Psyllid ID: psy7291
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
No hits with e-value below 0.001 by BLAST
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| ZFIN|ZDB-GENE-040426-2173 | 359 | pdhb "pyruvate dehydrogenase ( | 0.886 | 0.389 | 0.612 | 1e-43 | |
| UNIPROTKB|F1N823 | 360 | PDHB "Uncharacterized protein" | 0.886 | 0.388 | 0.6 | 7.3e-43 | |
| FB|FBgn0039635 | 365 | CG11876 [Drosophila melanogast | 0.873 | 0.378 | 0.620 | 1.5e-42 | |
| UNIPROTKB|E2R268 | 359 | PDHB "Uncharacterized protein" | 0.886 | 0.389 | 0.6 | 2.5e-42 | |
| RGD|1359146 | 359 | Pdhb "pyruvate dehydrogenase ( | 0.886 | 0.389 | 0.593 | 3.2e-42 | |
| UNIPROTKB|P11966 | 359 | PDHB "Pyruvate dehydrogenase E | 0.886 | 0.389 | 0.593 | 5.2e-42 | |
| MGI|MGI:1915513 | 359 | Pdhb "pyruvate dehydrogenase ( | 0.886 | 0.389 | 0.593 | 5.2e-42 | |
| UNIPROTKB|P11177 | 359 | PDHB "Pyruvate dehydrogenase E | 0.886 | 0.389 | 0.580 | 1.1e-41 | |
| UNIPROTKB|Q5RE79 | 359 | PDHB "Pyruvate dehydrogenase E | 0.886 | 0.389 | 0.580 | 1.1e-41 | |
| UNIPROTKB|J9P208 | 341 | J9P208 "Uncharacterized protei | 0.886 | 0.410 | 0.587 | 1.4e-41 |
| ZFIN|ZDB-GENE-040426-2173 pdhb "pyruvate dehydrogenase (lipoamide) beta" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 461 (167.3 bits), Expect = 1.0e-43, P = 1.0e-43
Identities = 95/155 (61%), Positives = 118/155 (76%)
Query: 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQ 60
V+SP+NSEDA+GLLKAAIRD +PVVFLENEL+YGV + M +E SKDFV+PIGKAK+E+Q
Sbjct: 174 VLSPWNSEDARGLLKAAIRDDNPVVFLENELMYGVPFEMSEEVQSKDFVIPIGKAKIERQ 233
Query: 61 GEAFYHLDAPVIRVTGKDITIVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIET 120
G H IT+V HS+ V LDAA +LA +GI+ EVINLRS+RPLD +T
Sbjct: 234 GN---H------------ITLVSHSRMVGLCLDAAAVLAKEGIECEVINLRSIRPLDADT 278
Query: 121 ITKSVMKTNYLISVEGGWPQCGIGSEISARIMEIP 155
I S+ KTN+L++VEGGWPQ G+G+EI ARIME P
Sbjct: 279 IETSITKTNHLVTVEGGWPQFGVGAEILARIMEGP 313
|
|
| UNIPROTKB|F1N823 PDHB "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039635 CG11876 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R268 PDHB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1359146 Pdhb "pyruvate dehydrogenase (lipoamide) beta" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11966 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915513 Pdhb "pyruvate dehydrogenase (lipoamide) beta" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11177 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RE79 PDHB "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P208 J9P208 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| PLN02683 | 356 | PLN02683, PLN02683, pyruvate dehydrogenase E1 comp | 5e-69 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 3e-68 | |
| PTZ00182 | 355 | PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydro | 2e-65 | |
| COG0022 | 324 | COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogena | 3e-59 | |
| PRK09212 | 327 | PRK09212, PRK09212, pyruvate dehydrogenase subunit | 4e-55 | |
| CHL00144 | 327 | CHL00144, odpB, pyruvate dehydrogenase E1 componen | 2e-31 | |
| pfam02780 | 124 | pfam02780, Transketolase_C, Transketolase, C-termi | 4e-30 | |
| cd07036 | 167 | cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PY | 6e-14 | |
| COG3958 | 312 | COG3958, COG3958, Transketolase, C-terminal subuni | 1e-12 | |
| COG1154 | 627 | COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [ | 1e-11 | |
| PRK05444 | 580 | PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate | 1e-10 | |
| TIGR00204 | 617 | TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate syn | 3e-09 | |
| pfam02779 | 172 | pfam02779, Transket_pyr, Transketolase, pyrimidine | 2e-07 | |
| PLN02234 | 641 | PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate | 7e-06 | |
| smart00861 | 136 | smart00861, Transket_pyr, Transketolase, pyrimidin | 9e-06 | |
| PLN02225 | 701 | PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate | 7e-05 | |
| PLN02582 | 677 | PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate | 2e-04 | |
