domai	2e-51
cd10232		386	cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma	8e-50
cd10237		417	cd10237, HSPA13-like_NBD, Nucleotide-binding domai	1e-49
PLN03184		673	PLN03184, PLN03184, chloroplast Hsp70; Provisional	3e-47
PRK01433		595	PRK01433, hscA, chaperone protein HscA; Provisiona	3e-47
PRK13410		668	PRK13410, PRK13410, molecular chaperone DnaK; Prov	3e-43
PTZ00186		657	PTZ00186, PTZ00186, heat shock 70 kDa precursor pr	2e-41
cd11739		383	cd11739, HSPH1_NBD, Nucleotide-binding domain of H	3e-41
cd10232		386	cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma	2e-38
cd11739		383	cd11739, HSPH1_NBD, Nucleotide-binding domain of H	2e-36
TIGR01991		599	TIGR01991, HscA, Fe-S protein assembly chaperone H	4e-35
PRK05183		616	PRK05183, hscA, chaperone protein HscA; Provisiona	6e-34
PRK01433		595	PRK01433, hscA, chaperone protein HscA; Provisiona	5e-25
cd10231		415	cd10231, YegD_like, Escherichia coli YegD, a putat	7e-19
cd10229		404	cd10229, HSPA12_like_NBD, Nucleotide-binding domai	5e-10
TIGR00904		333	TIGR00904, mreB, cell shape determining protein, M	9e-07
cd10225		320	cd10225, MreB_like, MreB and similar proteins	4e-06
cd00012		185	cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-	4e-06
TIGR01312		481	TIGR01312, XylB, D-xylulose kinase	4e-06
cd10225		320	cd10225, MreB_like, MreB and similar proteins	3e-05
pfam06723		327	pfam06723, MreB_Mbl, MreB/Mbl protein	3e-05
PRK13928		336	PRK13928, PRK13928, rod shape-determining protein	8e-05
PRK13930		335	PRK13930, PRK13930, rod shape-determining protein	9e-05
COG1077		342	COG1077, MreB, Actin-like ATPase involved in cell	2e-04
PRK15080		267	PRK15080, PRK15080, ethanolamine utilization prote	3e-04
cd10229		404	cd10229, HSPA12_like_NBD, Nucleotide-binding domai	4e-04
cd07809		487	cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup	4e-04
cd11736		468	cd11736, HSPA12B_like_NBD, Nucleotide-binding doma	5e-04
TIGR02529		239	TIGR02529, EutJ, ethanolamine utilization protein	5e-04
COG4820		277	COG4820, EutJ, Ethanolamine utilization protein, p	0.002
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	0.002

>gnl\|CDD\|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional	Back alignment and domain information

 Score =  615 bits (1587), Expect = 0.0
 Identities = 283/473 (59%), Positives = 329/473 (69%), Gaps = 81/473 (17%)

Query: 349 GVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKF 408
           GV+++  VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA NP NT+FDAKRLIGRKF
Sbjct: 19  GVWKNENVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKF 78

Query: 409 EDATVQADMKHWPFEVVSDG-GKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGK 467
           +D+ VQ+DMKHWPF+V + G  KP I+V Y+GE KTF PEE+SSMVL KMKE AE     
Sbjct: 79  DDSVVQSDMKHWPFKVTTGGDDKPMIEVTYQGEKKTFHPEEISSMVLQKMKEIAE----- 133

Query: 468 TVSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYG 527
                   AYLGK V +AV+TVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAIAYG
Sbjct: 134 --------AYLGKQVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG 185

Query: 528 LDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSI 587
           LDKK     G GE+NVLIFDLGGGTFDVS+LTIEDGIFE        +    G T     
Sbjct: 186 LDKK-----GDGEKNVLIFDLGGGTFDVSLLTIEDGIFE--------VKATAGDT----- 227

Query: 588 LTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 647
                                  LGG  FD  ++      F V           +DF  +
Sbjct: 228 ----------------------HLGGEDFDNRLVE-----FCV-----------QDFKRK 249

Query: 648 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 707
                +   +R  ++  T  +RA R L ++           TQA+IEIDSLFEG+D+  +
Sbjct: 250 NRGKDLSSNQRALRRLRTQCERAKRTLSSS-----------TQATIEIDSLFEGIDYNVT 298

Query: 708 ITRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 767
           I+RARFEEL  D FR T++PVEK L+DA MDK  +H++VLVGGSTRIPKVQ L++DFFNG
Sbjct: 299 ISRARFEELCGDYFRNTLQPVEKVLKDAGMDKRSVHEVVLVGGSTRIPKVQSLIKDFFNG 358

Query: 768 KELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGV 820
           KE  KSINPDEAVAYGAAVQAAIL G++S +VQDLLLLDVTPLSLG+ETAGGV
Sbjct: 359 KEPCKSINPDEAVAYGAAVQAAILTGEQSSQVQDLLLLDVTPLSLGLETAGGV 411

Length = 653

>gnl\|CDD\|215656 pfam00012, HSP70, Hsp70 protein	Back alignment and domain information

>gnl\|CDD\|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins	Back alignment and domain information

>gnl\|CDD\|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins	Back alignment and domain information

>gnl\|CDD\|233830 TIGR02350, prok_dnaK, chaperone protein DnaK	Back alignment and domain information

>gnl\|CDD\|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins	Back alignment and domain information

>gnl\|CDD\|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins	Back alignment and domain information

>gnl\|CDD\|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional	Back alignment and domain information

>gnl\|CDD\|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins	Back alignment and domain information

>gnl\|CDD\|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>gnl\|CDD\|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins	Back alignment and domain information

>gnl\|CDD\|215656 pfam00012, HSP70, Hsp70 protein	Back alignment and domain information

>gnl\|CDD\|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family	Back alignment and domain information

>gnl\|CDD\|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family	Back alignment and domain information

>gnl\|CDD\|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|233830 TIGR02350, prok_dnaK, chaperone protein DnaK	Back alignment and domain information

>gnl\|CDD\|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|235360 PRK05183, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L	Back alignment and domain information

>gnl\|CDD\|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4	Back alignment and domain information

>gnl\|CDD\|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA	Back alignment and domain information

>gnl\|CDD\|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins	Back alignment and domain information

>gnl\|CDD\|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|235360 PRK05183, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins	Back alignment and domain information

>gnl\|CDD\|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA	Back alignment and domain information

>gnl\|CDD\|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins	Back alignment and domain information

>gnl\|CDD\|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins	Back alignment and domain information

>gnl\|CDD\|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional	Back alignment and domain information

>gnl\|CDD\|234955 PRK01433, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>gnl\|CDD\|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1	Back alignment and domain information

>gnl\|CDD\|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins	Back alignment and domain information

>gnl\|CDD\|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1	Back alignment and domain information

>gnl\|CDD\|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA	Back alignment and domain information

>gnl\|CDD\|235360 PRK05183, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|234955 PRK01433, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins	Back alignment and domain information

>gnl\|CDD\|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins	Back alignment and domain information

>gnl\|CDD\|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family	Back alignment and domain information

>gnl\|CDD\|212668 cd10225, MreB_like, MreB and similar proteins	Back alignment and domain information

>gnl\|CDD\|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily	Back alignment and domain information

>gnl\|CDD\|233354 TIGR01312, XylB, D-xylulose kinase	Back alignment and domain information

>gnl\|CDD\|212668 cd10225, MreB_like, MreB and similar proteins	Back alignment and domain information

>gnl\|CDD\|115385 pfam06723, MreB_Mbl, MreB/Mbl protein	Back alignment and domain information

>gnl\|CDD\|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional	Back alignment and domain information

>gnl\|CDD\|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional	Back alignment and domain information

>gnl\|CDD\|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional	Back alignment and domain information