| COG0022 | 324 | COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogena | 3e-04 | |
| PRK12571 | 641 | PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate | 3e-04 | |
| PRK09622 | 407 | PRK09622, porA, pyruvate flavodoxin oxidoreductase | 5e-04 | |
| PRK05899 | 586 | PRK05899, PRK05899, transketolase; Reviewed | 6e-04 | |
| TIGR00232 | 653 | TIGR00232, tktlase_bact, transketolase, bacterial | 0.001 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.004 |
| >gnl|CDD|215368 PLN02683, PLN02683, pyruvate dehydrogenase E1 component subunit beta | Back alignment and domain information |
|---|
Score = 212 bits (541), Expect = 5e-69
Identities = 93/153 (60%), Positives = 113/153 (73%), Gaps = 15/153 (9%)
Query: 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQ 60
V++PY+SEDA+GLLKAAIRDPDPVVFLENELLYG +P+ E L FVLPIGKAK+E++
Sbjct: 168 VLAPYSSEDARGLLKAAIRDPDPVVFLENELLYGESFPVSAEVLDSSFVLPIGKAKIERE 227
Query: 61 GEAFYHLDAPVIRVTGKDITIVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIET 120
GKD+TIV SK V AL AA+ILA +GI AEVINLRS+RPLD +T
Sbjct: 228 ---------------GKDVTIVAFSKMVGYALKAAEILAKEGISAEVINLRSIRPLDRDT 272
Query: 121 ITKSVMKTNYLISVEGGWPQCGIGSEISARIME 153
I SV KTN L++VE GWPQ G+G+EI A ++E
Sbjct: 273 INASVRKTNRLVTVEEGWPQHGVGAEICASVVE 305
|
Length = 356 |
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185502 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223101 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|169719 PRK09212, PRK09212, pyruvate dehydrogenase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177066 CHL00144, odpB, pyruvate dehydrogenase E1 component beta subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217227 pfam02780, Transketolase_C, Transketolase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|132919 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226467 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224076 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235470 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|217226 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|214865 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|177870 PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|178194 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223101 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181999 PRK09622, porA, pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235639 PRK05899, PRK05899, transketolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232887 TIGR00232, tktlase_bact, transketolase, bacterial and yeast | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| COG3958 | 312 | Transketolase, C-terminal subunit [Carbohydrate tr | 99.97 | |
| PLN02683 | 356 | pyruvate dehydrogenase E1 component subunit beta | 99.97 | |
| CHL00144 | 327 | odpB pyruvate dehydrogenase E1 component beta subu | 99.97 | |
| PRK09212 | 327 | pyruvate dehydrogenase subunit beta; Validated | 99.97 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.96 | |
| PTZ00182 | 355 | 3-methyl-2-oxobutanate dehydrogenase; Provisional | 99.96 | |
| COG0022 | 324 | AcoB Pyruvate/2-oxoglutarate dehydrogenase complex | 99.96 | |
| PLN02225 | 701 | 1-deoxy-D-xylulose-5-phosphate synthase | 99.95 | |
| COG1154 | 627 | Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m | 99.95 | |
| TIGR00204 | 617 | dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s | 99.95 | |
| PLN02234 | 641 | 1-deoxy-D-xylulose-5-phosphate synthase | 99.94 | |
| PRK12315 | 581 | 1-deoxy-D-xylulose-5-phosphate synthase; Provision | 99.93 | |
| PLN02582 | 677 | 1-deoxy-D-xylulose-5-phosphate synthase | 99.93 | |
| PRK12571 | 641 | 1-deoxy-D-xylulose-5-phosphate synthase; Provision | 99.92 | |
| KOG0524|consensus | 359 | 99.92 | ||
| PRK05444 | 580 | 1-deoxy-D-xylulose-5-phosphate synthase; Provision | 99.92 | |
| PF02780 | 124 | Transketolase_C: Transketolase, C-terminal domain; | 99.88 | |
| PLN02790 | 654 | transketolase | 99.8 | |
| TIGR00232 | 653 | tktlase_bact transketolase, bacterial and yeast. T | 99.8 | |
| KOG0525|consensus | 362 | 99.79 | ||
| PRK05899 | 624 | transketolase; Reviewed | 99.76 | |
| KOG0523|consensus | 632 | 99.74 | ||
| TIGR03186 | 889 | AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S | 99.74 | |
| PTZ00089 | 661 | transketolase; Provisional | 99.72 | |
| PRK07119 | 352 | 2-ketoisovalerate ferredoxin reductase; Validated | 99.72 | |
| PRK12753 | 663 | transketolase; Reviewed | 99.7 | |
| PRK08659 | 376 | 2-oxoglutarate ferredoxin oxidoreductase subunit a | 99.67 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 99.66 | |
| PRK09627 | 375 | oorA 2-oxoglutarate-acceptor oxidoreductase subuni | 99.66 | |
| PRK09405 | 891 | aceE pyruvate dehydrogenase subunit E1; Reviewed | 99.64 | |
| PRK12754 | 663 | transketolase; Reviewed | 99.61 | |
| PRK09622 | 407 | porA pyruvate flavodoxin oxidoreductase subunit al | 99.55 | |
| TIGR03710 | 562 | OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s | 99.55 | |
| PRK13012 | 896 | 2-oxoacid dehydrogenase subunit E1; Provisional | 99.52 | |
| PRK09404 | 924 | sucA 2-oxoglutarate dehydrogenase E1 component; Re | 99.47 | |
| PRK08366 | 390 | vorA 2-ketoisovalerate ferredoxin oxidoreductase s | 99.41 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 99.4 | |
| PRK08367 | 394 | porA pyruvate ferredoxin oxidoreductase subunit al | 99.37 | |
| TIGR00239 | 929 | 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon | 99.33 | |
| COG0021 | 663 | TktA Transketolase [Carbohydrate transport and met | 99.17 | |
| PRK13030 | 1159 | 2-oxoacid ferredoxin oxidoreductase; Provisional | 99.05 | |
| PRK09193 | 1165 | indolepyruvate ferredoxin oxidoreductase; Validate | 99.02 | |
| PRK13029 | 1186 | 2-oxoacid ferredoxin oxidoreductase; Provisional | 98.97 | |
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 98.91 | |
| COG0674 | 365 | PorA Pyruvate:ferredoxin oxidoreductase and relate | 98.6 | |
| PRK05261 | 785 | putative phosphoketolase; Provisional | 98.24 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 96.66 | |
| TIGR00759 | 885 | aceE pyruvate dehydrogenase E1 component, homodime | 95.93 | |
| KOG0450|consensus | 1017 | 94.72 | ||
| KOG0451|consensus | 913 | 92.39 | ||
| PF09363 | 203 | XFP_C: XFP C-terminal domain; InterPro: IPR018969 | 91.92 | |
| COG0567 | 906 | SucA 2-oxoglutarate dehydrogenase complex, dehydro | 90.62 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 90.5 | |
| COG0075 | 383 | Serine-pyruvate aminotransferase/archaeal aspartat | 89.6 | |
| cd01481 | 165 | vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V | 89.35 | |
| COG2609 | 887 | AceE Pyruvate dehydrogenase complex, dehydrogenase | 89.08 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 88.62 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 87.37 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 87.11 | |
| COG3957 | 793 | Phosphoketolase [Carbohydrate transport and metabo | 86.83 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 85.42 | |
| PF03358 | 152 | FMN_red: NADPH-dependent FMN reductase; InterPro: | 85.3 | |
| COG0680 | 160 | HyaD Ni,Fe-hydrogenase maturation factor [Energy p | 84.43 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 84.32 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 83.92 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 83.78 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 83.59 | |
| PF01855 | 230 | POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta | 83.5 | |
| cd00860 | 91 | ThrRS_anticodon ThrRS Threonyl-anticodon binding d | 83.37 | |
| PRK10853 | 118 | putative reductase; Provisional | 81.46 | |
| cd06062 | 146 | H2MP_MemB-H2up Endopeptidases belonging to membran | 80.84 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 80.76 | |
| cd03412 | 127 | CbiK_N Anaerobic cobalamin biosynthetic cobalt che | 80.72 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 80.71 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 80.08 |