>gnl\|CDD\|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins	Back alignment and domain information

>gnl\|CDD\|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases	Back alignment and domain information

>gnl\|CDD\|212686 cd11736, HSPA12B_like_NBD, Nucleotide-binding domain of HSPA12B and similar proteins	Back alignment and domain information

>gnl\|CDD\|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein	Back alignment and domain information

>gnl\|CDD\|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		840
KOG0100\|consensus		663		100.0
PTZ00009		653	heat shock 70 kDa protein; Provisional	100.0
PTZ00186		657	heat shock 70 kDa precursor protein; Provisional	100.0
PRK13410		668	molecular chaperone DnaK; Provisional	100.0
PTZ00400		663	DnaK-type molecular chaperone; Provisional	100.0
PRK13411		653	molecular chaperone DnaK; Provisional	100.0
PRK00290		627	dnaK molecular chaperone DnaK; Provisional	100.0
PLN03184		673	chloroplast Hsp70; Provisional	100.0
TIGR02350		595	prok_dnaK chaperone protein DnaK. Members of this	100.0
TIGR01991		599	HscA Fe-S protein assembly chaperone HscA. The Hea	100.0
CHL00094		621	dnaK heat shock protein 70	100.0
PRK05183		616	hscA chaperone protein HscA; Provisional	100.0
PF00012		602	HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho	100.0
KOG0101\|consensus		620		100.0
COG0443		579	DnaK Molecular chaperone [Posttranslational modifi	100.0
PRK01433		595	hscA chaperone protein HscA; Provisional	100.0
KOG0102\|consensus		640		100.0
KOG0103\|consensus		727		100.0
KOG0104\|consensus		902		100.0
PRK11678		450	putative chaperone; Provisional	100.0
KOG0100\|consensus		663		100.0
PRK13928		336	rod shape-determining protein Mbl; Provisional	100.0
PRK13929		335	rod-share determining protein MreBH; Provisional	100.0
PRK13927		334	rod shape-determining protein MreB; Provisional	100.0
TIGR00904		333	mreB cell shape determining protein, MreB/Mrl fami	99.97
PRK13930		335	rod shape-determining protein MreB; Provisional	99.97
KOG0101\|consensus		620		99.96
PTZ00009		653	heat shock 70 kDa protein; Provisional	99.96
PF06723		326	MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba	99.96
PRK13411		653	molecular chaperone DnaK; Provisional	99.95
PTZ00400		663	DnaK-type molecular chaperone; Provisional	99.95
PRK13410		668	molecular chaperone DnaK; Provisional	99.94
PLN03184		673	chloroplast Hsp70; Provisional	99.94
COG1077		342	MreB Actin-like ATPase involved in cell morphogene	99.94
PTZ00186		657	heat shock 70 kDa precursor protein; Provisional	99.93
PRK00290		627	dnaK molecular chaperone DnaK; Provisional	99.93
CHL00094		621	dnaK heat shock protein 70	99.93
TIGR02529		239	EutJ ethanolamine utilization protein EutJ family	99.93
TIGR02350		595	prok_dnaK chaperone protein DnaK. Members of this	99.93
PRK05183		616	hscA chaperone protein HscA; Provisional	99.92
TIGR01991		599	HscA Fe-S protein assembly chaperone HscA. The Hea	99.92
PRK01433		595	hscA chaperone protein HscA; Provisional	99.91
KOG0102\|consensus		640		99.9
PRK15080		267	ethanolamine utilization protein EutJ; Provisional	99.89
PF00012		602	HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho	99.85
COG0443		579	DnaK Molecular chaperone [Posttranslational modifi	99.8
TIGR01174		371	ftsA cell division protein FtsA. This bacterial ce	99.8
PRK09472		420	ftsA cell division protein FtsA; Reviewed	99.79
KOG0103\|consensus		727		99.78
COG0849		418	ftsA Cell division ATPase FtsA [Cell division and	99.66
KOG0104\|consensus		902		99.51
cd00012		371	ACTIN Actin; An ubiquitous protein involved in the	99.47
smart00268		373	ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki	99.38
PRK13917		344	plasmid segregation protein ParM; Provisional	99.33
COG4820		277	EutJ Ethanolamine utilization protein, possible ch	99.33
TIGR03739		320	PRTRC_D PRTRC system protein D. A novel genetic sy	99.18
PTZ00280		414	Actin-related protein 3; Provisional	99.13
PF00022		393	Actin: Actin; InterPro: IPR004000 Actin [, ] is a	99.04
PF06406		318	StbA: StbA protein; InterPro: IPR009440 This entry	98.95
PTZ00004		378	actin-2; Provisional	98.91
PTZ00452		375	actin; Provisional	98.9
PTZ00281		376	actin; Provisional	98.89
PTZ00466		380	actin-like protein; Provisional	98.8
TIGR01175		348	pilM type IV pilus assembly protein PilM. This pro	98.77
PF11104		340	PilM_2: Type IV pilus assembly protein PilM;; PDB:	98.58
PF07520		1002	SrfB: Virulence factor SrfB; InterPro: IPR009216 T	98.54
TIGR03192		293	benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s	98.18
KOG0679\|consensus		426		98.14
COG5277		444	Actin and related proteins [Cytoskeleton]	98.05
TIGR00241		248	CoA_E_activ CoA-substrate-specific enzyme activase	97.97
COG4457		1014	SrfB Uncharacterized protein conserved in bacteria	97.79
PRK10719		475	eutA reactivating factor for ethanolamine ammonia	97.7
PF08841		332	DDR: Diol dehydratase reactivase ATPase-like domai	97.59
COG4972		354	PilM Tfp pilus assembly protein, ATPase PilM [Cell	97.53
COG1924		396	Activator of 2-hydroxyglutaryl-CoA dehydratase (HS	97.08
TIGR02261		262	benz_CoA_red_D benzoyl-CoA reductase, bcr type, su	97.03
TIGR03286		404	methan_mark_15 putative methanogenesis marker prot	96.91
TIGR02259		432	benz_CoA_red_A benzoyl-CoA reductase, bcr type, su	96.88
PF01968		290	Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr	96.6
KOG0676\|consensus		372		96.6
PF02782		198	FGGY_C: FGGY family of carbohydrate kinases, C-ter	96.29
KOG0797\|consensus		618		95.65
TIGR01315		541	5C_CHO_kinase FGGY-family pentulose kinase. This m	95.38
PLN02669		556	xylulokinase	95.24
PRK15027		484	xylulokinase; Provisional	95.22
KOG0680\|consensus		400		95.08
PRK13317		277	pantothenate kinase; Provisional	94.66
PRK00047		498	glpK glycerol kinase; Provisional	94.34
COG1069		544	AraB Ribulose kinase [Energy production and conver	94.31
PRK04123		548	ribulokinase; Provisional	94.21
PTZ00294		504	glycerol kinase-like protein; Provisional	94.18
TIGR02628		465	fuculo_kin_coli L-fuculokinase. Members of this fa	94.16
TIGR01234		536	L-ribulokinase L-ribulokinase. This enzyme catalyz	94.11
TIGR01311		493	glycerol_kin glycerol kinase. This model describes	94.09
PRK10331		470	L-fuculokinase; Provisional	94.03
TIGR01312		481	XylB D-xylulose kinase. D-xylulose kinase (XylB) g	94.0
KOG2517\|consensus		516		94.0
PF06277		473	EutA: Ethanolamine utilisation protein EutA; Inter	93.55
TIGR01314		505	gntK_FGGY gluconate kinase, FGGY type. Gluconate i	93.45
TIGR02627		454	rhamnulo_kin rhamnulokinase. This model describes	93.45
PLN02295		512	glycerol kinase	93.39
PRK10939		520	autoinducer-2 (AI-2) kinase; Provisional	92.98
PRK10640		471	rhaB rhamnulokinase; Provisional	92.72
KOG2531\|consensus		545		92.51
PLN02666		1275	5-oxoprolinase	91.89
COG1070		502	XylB Sugar (pentulose and hexulose) kinases [Carbo	91.12
KOG0681\|consensus		645		91.09
PF01869		271	BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In	88.93
PF14450		120	FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B	87.65
KOG0677\|consensus		389		87.47
COG4819		473	EutA Ethanolamine utilization protein, possible ch	84.12
TIGR00555		279	panK_eukar pantothenate kinase, eukaryotic/staphyl	83.43
PRK11031		496	guanosine pentaphosphate phosphohydrolase; Provisi	82.28
COG0554		499	GlpK Glycerol kinase [Energy production and conver	82.12
PF07318		343	DUF1464: Protein of unknown function (DUF1464); In	82.05
COG0248		492	GppA Exopolyphosphatase [Nucleotide transport and	80.9
PRK10854		513	exopolyphosphatase; Provisional	80.59

>KOG0100\|consensus	Back alignment and domain information

Probab=100.00  E-value=7.3e-76  Score=606.17  Aligned_cols=411  Identities=66%  Similarity=1.013  Sum_probs=391.0

Q ss_pred             cCCCcccc-ccceEEEEEEECCeEEEEEcCCCCcccceEEEeeCCcEEEcHHHHHHHHhCcCchhhhhhHhcCCCCCChH
Q psy7262         334 FIPSHPVS-FITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDAT  412 (840)
Q Consensus       334 ~~~~~gID-GtT~s~va~~~~g~~~ii~~~~g~~~iPS~V~f~~~~~~~G~~A~~~~~~~p~~~i~~~K~llg~~~~~~~  412 (840)
                      ..-+|||| |||||||+++.+|+++||.|++|+|.+||.|+|.+++|++|+.|..++..||++++.+.|||+|+.+++..
T Consensus        35 ~gtvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~~  114 (663)
T KOG0100|consen   35 LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDKS  114 (663)
T ss_pred             cceEEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccceechHHHhCcccCChh
Confidence            45689999 99999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcccCCeeEeecCCcceEEEEEc-CcceeeCHHHHHHHHHHHHHHHHHHHhCCccchhhhhhccCCccceEEEeeCC
Q psy7262         413 VQADMKHWPFEVVSDGGKPKIKVEYK-GEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPA  491 (840)
Q Consensus       413 ~~~~~~~~p~~~~~~~~~~~~~v~~~-~~~~~~~~~ev~a~~L~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~vVitVPa  491 (840)
                      +|.+.+.+||.+++.++++++.|... |+.+.++|+++.+|+|..+++.|+.++|..+             .++|+|||+
T Consensus       115 vq~Dik~~Pfkvv~k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv-------------~~AVvTvPA  181 (663)
T KOG0100|consen  115 VQKDIKFLPFKVVNKDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKV-------------THAVVTVPA  181 (663)
T ss_pred             hhhhhhcCceEEEcCCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcc-------------cceEEecch
Confidence            99999999999999999999999987 5689999999999999999999999999876             899999999


Q ss_pred             CCCHHHHHHHHHHHHHcCCcEEEeecchHHHHHHhhcccccCCCCCCCCceEEEEecCCCceEEEEEeeccCcccCCCCc
Q psy7262         492 YFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGER  571 (840)
Q Consensus       492 ~~~~~~r~~l~~Aa~~AG~~~v~~v~Ep~AAAl~y~~~~~~~~~~~~~~~~vLVvDiGGGTtDis~~~~~~~~~~~~g~~  571 (840)
                      ||++.||++..+|-..||++.+++++||+|||++|+++...      .                                
T Consensus       182 YFNDAQrQATKDAGtIAgLnV~RIiNePTaAAIAYGLDKk~------g--------------------------------  223 (663)
T KOG0100|consen  182 YFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKD------G--------------------------------  223 (663)
T ss_pred             hcchHHHhhhcccceeccceEEEeecCccHHHHHhcccccC------C--------------------------------
Confidence            99999999999999999999999999999999999887652      2                                


Q ss_pred             eeEEEecCCCccccceeeeeecccccCCCCCCceEEEEEcCCceeEEEEEEEeCCeEEEEEeeCCCCCchhhhhhHHHHH
Q psy7262         572 NVLIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH  651 (840)
Q Consensus       572 ~~~~~d~Gg~~~d~~~~~~~~~~p~~~~~~~~~~v~v~D~Gggt~d~s~~~~~~~~~~~~~~~~~~~lGG~~~d~~l~~~  651 (840)
                                                     +++++|||+||||||+|++.+.++.|++++..++.++||++||++.++|
T Consensus       224 -------------------------------EknilVfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm~~  272 (663)
T KOG0100|consen  224 -------------------------------EKNILVFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVMEY  272 (663)
T ss_pred             -------------------------------cceEEEEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHHHH
Confidence                                           3346777777777777777888999999999999999999999999999


Q ss_pred             HHHHHHHhccCCccccHHHHHHHHHHHHHHHHHcCCCCeeEEEEecccCCeeeEEEEehHHHHHHHHHHHHHHHHHHHHH
Q psy7262         652 FVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKS  731 (840)
Q Consensus       652 l~~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~~Ls~~~~~~i~i~~~~~~~~~~~~itr~e~e~~~~~~i~~i~~~i~~~  731 (840)
                      +.+.++++.+.++..+.++..+|+++||+||++||.+.+..+.|+++++|.|++-++||+.|+++--+++...+.+++.+
T Consensus       273 fiklykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSsqhq~riEIeS~fdG~DfSEtLtRAkFEElNmDLFr~TlkPv~kv  352 (663)
T KOG0100|consen  273 FIKLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSSQHQVRIEIESLFDGVDFSETLTRAKFEELNMDLFRKTLKPVQKV  352 (663)
T ss_pred             HHHHHhhhcCCccchhhHHHHHHHHHHHHHHhhhccccceEEeeeeccccccccchhhhhHHHHhhhHHHHHhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCCccCccEEEEEcCCCCcHHHHHHHHhHcCCCcccCCCChhhHHHHHHHHHHHHHcCCCCccccceEEEEeccce
Q psy7262         732 LRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLS  811 (840)
Q Consensus       732 l~~a~~~~~~Id~V~LvGG~s~~p~v~~~l~~~f~~~~v~~~~~p~~aVA~GAal~a~~l~~~~~~~~~~~~~~d~~~~s  811 (840)
                      |+++++...+|+.|+||||++|||-||+.|+++|.+.+.....||++|||+|||.+|..++|  .....++++.|++|++
T Consensus       353 l~Ds~lkKsdideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsG--ee~t~divLLDv~pLt  430 (663)
T KOG0100|consen  353 LEDSDLKKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSG--EEDTGDIVLLDVNPLT  430 (663)
T ss_pred             HhhcCcccccCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhccccc--ccCcCcEEEEeecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999  5677899999999999


Q ss_pred             eEEEeeCCeEEEccccC
Q psy7262         812 LGIETAGGVSYSQSQLG  828 (840)
Q Consensus       812 ~gi~~~~~~~~~~~~~~  828 (840)
                      +|||+.||+|-..++.+
T Consensus       431 lGIETvGGVMTklI~RN  447 (663)
T KOG0100|consen  431 LGIETVGGVMTKLIPRN  447 (663)
T ss_pred             ceeeeecceeeccccCC
Confidence            99999999999888654

>PTZ00009 heat shock 70 kDa protein; Provisional	Back alignment and domain information

>PTZ00186 heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>PRK13410 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PTZ00400 DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>PRK13411 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PRK00290 dnaK molecular chaperone DnaK; Provisional	Back alignment and domain information