| >COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.4e-31 Score=206.04 Aligned_cols=135 Identities=28% Similarity=0.432 Sum_probs=123.1
Q ss_pred CcccCCHHHHHHHHHHHHhCCCcEEEEecccccccccCCCCcccCCCcccccCceEEEeeccccccCCCcccccCCCcEE
Q psy7291 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQGEAFYHLDAPVIRVTGKDIT 80 (158)
Q Consensus 1 V~~P~d~~e~~~~l~~a~~~~~P~~iR~~~~~~~~~~~~~~~~~~~~~~~~~g~~~vl~~~~~~~~~~~~~~~~~g~~~~ 80 (158)
|++|+|+.+.+++++++.++++|+|+|+.+. ++|+. .....+.|++||+.+|++ |+|++
T Consensus 138 V~~P~D~v~~~~i~~~~~~~~GP~Y~Rl~R~----~~p~~--~~~~~~~F~iGka~vLrd---------------G~D~t 196 (312)
T COG3958 138 VIAPADAVETRAILDQIADYKGPVYMRLGRG----KVPVV--VDEGGYTFEIGKANVLRD---------------GSDLT 196 (312)
T ss_pred EEccCcHHHHHHHHHHHHhcCCCEEEEecCC----CCCce--ecCCCceEeccceeEeec---------------CCceE
Confidence 6899999999999999999999999997543 23321 122357899999999999 99999
Q ss_pred EEEechhHHHHHHHHHHHHhCCCcEEEEEeccccCCCHHHHHHHHhCCCeEEEEeCCcCCCChHHHHHHHHHcCCC
Q psy7291 81 IVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIETITKSVMKTNYLISVEGGWPQCGIGSEISARIMEIPY 156 (158)
Q Consensus 81 ii~~G~~~~~a~ea~~~L~~~gi~~~vi~~~~l~Pld~~~l~~~~~~~~~vvvvEe~~~~GG~g~~i~~~l~~~~~ 156 (158)
||++|.|+..+++|++.|+++||++.|||+.+|||+|++.+.+++++++.|+|+|||+..||+|+.+++.|++++.
T Consensus 197 iiA~G~mv~~al~AA~~L~~~GIsa~Vi~m~tIKPiD~~~i~~~A~~t~~IvT~EeHsi~GGlGsaVAEvlse~~p 272 (312)
T COG3958 197 IIATGVMVAEALEAAEILKKEGISAAVINMFTIKPIDEQAILKAARETGRIVTAEEHSIIGGLGSAVAEVLSENGP 272 (312)
T ss_pred EEecCcchHHHHHHHHHHHhcCCCEEEEecCccCCCCHHHHHHHHhhcCcEEEEecceeecchhHHHHHHHHhcCC
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999986
|
|
| >PLN02683 pyruvate dehydrogenase E1 component subunit beta | Back alignment and domain information |
|---|
| >CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated | Back alignment and domain information |
|---|
| >PRK09212 pyruvate dehydrogenase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02225 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >PLN02234 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02582 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG0524|consensus | Back alignment and domain information |
|---|
| >PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PF02780 Transketolase_C: Transketolase, C-terminal domain; InterPro: IPR005476 Transketolase 2 | Back alignment and domain information |
|---|
| >PLN02790 transketolase | Back alignment and domain information |
|---|
| >TIGR00232 tktlase_bact transketolase, bacterial and yeast | Back alignment and domain information |
|---|
| >KOG0525|consensus | Back alignment and domain information |
|---|
| >PRK05899 transketolase; Reviewed | Back alignment and domain information |
|---|
| >KOG0523|consensus | Back alignment and domain information |
|---|
| >TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00089 transketolase; Provisional | Back alignment and domain information |
|---|
| >PRK07119 2-ketoisovalerate ferredoxin reductase; Validated | Back alignment and domain information |
|---|
| >PRK12753 transketolase; Reviewed | Back alignment and domain information |
|---|
| >PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed | Back alignment and domain information |
|---|
| >PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed | Back alignment and domain information |
|---|
| >PRK12754 transketolase; Reviewed | Back alignment and domain information |
|---|
| >PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional | Back alignment and domain information |
|---|
| >PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed | Back alignment and domain information |
|---|
| >PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component | Back alignment and domain information |
|---|
| >COG0021 TktA Transketolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05261 putative phosphoketolase; Provisional | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type | Back alignment and domain information |
|---|
| >KOG0450|consensus | Back alignment and domain information |
|---|
| >KOG0451|consensus | Back alignment and domain information |
|---|
| >PF09363 XFP_C: XFP C-terminal domain; InterPro: IPR018969 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria | Back alignment and domain information |
|---|
| >COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >COG3957 Phosphoketolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 | Back alignment and domain information |
|---|
| >COG0680 HyaD Ni,Fe-hydrogenase maturation factor [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains | Back alignment and domain information |
|---|
| >cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd06062 H2MP_MemB-H2up Endopeptidases belonging to membrane-bound hydrogenases group | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| 2ozl_B | 341 | PDHE1-B, pyruvate dehydrogenase E1 component subun | 4e-75 | |
| 2ozl_B | 341 | PDHE1-B, pyruvate dehydrogenase E1 component subun | 4e-04 | |
| 1w85_B | 324 | Pyruvate dehydrogenase E1 component, beta subunit; | 2e-54 | |
| 1w85_B | 324 | Pyruvate dehydrogenase E1 component, beta subunit; | 1e-04 | |
| 1umd_B | 324 | E1-beta, 2-OXO acid dehydrogenase beta subunit; al | 7e-54 | |
| 1umd_B | 324 | E1-beta, 2-OXO acid dehydrogenase beta subunit; al | 1e-04 | |
| 1ik6_A | 369 | Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o | 4e-49 | |
| 1ik6_A | 369 | Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o | 5e-04 | |
| 2bfd_B | 342 | 2-oxoisovalerate dehydrogenase beta subunit; oxido | 4e-49 | |
| 2bfd_B | 342 | 2-oxoisovalerate dehydrogenase beta subunit; oxido | 5e-04 | |
| 1qs0_B | 338 | 2-oxoisovalerate dehydrogenase beta-subunit; heter | 5e-47 | |
| 1qs0_B | 338 | 2-oxoisovalerate dehydrogenase beta-subunit; heter | 2e-04 | |
| 2o1x_A | 629 | 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, | 1e-11 | |
| 3mos_A | 616 | Transketolase, TK; thiamin diphosphate TPP THDP en | 2e-11 | |
| 2o1s_A | 621 | 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia | 3e-10 |
| >2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Length = 341 | Back alignment and structure |
|---|
Score = 226 bits (579), Expect = 4e-75
Identities = 88/153 (57%), Positives = 116/153 (75%), Gaps = 15/153 (9%)
Query: 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQ 60
VVSP+NSEDAKGL+K+AIRD +PVV LENEL+YGV + EA SKDF++PIGKAK+E+Q
Sbjct: 156 VVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQ 215
Query: 61 GEAFYHLDAPVIRVTGKDITIVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIET 120
G IT+V HS+ V L+AA +L+ +G++ EVIN+R++RP+D+ET
Sbjct: 216 G---------------THITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMET 260
Query: 121 ITKSVMKTNYLISVEGGWPQCGIGSEISARIME 153
I SVMKTN+L++VEGGWPQ G+G+EI ARIME
Sbjct: 261 IEASVMKTNHLVTVEGGWPQFGVGAEICARIME 293
|
| >2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Length = 341 | Back alignment and structure |
|---|
| >1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Length = 324 | Back alignment and structure |
|---|
| >1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Length = 324 | Back alignment and structure |
|---|
| >1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Length = 324 | Back alignment and structure |
|---|
| >1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Length = 324 | Back alignment and structure |
|---|
| >1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Length = 369 | Back alignment and structure |
|---|
| >1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Length = 369 | Back alignment and structure |
|---|
| >2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Length = 342 | Back alignment and structure |
|---|
| >2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Length = 342 | Back alignment and structure |
|---|
| >1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Length = 338 | Back alignment and structure |
|---|
| >1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Length = 338 | Back alignment and structure |
|---|
| >2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Length = 629 | Back alignment and structure |