>PLN03184 chloroplast Hsp70; Provisional	Back alignment and domain information

>TIGR02350 prok_dnaK chaperone protein DnaK	Back alignment and domain information

>TIGR01991 HscA Fe-S protein assembly chaperone HscA	Back alignment and domain information

>CHL00094 dnaK heat shock protein 70	Back alignment and domain information

>PRK05183 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins	Back alignment and domain information

>KOG0101\|consensus	Back alignment and domain information

>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK01433 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>KOG0102\|consensus	Back alignment and domain information

>KOG0103\|consensus	Back alignment and domain information

>KOG0104\|consensus	Back alignment and domain information

>PRK11678 putative chaperone; Provisional	Back alignment and domain information

>KOG0100\|consensus	Back alignment and domain information

>PRK13928 rod shape-determining protein Mbl; Provisional	Back alignment and domain information

>PRK13929 rod-share determining protein MreBH; Provisional	Back alignment and domain information

>PRK13927 rod shape-determining protein MreB; Provisional	Back alignment and domain information

>TIGR00904 mreB cell shape determining protein, MreB/Mrl family	Back alignment and domain information

>PRK13930 rod shape-determining protein MreB; Provisional	Back alignment and domain information

>KOG0101\|consensus	Back alignment and domain information

>PTZ00009 heat shock 70 kDa protein; Provisional	Back alignment and domain information

>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes	Back alignment and domain information

>PRK13411 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PTZ00400 DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>PRK13410 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PLN03184 chloroplast Hsp70; Provisional	Back alignment and domain information

>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning]	Back alignment and domain information

>PTZ00186 heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>PRK00290 dnaK molecular chaperone DnaK; Provisional	Back alignment and domain information

>CHL00094 dnaK heat shock protein 70	Back alignment and domain information

>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein	Back alignment and domain information

>TIGR02350 prok_dnaK chaperone protein DnaK	Back alignment and domain information

>PRK05183 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>TIGR01991 HscA Fe-S protein assembly chaperone HscA	Back alignment and domain information

>PRK01433 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>KOG0102\|consensus	Back alignment and domain information

>PRK15080 ethanolamine utilization protein EutJ; Provisional	Back alignment and domain information

>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins	Back alignment and domain information

>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01174 ftsA cell division protein FtsA	Back alignment and domain information

>PRK09472 ftsA cell division protein FtsA; Reviewed	Back alignment and domain information

>KOG0103\|consensus	Back alignment and domain information

>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0104\|consensus	Back alignment and domain information

>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton	Back alignment and domain information

>smart00268 ACTIN Actin	Back alignment and domain information

>PRK13917 plasmid segregation protein ParM; Provisional	Back alignment and domain information

>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03739 PRTRC_D PRTRC system protein D	Back alignment and domain information

>PTZ00280 Actin-related protein 3; Provisional	Back alignment and domain information

>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton	Back alignment and domain information

>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA []	Back alignment and domain information

>PTZ00004 actin-2; Provisional	Back alignment and domain information

>PTZ00452 actin; Provisional	Back alignment and domain information

>PTZ00281 actin; Provisional	Back alignment and domain information

>PTZ00466 actin-like protein; Provisional	Back alignment and domain information

>TIGR01175 pilM type IV pilus assembly protein PilM	Back alignment and domain information

>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A	Back alignment and domain information

>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function	Back alignment and domain information

>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit	Back alignment and domain information

>KOG0679\|consensus	Back alignment and domain information

>COG5277 Actin and related proteins [Cytoskeleton]	Back alignment and domain information

>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative	Back alignment and domain information

>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown]	Back alignment and domain information

>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional	Back alignment and domain information

>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ]	Back alignment and domain information

>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism]	Back alignment and domain information

>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D	Back alignment and domain information

>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15	Back alignment and domain information

>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A	Back alignment and domain information

>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3	Back alignment and domain information

>KOG0676\|consensus	Back alignment and domain information

>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related	Back alignment and domain information

>KOG0797\|consensus	Back alignment and domain information

>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase	Back alignment and domain information

>PLN02669 xylulokinase	Back alignment and domain information

>PRK15027 xylulokinase; Provisional	Back alignment and domain information

>KOG0680\|consensus	Back alignment and domain information

>PRK13317 pantothenate kinase; Provisional	Back alignment and domain information

>PRK00047 glpK glycerol kinase; Provisional	Back alignment and domain information

>COG1069 AraB Ribulose kinase [Energy production and conversion]	Back alignment and domain information

>PRK04123 ribulokinase; Provisional	Back alignment and domain information

>PTZ00294 glycerol kinase-like protein; Provisional	Back alignment and domain information

>TIGR02628 fuculo_kin_coli L-fuculokinase	Back alignment and domain information

>TIGR01234 L-ribulokinase L-ribulokinase	Back alignment and domain information

>TIGR01311 glycerol_kin glycerol kinase	Back alignment and domain information

>PRK10331 L-fuculokinase; Provisional	Back alignment and domain information

>TIGR01312 XylB D-xylulose kinase	Back alignment and domain information

>KOG2517\|consensus	Back alignment and domain information

>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon	Back alignment and domain information

>TIGR01314 gntK_FGGY gluconate kinase, FGGY type	Back alignment and domain information

>TIGR02627 rhamnulo_kin rhamnulokinase	Back alignment and domain information

>PLN02295 glycerol kinase	Back alignment and domain information

>PRK10939 autoinducer-2 (AI-2) kinase; Provisional	Back alignment and domain information

>PRK10640 rhaB rhamnulokinase; Provisional	Back alignment and domain information

>KOG2531\|consensus	Back alignment and domain information

>PLN02666 5-oxoprolinase	Back alignment and domain information

>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0681\|consensus	Back alignment and domain information

>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis	Back alignment and domain information

>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T	Back alignment and domain information

>KOG0677\|consensus	Back alignment and domain information

>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type	Back alignment and domain information

>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional	Back alignment and domain information

>COG0554 GlpK Glycerol kinase [Energy production and conversion]	Back alignment and domain information

>PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length	Back alignment and domain information