|---|
| >3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Length = 616 | Back alignment and structure |
|---|
| >2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Length = 621 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| 2ozl_B | 341 | PDHE1-B, pyruvate dehydrogenase E1 component subun | 99.96 | |
| 1w85_B | 324 | Pyruvate dehydrogenase E1 component, beta subunit; | 99.95 | |
| 1umd_B | 324 | E1-beta, 2-OXO acid dehydrogenase beta subunit; al | 99.95 | |
| 2bfd_B | 342 | 2-oxoisovalerate dehydrogenase beta subunit; oxido | 99.95 | |
| 1ik6_A | 369 | Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o | 99.94 | |
| 1qs0_B | 338 | 2-oxoisovalerate dehydrogenase beta-subunit; heter | 99.94 | |
| 3mos_A | 616 | Transketolase, TK; thiamin diphosphate TPP THDP en | 99.93 | |
| 2o1x_A | 629 | 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, | 99.9 | |
| 2o1s_A | 621 | 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia | 99.9 | |
| 2yic_A | 868 | 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 | 99.82 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 99.82 | |
| 2e6k_A | 651 | Transketolase; structural genomics, NPPSFA, nation | 99.81 | |
| 3rim_A | 700 | Transketolase, TK; TPP, transferase; HET: TPP; 2.4 | 99.81 | |
| 1gpu_A | 680 | Transketolase; transferase(ketone residues); HET: | 99.81 | |
| 3m49_A | 690 | Transketolase; alpha-beta-alpha sandwich, csgid, t | 99.81 | |
| 1itz_A | 675 | Transketolase; calvin cycle, cofactor, thiamine py | 99.81 | |
| 3l84_A | 632 | Transketolase; TKT, structural genomics, center fo | 99.8 | |
| 2r8o_A | 669 | Transketolase 1, TK 1; reaction intermediate, calc | 99.8 | |
| 1r9j_A | 673 | Transketolase; domains, EACH of the alpha/beta typ | 99.79 | |
| 2jgd_A | 933 | 2-oxoglutarate dehydrogenase E1 component; flavopr | 99.79 | |
| 3ju3_A | 118 | Probable 2-oxoacid ferredoxin oxidoreductase, ALP; | 99.79 | |
| 3uk1_A | 711 | Transketolase; structural genomics, seattle struct | 99.79 | |
| 1yd7_A | 395 | 2-keto acid:ferredoxin oxidoreductase subunit alph | 99.75 | |
| 3kom_A | 663 | Transketolase; rossmann fold, csgid, transferase, | 99.73 | |
| 2qtc_A | 886 | Pyruvate dehydrogenase E1 component; thiamin dipho | 99.55 | |
| 3ahc_A | 845 | Phosphoketolase, xylulose 5-phosphate/fructose 6-p | 99.47 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 99.46 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 90.17 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 86.1 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 84.6 | |
| 3rpe_A | 218 | MDAB, modulator of drug activity B; structural gen | 82.72 | |
| 4dik_A | 410 | Flavoprotein; TM0755, electron transport, DI-iron | 80.75 | |
| 2a5l_A | 200 | Trp repressor binding protein WRBA; APC5760, PA094 | 80.24 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 80.17 |
| >2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B | Back alignment and structure |
|---|
Probab=99.96 E-value=2.4e-28 Score=197.11 Aligned_cols=140 Identities=63% Similarity=1.036 Sum_probs=122.3
Q ss_pred CcccCCHHHHHHHHHHHHhCCCcEEEEecccccccccCCCCcccCCCcccccCceEEEeeccccccCCCcccccCCCcEE
Q psy7291 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDFVLPIGKAKVEKQGEAFYHLDAPVIRVTGKDIT 80 (158)
Q Consensus 1 V~~P~d~~e~~~~l~~a~~~~~P~~iR~~~~~~~~~~~~~~~~~~~~~~~~~g~~~vl~~~~~~~~~~~~~~~~~g~~~~ 80 (158)
|++|+|++|++.|+++|++.++|++||+++.+|+.+.++.+.+....+.+.+|+++++++ |.|++
T Consensus 156 V~~Psd~~e~~~~l~~a~~~~~Pv~i~~~~~~~~~~~~v~p~~~~~~~~~~~Gk~~v~~~---------------g~dv~ 220 (341)
T 2ozl_B 156 VVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQ---------------GTHIT 220 (341)
T ss_dssp EECCCSHHHHHHHHHHHHHSSSCEEEEECHHHHTCEEECCHHHHSTTCCCCTTCCEEEEC---------------CSSEE
T ss_pred EEEeCCHHHHHHHHHHHHhcCCCEEEEEChhhhcCCCCcCCccCCccccccCCceEEecc---------------CCCEE
Confidence 589999999999999999999999999998776543222111112234567899999988 89999
Q ss_pred EEEechhHHHHHHHHHHHHhCCCcEEEEEeccccCCCHHHHHHHHhCCCeEEEEeCCcCCCChHHHHHHHHHc-CC
Q psy7291 81 IVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIETITKSVMKTNYLISVEGGWPQCGIGSEISARIME-IP 155 (158)
Q Consensus 81 ii~~G~~~~~a~ea~~~L~~~gi~~~vi~~~~l~Pld~~~l~~~~~~~~~vvvvEe~~~~GG~g~~i~~~l~~-~~ 155 (158)
||++|+++..+++|++.|+++|++++||++++++|||++.+.++++++++|+++||+...||||+.|++++.+ ++
T Consensus 221 iia~Gs~~~~a~~Aa~~L~~~Gi~v~vv~~~~l~P~d~~~i~~~~~~~~~vv~vEe~~~~Gg~g~~v~~~l~~~~~ 296 (341)
T 2ozl_B 221 VVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPA 296 (341)
T ss_dssp EEECSTHHHHHHHHHHHHHTTTCCEEEEECCEEETCCHHHHHHHHHHHSCEEEECSSCSTTCHHHHHHHHHHHSTT
T ss_pred EEEeCHHHHHHHHHHHHHHhcCCCeEEEeeeeecCCCHHHHHHHHhcCCeEEEEecCcccCcHHHHHHHHHHhhhc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999988 65
|
| >1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* | Back alignment and structure |
|---|
| >1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* | Back alignment and structure |
|---|
| >2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... | Back alignment and structure |
|---|
| >1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 | Back alignment and structure |
|---|
| >1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B | Back alignment and structure |
|---|
| >3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* | Back alignment and structure |
|---|
| >2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* | Back alignment and structure |
|---|
| >3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* | Back alignment and structure |
|---|
| >1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 | Back alignment and structure |
|---|
| >3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* | Back alignment and structure |
|---|
| >2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* | Back alignment and structure |
|---|
| >1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 | Back alignment and structure |
|---|
| >2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* | Back alignment and structure |
|---|
| >3ju3_A Probable 2-oxoacid ferredoxin oxidoreductase, ALP; structural genomics, PSI-2, protein structu initiative; 1.90A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* | Back alignment and structure |
|---|
| >1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* | Back alignment and structure |
|---|
| >3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} | Back alignment and structure |
|---|
| >4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* | Back alignment and structure |
|---|
| >2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 158 | ||||
| d2ozlb1 | 192 | c.36.1.7 (B:0-191) E1-beta subunit of pyruvate deh | 4e-16 | |
| d1qs0b1 | 204 | c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase | 1e-14 | |
| d1umdb2 | 137 | c.48.1.2 (B:188-324) Branched-chain alpha-keto aci | 3e-12 | |
| d1qs0b2 | 134 | c.48.1.2 (B:206-339) 2-oxoisovalerate dehydrogenas | 1e-11 | |
| d2bfdb1 | 203 | c.36.1.7 (B:2-204) Branched-chain alpha-keto acid | 1e-11 | |
| d2bfdb2 | 138 | c.48.1.2 (B:205-342) Branched-chain alpha-keto aci | 2e-11 | |
| d1w85b1 | 192 | c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, | 2e-11 | |
| d1ik6a1 | 191 | c.36.1.7 (A:1-191) E1-beta subunit of pyruvate deh | 4e-11 | |
| d1w85b2 | 132 | c.48.1.2 (B:193-324) Pyruvate dehydrogenase E1-bet | 4e-11 | |
| d2ozlb2 | 138 | c.48.1.2 (B:192-329) E1-beta subunit of pyruvate d | 1e-10 | |
| d1ik6a2 | 135 | c.48.1.2 (A:192-326) E1-beta subunit of pyruvate d | 6e-10 | |
| d2c42a3 | 157 | c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoredu | 9e-08 | |
| d1umdb1 | 186 | c.36.1.7 (B:2-187) Branched-chain alpha-keto acid | 3e-07 |
| >d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiamin diphosphate-binding fold (THDP-binding) superfamily: Thiamin diphosphate-binding fold (THDP-binding) family: Branched-chain alpha-keto acid dehydrogenase Pyr module domain: E1-beta subunit of pyruvate dehydrogenase, Pyr module species: Human (Homo sapiens) [TaxId: 9606]
Score = 69.7 bits (170), Expect = 4e-16