>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10854 exopolyphosphatase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		840
1yuw_A		554	Heat shock cognate 71 kDa protein; chaperone; 2.60	0.0
1yuw_A		554	Heat shock cognate 71 kDa protein; chaperone; 2.60	1e-100
2kho_A		605	Heat shock protein 70; molecular chaperone, HSP70,	1e-164
2kho_A		605	Heat shock protein 70; molecular chaperone, HSP70,	1e-74
3qfu_A		394	78 kDa glucose-regulated protein homolog; HSP70, K	1e-159
3qfu_A		394	78 kDa glucose-regulated protein homolog; HSP70, K	1e-154
3i33_A		404	Heat shock-related 70 kDa protein 2; protein-ADP c	1e-159
3i33_A		404	Heat shock-related 70 kDa protein 2; protein-ADP c	1e-155
1dkg_D		383	Molecular chaperone DNAK; HSP70, GRPE, nucleotide	1e-153
2v7y_A		509	Chaperone protein DNAK; HSP70, heat shock protein,	1e-152
2v7y_A		509	Chaperone protein DNAK; HSP70, heat shock protein,	1e-66
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	1e-149
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	1e-142
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	1e-103
3dob_A		152	Heat shock 70 kDa protein F44E5.5; structural geno	1e-100
3dob_A		152	Heat shock 70 kDa protein F44E5.5; structural geno	3e-04
3h0x_A		152	78 kDa glucose-regulated protein homolog; structur	2e-99
3h0x_A		152	78 kDa glucose-regulated protein homolog; structur	3e-04
2op6_A		152	Heat shock 70 kDa protein D; HSP70/peptide-binding	1e-97
2op6_A		152	Heat shock 70 kDa protein D; HSP70/peptide-binding	3e-04
4e81_A		219	Chaperone protein DNAK; chaperone; 1.90A {Escheric	1e-78
4e81_A		219	Chaperone protein DNAK; chaperone; 1.90A {Escheric	9e-06
1u00_A		227	HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A	3e-74
1u00_A		227	HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A	2e-04
3n8e_A		182	Stress-70 protein, mitochondrial; beta-sandwich, h	9e-72
3n8e_A		182	Stress-70 protein, mitochondrial; beta-sandwich, h	5e-09
3dqg_A		151	Heat shock 70 kDa protein F; structural genomics,	2e-68
1q5l_A		135	Chaperone protein DNAK; HSP70, chaperone, heat sho	2e-52
1q5l_A		135	Chaperone protein DNAK; HSP70, chaperone, heat sho	2e-08
2p32_A		120	Heat shock 70 kDa protein A; three-helix bundle, c	4e-44
3lof_A		113	Heat shock 70 kDa protein 1; structural genomics,	6e-37
1ud0_A		113	HSC70, 70 kDa heat-shock-like protein; chaperone;	9e-36
3h1q_A		272	Ethanolamine utilization protein EUTJ; ethanolamin	8e-25
2zgy_A		320	Plasmid segregation protein PARM; plasmid partitio	3e-16
4apw_A		329	ALP12; actin-like protein; 19.70A {Clostridium tet	3e-10
4apw_A		329	ALP12; actin-like protein; 19.70A {Clostridium tet	2e-04
2fsj_A		346	Hypothetical protein TA0583; actin homologs, archa	7e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04
3js6_A		355	Uncharacterized PARM protein; partition, segregati	9e-08
3i8b_A		515	Xylulose kinase; strain ATCC 15703 / DSM 20083, 11	2e-06
1jce_A		344	ROD shape-determining protein MREB; MBL, actin, HS	9e-05
2itm_A		484	Xylulose kinase, xylulokinase; ATPase, FGGY kinase	9e-05
3hz6_A		511	Xylulokinase; xylulose, structural genomic, chromo	1e-04
2ych_A		377	Competence protein PILM; cell cycle, type IV pilus	2e-04

>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554	Back alignment and structure

 Score =  796 bits (2058), Expect = 0.0
 Identities = 332/472 (70%), Positives = 361/472 (76%), Gaps = 81/472 (17%)

Query: 349 GVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKF 408
           GVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+F
Sbjct: 19  GVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF 78

Query: 409 EDATVQADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKT 468
           +DA VQ+DMKHWPF VV+D G+PK++VEYKGE K+F+PEEVSSMVLTKMKE AE      
Sbjct: 79  DDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAE------ 132

Query: 469 VSNAVITAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGL 528
                  AYLGKTV+NAV+TVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAIAYGL
Sbjct: 133 -------AYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL 185

Query: 529 DKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNVLIFDLGGGTFDVSIL 588
           DKK        ERNVLIFDLGGGTFDVSILTI  GIFE      V      G T      
Sbjct: 186 DKK-----VGAERNVLIFDLGGGTFDVSILTIAAGIFE------VK--STAGDTH----- 227

Query: 589 TIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM 648
                                 LGG  FD  ++                        N  
Sbjct: 228 ----------------------LGGEDFDNRMV------------------------NHF 241

Query: 649 VNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSI 708
           +  F ++ K    KD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYTSI
Sbjct: 242 IAEFKRKHK----KDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSI 297

Query: 709 TRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 768
           TRARFEELNADLFRGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK+QKLLQDFFNGK
Sbjct: 298 TRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGK 357

Query: 769 ELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGV 820
           ELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLGIETAGGV
Sbjct: 358 ELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGV 409

PyMOL of 1yuw

>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554	Back alignment and structure

>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605	Back alignment and structure

>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605	Back alignment and structure

>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404	Back alignment and structure

>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404	Back alignment and structure

>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383	Back alignment and structure

>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509	Back alignment and structure

>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509	Back alignment and structure

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675	Back alignment and structure

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675	Back alignment and structure

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675	Back alignment and structure

>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152	Back alignment and structure

>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152	Back alignment and structure

>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152	Back alignment and structure

>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152	Back alignment and structure

>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152	Back alignment and structure

>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152	Back alignment and structure

>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219	Back alignment and structure

>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219	Back alignment and structure

>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227	Back alignment and structure

>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227	Back alignment and structure

>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182	Back alignment and structure

>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182	Back alignment and structure

>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151	Back alignment and structure

>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135	Back alignment and structure

>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135	Back alignment and structure

>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Length = 120	Back alignment and structure

>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Length = 113	Back alignment and structure

>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Length = 113	Back alignment and structure

>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272	Back alignment and structure

>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320	Back alignment and structure

>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329	Back alignment and structure

>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329	Back alignment and structure

>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355	Back alignment and structure

>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515	Back alignment and structure

>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344	Back alignment and structure

>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484	Back alignment and structure

>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511	Back alignment and structure

>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		840
1yuw_A		554	Heat shock cognate 71 kDa protein; chaperone; 2.60	100.0
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	100.0
4b9q_A		605	Chaperone protein DNAK; HET: ATP; 2.40A {Escherich	100.0
2kho_A		605	Heat shock protein 70; molecular chaperone, HSP70,	100.0
3i33_A		404	Heat shock-related 70 kDa protein 2; protein-ADP c	100.0
2v7y_A		509	Chaperone protein DNAK; HSP70, heat shock protein,	100.0
3qfu_A		394	78 kDa glucose-regulated protein homolog; HSP70, K	100.0
4gni_A		409	Putative heat shock protein; HSP70-type ATPase, AT	100.0
1dkg_D		383	Molecular chaperone DNAK; HSP70, GRPE, nucleotide	100.0
1jce_A		344	ROD shape-determining protein MREB; MBL, actin, HS	100.0
4e81_A		219	Chaperone protein DNAK; chaperone; 1.90A {Escheric	100.0
1u00_A		227	HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A	100.0
4b9q_A		605	Chaperone protein DNAK; HET: ATP; 2.40A {Escherich	99.96
3n8e_A		182	Stress-70 protein, mitochondrial; beta-sandwich, h	99.96
2kho_A		605	Heat shock protein 70; molecular chaperone, HSP70,	99.95
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	99.95
3h0x_A		152	78 kDa glucose-regulated protein homolog; structur	99.94
3dob_A		152	Heat shock 70 kDa protein F44E5.5; structural geno	99.94
3dqg_A		151	Heat shock 70 kDa protein F; structural genomics,	99.93
2op6_A		152	Heat shock 70 kDa protein D; HSP70/peptide-binding	99.91
2fsj_A		346	Hypothetical protein TA0583; actin homologs, archa	99.88
2ych_A		377	Competence protein PILM; cell cycle, type IV pilus	99.88
1k8k_A		418	ARP3, actin-like protein 3, actin-2; beta-propelle	99.87
3h1q_A		272	Ethanolamine utilization protein EUTJ; ethanolamin	99.86
4a2a_A		419	Cell division protein FTSA, putative; cell cycle,	99.86
2fxu_A		375	Alpha-actin-1, actin, alpha skeletal muscle; actin	99.85
1yuw_A		554	Heat shock cognate 71 kDa protein; chaperone; 2.60	99.83
2zgy_A		320	Plasmid segregation protein PARM; plasmid partitio	99.77
1q5l_A		135	Chaperone protein DNAK; HSP70, chaperone, heat sho	99.76
2v7y_A		509	Chaperone protein DNAK; HSP70, heat shock protein,	99.74
1k8k_B		394	ARP2, actin-like protein 2; beta-propeller, struct	99.64
3js6_A		355	Uncharacterized PARM protein; partition, segregati	99.52
4ehu_A		276	Activator of 2-hydroxyisocaproyl-COA dehydratase;	99.48
3dwl_A		427	Actin-related protein 3; propellor, actin-binding,	99.28
3lof_A		113	Heat shock 70 kDa protein 1; structural genomics,	99.24
3qb0_A		498	Actin-related protein 4; actin fold, ATP binding,	99.22
4apw_A		329	ALP12; actin-like protein; 19.70A {Clostridium tet	99.19
2p32_A		120	Heat shock 70 kDa protein A; three-helix bundle, c	99.07
2d0o_A		610	DIOL dehydratase-reactivating factor large subunit	99.07
1nbw_A		607	Glycerol dehydratase reactivase alpha subunit; mol	99.02
1ud0_A		113	HSC70, 70 kDa heat-shock-like protein; chaperone;	98.98
4fo0_A		593	Actin-related protein 8; chromatin remodeling, nuc	98.78
1hux_A		270	Activator of (R)-2-hydroxyglutaryl-COA dehydratase	97.75
4am6_A		655	Actin-like protein ARP8; nuclear protein, chromati	97.54
2i7n_A		360	Pantothenate kinase 1; PANK, transferase; HET: ACO	95.91
3l0q_A		554	Xylulose kinase; xlylulose kinase, SGX, PSI, struc	95.59
2itm_A		484	Xylulose kinase, xylulokinase; ATPase, FGGY kinase	95.47
4bc3_A		538	Xylulose kinase; transferase, glucuronate xyluloki	95.4
3hz6_A		511	Xylulokinase; xylulose, structural genomic, chromo	95.24
3ll3_A		504	Gluconate kinase; xylulose kinase, nysgx, ATP, ADP	95.22
3i8b_A		515	Xylulose kinase; strain ATCC 15703 / DSM 20083, 11	95.15
2zf5_O		497	Glycerol kinase; hyperthermophilic archaeon, ATP-b	95.13
2ews_A		287	Pantothenate kinase; PANK, structural genomics, st	94.92
3g25_A		501	Glycerol kinase; IDP00743, ATP-binding, glycerol m	94.6
3jvp_A		572	Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su	94.52
4e1j_A		520	Glycerol kinase; structural genomics, PSI-biology,	94.43
2p3r_A		510	Glycerol kinase; glycerol metabolism, allosteric r	94.4
2dpn_A		495	Glycerol kinase; thermus thermophilus HB8, structu	94.35
3h3n_X		506	Glycerol kinase; ATP-binding, glycerol metabolism,	94.34
3ezw_A		526	Glycerol kinase; glycerol metabolism, allosteric r	94.34
3ifr_A		508	Carbohydrate kinase, FGGY; xylulose kinase, SGX, s	94.23
2d4w_A		504	Glycerol kinase; alpha and beta protein, ribonucle	94.02
2w40_A		503	Glycerol kinase, putative; closed conformation, ma	93.67
2uyt_A		489	Rhamnulokinase; rhamnose degradation, IN-LINE phos	92.9
3cet_A		334	Conserved archaeal protein; Q6M145, MRR63, NESG, X	90.83
1t6c_A		315	Exopolyphosphatase; alpha/beta protein, actin-like	90.35
3h6e_A		482	Carbohydrate kinase, FGGY; novosphingobium aromati	87.72
3cer_A		343	Possible exopolyphosphatase-like protein; NESG, BL	84.84
3mdq_A		315	Exopolyphosphatase; structural genomics, joint cen	84.58

>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A*	Back alignment and structure

Probab=100.00  E-value=5.1e-64  Score=587.05  Aligned_cols=417  Identities=85%  Similarity=1.213  Sum_probs=382.2

Q ss_pred             CCCcccc-ccceEEEEEEECCeEEEEEcCCCCcccceEEEeeCCcEEEcHHHHHHHHhCcCchhhhhhHhcCCCCCChHH
Q psy7262         335 IPSHPVS-FITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATV  413 (840)
Q Consensus       335 ~~~~gID-GtT~s~va~~~~g~~~ii~~~~g~~~iPS~V~f~~~~~~~G~~A~~~~~~~p~~~i~~~K~llg~~~~~~~~  413 (840)
                      ..++||| |||||+||++.+|.+++|+|+.|++++||+|+|+++++++|.+|..++..+|+++++++|+|+|+.+.++.+
T Consensus         4 ~~~iGIDlGTt~s~va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~v   83 (554)
T 1yuw_A            4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVV   83 (554)
T ss_dssp             CCCEEEEECSSEEEEEEECSSSEEECCCTTSCSEEECCEEECSSCEEETHHHHTTTTTCGGGEECCGGGTTTCCSSCSHH
T ss_pred             CCEEEEEeCcccEEEEEEECCEEEEEECCCCCeecceEEEEcCCcEEEcHHHHHhhhhChhhehHhhHHhcCCCCCcHHH
Confidence            3578999 999999999999999999999999999999999988999999999999999999999999999999999888


Q ss_pred             HhhcccCCeeEeecCCcceEEEEEcCcceeeCHHHHHHHHHHHHHHHHHHHhCCccchhhhhhccCCccceEEEeeCCCC
Q psy7262         414 QADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYF  493 (840)
Q Consensus       414 ~~~~~~~p~~~~~~~~~~~~~v~~~~~~~~~~~~ev~a~~L~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~vVitVPa~~  493 (840)
                      +...+.+||.+...++.+.+.+.+.+....++|+++++++|++|++.++.+++..+             .++|||||++|
T Consensus        84 ~~~~~~~p~~v~~~~g~~~~~v~~~~~~~~~sp~ei~a~~L~~lk~~ae~~lg~~v-------------~~~VitVPa~f  150 (554)
T 1yuw_A           84 QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTV-------------TNAVVTVPAYF  150 (554)
T ss_dssp             HHHHTTCSSEEEEETTEEEEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHSSCC-------------CEEEEEECTTC
T ss_pred             HHHhhcCCeEEEecCCceEEEEEECCCceEEcHHHHHHHHHHHHHHHHHHHhCCCC-------------CeEEEEECCCC
Confidence            88889999999877888888899988889999999999999999999999988755             79999999999


Q ss_pred             CHHHHHHHHHHHHHcCCcEEEeecchHHHHHHhhcccccCCCCCCCCceEEEEecCCCceEEEEEeeccCcccCCCCcee
Q psy7262         494 NDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSTAGSGERNVLIFDLGGGTFDVSILTIEDGIFEGSGERNV  573 (840)
Q Consensus       494 ~~~~r~~l~~Aa~~AG~~~v~~v~Ep~AAAl~y~~~~~~~~~~~~~~~~vLVvDiGGGTtDis~~~~~~~~~~~~g~~~~  573 (840)
                      ++.||+++++|++.||++.+.+++||+|||++|+.....     ..+..+||+|+||||+|+|++++.            
T Consensus       151 ~~~qr~a~~~A~~~AGl~~~~li~EP~AAAlay~~~~~~-----~~~~~vlV~D~GgGT~Dvsv~~~~------------  213 (554)
T 1yuw_A          151 NDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKV-----GAERNVLIFDLGGGTFDVSILTIA------------  213 (554)
T ss_dssp             CHHHHHHHHHHHHTTTCEEEEEEEHHHHHHHHTTCSTTC-----SSCEEEEEEEECSSCEEEEEEEEE------------
T ss_pred             CHHHHHHHHHHHHHcCCCeEEEeCcHHHHHHHHHhhccC-----CCCcEEEEEEcCCCeEEEEEEEEc------------
Confidence            999999999999999999999999999999999876532     146789999999999999988653            