Identities = 34/48 (70%), Positives = 40/48 (83%)
Query: 1 VVSPYNSEDAKGLLKAAIRDPDPVVFLENELLYGVQYPMGDEALSKDF 48
VVSP+NSEDAKGL+K+AIRD +PVV LENEL+YGV + EA SKDF
Sbjct: 145 VVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDF 192
|
| >d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Length = 204 | Back information, alignment and structure |
|---|
| >d1umdb2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 137 | Back information, alignment and structure |
|---|
| >d1qs0b2 c.48.1.2 (B:206-339) 2-oxoisovalerate dehydrogenase E1b, C-domain {Pseudomonas putida [TaxId: 303]} Length = 134 | Back information, alignment and structure |
|---|
| >d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
| >d2bfdb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1w85b1 c.36.1.7 (B:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 192 | Back information, alignment and structure |
|---|
| >d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 191 | Back information, alignment and structure |
|---|
| >d1w85b2 c.48.1.2 (B:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 132 | Back information, alignment and structure |
|---|
| >d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1ik6a2 c.48.1.2 (A:192-326) E1-beta subunit of pyruvate dehydrogenase, C-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 135 | Back information, alignment and structure |
|---|
| >d2c42a3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} Length = 157 | Back information, alignment and structure |
|---|
| >d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| d1umdb2 | 137 | Branched-chain alpha-keto acid dehydrogenase {Ther | 99.92 | |
| d2bfdb2 | 138 | Branched-chain alpha-keto acid dehydrogenase {Huma | 99.92 | |
| d2ozlb2 | 138 | E1-beta subunit of pyruvate dehydrogenase, C-domai | 99.91 | |
| d1w85b2 | 132 | Pyruvate dehydrogenase E1-beta, PdhB, C-terminal d | 99.9 | |
| d1ik6a2 | 135 | E1-beta subunit of pyruvate dehydrogenase, C-domai | 99.9 | |
| d1qs0b2 | 134 | 2-oxoisovalerate dehydrogenase E1b, C-domain {Pseu | 99.89 | |
| d2c42a3 | 157 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain I | 99.66 | |
| d1gpua3 | 146 | Transketolase (TK), C-domain {Baker's yeast (Sacch | 99.32 | |
| d2r8oa3 | 136 | Transketolase (TK), C-domain {Escherichia coli [Ta | 99.26 | |
| d1r9ja3 | 143 | Transketolase (TK), C-domain {Leishmania mexicana | 98.8 | |
| d1itza3 | 136 | Transketolase (TK), C-domain {Maize (Zea mays) [Ta | 98.7 | |
| d1qs0b1 | 204 | 2-oxoisovalerate dehydrogenase (E1B), Pyr module { | 98.08 | |
| d2ieaa3 | 186 | Pyruvate dehydrogenase E1 component, C-domain {Esc | 96.65 | |
| d1vmea1 | 148 | ROO-like flavoprotein TM0755, C-terminal domain {T | 90.8 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 89.91 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 86.67 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 84.76 | |
| d2qwxa1 | 230 | Quinone reductase type 2 (menadione reductase) {Hu | 84.58 | |
| d1e5da1 | 152 | Rubredoxin oxygen:oxidoreductase (ROO), C-terminal | 84.14 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 82.82 | |
| d1ycga1 | 149 | Nitric oxide reductase C-terminal domain {Moorella | 81.44 | |
| d1f4pa_ | 147 | Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} | 80.99 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 80.22 |
| >d1umdb2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TK C-terminal domain-like superfamily: TK C-terminal domain-like family: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain domain: Branched-chain alpha-keto acid dehydrogenase species: Thermus thermophilus [TaxId: 274]
Probab=99.92 E-value=1.3e-25 Score=157.95 Aligned_cols=93 Identities=38% Similarity=0.548 Sum_probs=89.2
Q ss_pred cccccCceEEEeeccccccCCCcccccCCCcEEEEEechhHHHHHHHHHHHHhCCCcEEEEEeccccCCCHHHHHHHHhC
Q psy7291 48 FVLPIGKAKVEKQGEAFYHLDAPVIRVTGKDITIVGHSKAVETALDAAKILAGQGIDAEVINLRSLRPLDIETITKSVMK 127 (158)
Q Consensus 48 ~~~~~g~~~vl~~~~~~~~~~~~~~~~~g~~~~ii~~G~~~~~a~ea~~~L~~~