Q ss_pred             EEEecCCCccccceeeeeecccccCCCCCCceEEEEEcCCceeEEEEEEEeCCeEEEEEeeCCCCCchhhhhhHHHHHHH
Q psy7262         574 LIFDLGGGTFDVSILTIEEYFPLRSWGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFV  653 (840)
Q Consensus       574 ~~~d~Gg~~~d~~~~~~~~~~p~~~~~~~~~~v~v~D~Gggt~d~s~~~~~~~~~~~~~~~~~~~lGG~~~d~~l~~~l~  653 (840)
                                                                         ++.+++++..++..+||.+||.+|++++.
T Consensus       214 ---------------------------------------------------~g~~~v~a~~g~~~lGG~d~d~~l~~~l~  242 (554)
T 1yuw_A          214 ---------------------------------------------------AGIFEVKSTAGDTHLGGEDFDNRMVNHFI  242 (554)
T ss_dssp             ---------------------------------------------------TTEEEEEEEEEETTCSHHHHHHHHHHHHH
T ss_pred             ---------------------------------------------------CCcEEEEEEeCCCCCCHHHHHHHHHHHHH
Confidence                                                               23456777788899999999999999999


Q ss_pred             HHHHHhccCCccccHHHHHHHHHHHHHHHHHcCCCCeeEEEEecccCCeeeEEEEehHHHHHHHHHHHHHHHHHHHHHHH
Q psy7262         654 QEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLFRGTMEPVEKSLR  733 (840)
Q Consensus       654 ~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~~Ls~~~~~~i~i~~~~~~~~~~~~itr~e~e~~~~~~i~~i~~~i~~~l~  733 (840)
                      ++++++++.++..+++.+.+|+.+||++|+.||......+.++.+.++.++...|+|++|+++++|+++++.++|+++|+
T Consensus       243 ~~~~~~~~~~~~~~~~~~~~l~~~aE~~K~~ls~~~~~~i~i~~~~~g~~~~~~ltr~~~e~l~~~~~~~i~~~i~~~L~  322 (554)
T 1yuw_A          243 AEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALR  322 (554)
T ss_dssp             HHHHHHTSCCTTSCHHHHHHHHHHHHHHHHHHTTSSEEEEEETTCSSSCCEEEEEEHHHHHHHTHHHHHHTTHHHHHHHH
T ss_pred             HHHHHHhCCCcccCHHHHHHHHHHHHHHhhhcccCceEEEEEeeccCCceEEEEEEHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999988888888999999999999999999999999999988888888999999999999999999999999999999


Q ss_pred             HcCCCccCccEEEEEcCCCCcHHHHHHHHhHcCCCcccCCCChhhHHHHHHHHHHHHHcCCCCccccceEEEEeccceeE
Q psy7262         734 DAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLG  813 (840)
Q Consensus       734 ~a~~~~~~Id~V~LvGG~s~~p~v~~~l~~~f~~~~v~~~~~p~~aVA~GAal~a~~l~~~~~~~~~~~~~~d~~~~s~g  813 (840)
                      ++++...+|+.|+||||+|++|+|++.|++.|++.++..+.||++|||+|||++|+.+++...+.++++++.|++|++||
T Consensus       323 ~a~~~~~~i~~VvLvGG~srip~v~~~l~~~f~~~~v~~~~np~~aVA~Gaa~~a~~l~~~~~~~~~~~~~~dv~p~slg  402 (554)
T 1yuw_A          323 DAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLG  402 (554)
T ss_dssp             HTTCCGGGCCEEEEESGGGGCHHHHHHHHHHTTTCCCBCCSCTTTHHHHHHHHHHHHTTSCCCCCTTSSCCCCBCSSCEE
T ss_pred             HcCCChhhCcEEEEECCcccChHHHHHHHHHcCCCccccCCCchhHHHHHHHHHHHHhcCCccccccceEEEEeeeeEEE
Confidence            99999999999999999999999999999999778888899999999999999999999865667788999999999999


Q ss_pred             EEeeCCeEEEccccCceEe
Q psy7262         814 IETAGGVSYSQSQLGWLLI  832 (840)
Q Consensus       814 i~~~~~~~~~~~~~~~~~~  832 (840)
                      +++.+|.+..+++.+..++
T Consensus       403 i~~~~g~~~~li~r~t~iP  421 (554)
T 1yuw_A          403 IETAGGVMTVLIKRNTTIP  421 (554)
T ss_dssp             EEETTTEEEEEECTTCBSS
T ss_pred             EEecCceEEEEEECCCccC
Confidence            9999999988886654443

PyMOL of 1yuw

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A*	Back alignment and structure

>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D	Back alignment and structure

>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli}	Back alignment and structure

>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ...	Back alignment and structure

>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var}	Back alignment and structure

>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1	Back alignment and structure

>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A	Back alignment and structure

>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A	Back alignment and structure

>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1	Back alignment and structure

>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D	Back alignment and structure

>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens}	Back alignment and structure

>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli}	Back alignment and structure

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A*	Back alignment and structure

>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A	Back alignment and structure

>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans}	Back alignment and structure

>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans}	Back alignment and structure

>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A*	Back alignment and structure

>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus}	Back alignment and structure

>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A	Back alignment and structure

>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid}	Back alignment and structure

>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A*	Back alignment and structure

>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ...	Back alignment and structure

>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A*	Back alignment and structure

>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A	Back alignment and structure

>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1	Back alignment and structure

>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B*	Back alignment and structure

>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus}	Back alignment and structure

>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A	Back alignment and structure

>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A	Back alignment and structure

>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani}	Back alignment and structure

>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans}	Back alignment and structure

>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A	Back alignment and structure

>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6	Back alignment and structure

>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1	Back alignment and structure

>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens}	Back alignment and structure

>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5	Back alignment and structure

>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A*	Back alignment and structure

>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A*	Back alignment and structure

>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A*	Back alignment and structure

>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A	Back alignment and structure

>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A*	Back alignment and structure

>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A*	Back alignment and structure

>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A*	Back alignment and structure

>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703}	Back alignment and structure

>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis}	Back alignment and structure

>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14	Back alignment and structure

>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A*	Back alignment and structure

>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti}	Back alignment and structure

>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus}	Back alignment and structure

>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O	Back alignment and structure

>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y*	Back alignment and structure

>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP}	Back alignment and structure

>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A*	Back alignment and structure

>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A*	Back alignment and structure

>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A	Back alignment and structure

>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A*	Back alignment and structure

>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705}	Back alignment and structure

>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		840
d1bupa2		193	c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP	4e-88
d1dkgd2		198	c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP	9e-84
d1bupa1		185	c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas	7e-74
d1dkgd1		183	c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas	9e-66
d1yuwa1		159	b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus	3e-57
d1yuwa1		159	b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus	9e-10
d1dkza2		118	b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI	1e-41
d1dkza2		118	b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI	8e-06
d1ud0a_		84	a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId:	1e-38
d1u00a2		115	b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6	5e-36
d1u00a2		115	b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6	9e-05
d1jcea2		196	c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre	3e-33
d1jcea2		196	c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre	1e-06
d2zgya2		163	c.55.1.1 (A:158-320) Plasmid segregation protein P	6e-27
d2zgya2		163	c.55.1.1 (A:158-320) Plasmid segregation protein P	2e-04
d1dkza1		97	a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId:	2e-23
d2fsja1		161	c.55.1.12 (A:165-325) Hypothetical protein Ta0583	2e-21
d2fsja1		161	c.55.1.12 (A:165-325) Hypothetical protein Ta0583	0.001
d1u00a1		112	a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66)	6e-20
d1jcea1		137	c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB	3e-18
d1e4ft2		191	c.55.1.1 (T:200-390) Cell division protein FtsA {T	4e-05

>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  275 bits (704), Expect = 4e-88
 Identities = 174/190 (91%), Positives = 187/190 (98%)

Query: 602 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 661
            ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+K
Sbjct: 3   AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHK 62

Query: 662 KDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRARFEELNADLF 721
           KD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLF
Sbjct: 63  KDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLF 122

Query: 722 RGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVA 781
           RGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK+QKLLQDFFNGKELNKSINPDEAVA
Sbjct: 123 RGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVA 182

Query: 782 YGAAVQAAIL 791
           YGAAVQAAIL
Sbjct: 183 YGAAVQAAIL 192

PyMOL of d1bupa2

>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198	Back information, alignment and structure

>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185	Back information, alignment and structure

>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183	Back information, alignment and structure

>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159	Back information, alignment and structure

>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159	Back information, alignment and structure

>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118	Back information, alignment and structure

>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118	Back information, alignment and structure

>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 84	Back information, alignment and structure

>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115	Back information, alignment and structure

>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115	Back information, alignment and structure

>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196	Back information, alignment and structure

>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196	Back information, alignment and structure

>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163	Back information, alignment and structure

>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163	Back information, alignment and structure

>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Length = 97	Back information, alignment and structure

>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161	Back information, alignment and structure

>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161	Back information, alignment and structure

>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112	Back information, alignment and structure

>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137	Back information, alignment and structure

>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		840
d1bupa1		185	Heat shock protein 70kDa, ATPase fragment {Cow (Bo	100.0
d1bupa2		193	Heat shock protein 70kDa, ATPase fragment {Cow (Bo	100.0
d1dkgd2		198	Heat shock protein 70kDa, ATPase fragment {Escheri	99.98
d1dkgd1		183	Heat shock protein 70kDa, ATPase fragment {Escheri	99.97
d1yuwa1		159	DnaK {Rat (Rattus norvegicus) [TaxId: 10116]}	99.94
d1dkza2		118	DnaK {Escherichia coli [TaxId: 562]}	99.83
d1u00a2		115	Chaperone protein hscA (Hsc66) {Escherichia coli [	99.83
d1jcea2		196	Prokaryotic actin homolog MreB {Thermotoga maritim	99.74
d1jcea1		137	Prokaryotic actin homolog MreB {Thermotoga maritim	99.71
d1ud0a_		84	DnaK {Rat (Rattus norvegicus) [TaxId: 10116]}	99.47
d2zgya2		163	Plasmid segregation protein ParM {Escherichia coli	99.37
d1e4ft2		191	Cell division protein FtsA {Thermotoga maritima [T	99.29
d1dkza1		97	DnaK {Escherichia coli [TaxId: 562]}	99.06
d1u00a1		112	Chaperone protein hscA (Hsc66) {Escherichia coli [	99.06
d2fsja1		161	Hypothetical protein Ta0583 {Archaeon Thermoplasma	99.02
d2fxua2		225	Actin {Cow (Bos taurus) [TaxId: 9913]}	97.26
d1k8ka2		258	Actin-related protein 3, Arp3 {Cow (Bos taurus) [T	97.23
d1nbwa3		202	ATPase domain of the glycerol dehydratase reactiva	97.03
d1bupa2		193	Heat shock protein 70kDa, ATPase fragment {Cow (Bo	96.91
d2d0oa3		203	Diol dehydratase-reactivating factor large subunit	96.79
d1dkgd2		198	Heat shock protein 70kDa, ATPase fragment {Escheri	96.62
d1huxa_		259	Hydroxyglutaryl-CoA dehydratase component A {Acida	96.6
d1k8kb1		190	Actin-related protein 2, Arp2 {Cow (Bos taurus) [T	96.52
d1r59o2		235	Glycerol kinase {Enterococcus casseliflavus [TaxId	94.7
d2p3ra2		247	Glycerol kinase {Escherichia coli [TaxId: 562]}	94.57
d2i7na2		212	Pantothenate kinase 1, PANK1 {Human (Homo sapiens)	92.01
d2ewsa1		267	Type II pantothenate kinase, CoaW {Staphylococcus	90.74
d1jcea2		196	Prokaryotic actin homolog MreB {Thermotoga maritim	86.35
d1k8ka1		158	Actin-related protein 3, Arp3 {Cow (Bos taurus) [T	85.0
d1t6ca2		180	Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6	82.37

>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=1.5e-33  Score=280.51  Aligned_cols=183  Identities=83%  Similarity=1.207  Sum_probs=173.7

Q ss_pred             CCCcccc-ccceEEEEEEECCeEEEEEcCCCCcccceEEEeeCCcEEEcHHHHHHHHhCcCchhhhhhHhcCCCCCChHH
Q psy7262         335 IPSHPVS-FITSALQGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATV  413 (840)
Q Consensus       335 ~~~~gID-GtT~s~va~~~~g~~~ii~~~~g~~~iPS~V~f~~~~~~~G~~A~~~~~~~p~~~i~~~K~llg~~~~~~~~  413 (840)
                      .+++||| |||||+||++++|+++++++..|++++||+|+|.++++++|..|..++..+|+++++++|+|||+.+.+...
T Consensus         1 g~vvGIDfGTt~s~va~~~~g~~~ii~~~~~~r~~Ps~i~~~~~~~~vG~~a~~~~~~~p~~~i~~~KrllG~~~~~~~~   80 (185)
T d1bupa1           1 GPAVGIDLGSTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVV   80 (185)
T ss_dssp             CCCEEEEECSSEEEEEEEETTEEEECCCTTSCSSEECCEEECSSCEEETHHHHTTTTTCGGGEECCHHHHTTCCTTCHHH
T ss_pred             CCEEEEEcChhcEEEEEEECCEEEEEECCCCCccceeEEEECCCcEEEeechHHHhhcCcccchhHHHHHhCCCCccHHH
Confidence            3689999 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcccCCeeEeecCCcceEEEEEcCcceeeCHHHHHHHHHHHHHHHHHHHhCCccchhhhhhccCCccceEEEeeCCCC
Q psy7262         414 QADMKHWPFEVVSDGGKPKIKVEYKGEAKTFFPEEVSSMVLTKMKETAEAYLGKTVSNAVITAYLGKTVSNAVITVPAYF  493 (840)
Q Consensus       414 ~~~~~~~p~~~~~~~~~~~~~v~~~~~~~~~~~~ev~a~~L~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~vVitVPa~~  493 (840)
                      +.....+|+.+..+.+.....+.+.+....++|++|++++|++|++.++..++.+.             .++|||||++|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~el~a~~l~~l~~~a~~~~~~~~-------------~~~VitvPa~f  147 (185)
T d1bupa1          81 QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTV-------------TNAVVTVPAYF  147 (185)
T ss_dssp             HHHHTTCSSEEEEETTEEEEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHTSCC-------------CEEEEEECTTC
T ss_pred             HHHhhcCCceEEcCCCCccEEEEEcCCceEEcHHHHHHHHHHHHHHHHHHHhCCCc-------------CcEEEEECCCC
Confidence            88889999999988889999999999999999999999999999999999998765             89999999999


Q ss_pred             CHHHHHHHHHHHHHcCCcEEEeecchHHHHHHhhccc
Q psy7262         494 NDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDK  530 (840)
Q Consensus       494 ~~~~r~~l~~Aa~~AG~~~v~~v~Ep~AAAl~y~~~~  530 (840)
                      ++.||++|++||+.|||+.+.|++||+|||++|++++
T Consensus       148 ~~~qr~~~~~Aa~~AGl~~~~li~EP~AAAl~Ygldk  184 (185)
T d1bupa1         148 NDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK  184 (185)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEEEHHHHHHHHTTTTS
T ss_pred             CHHHHHHHHHHHHHcCCCeEEEEcCHHHHHHHhcccC
Confidence            9999999999999999999999999999999998754

PyMOL of d1bupa1

>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]}	Back information, alignment and structure

>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]}	Back information, alignment and structure

>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}	Back information, alignment and structure

>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]}	Back information, alignment and structure

>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]}	Back information, alignment and structure

>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}	Back information, alignment and structure

>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure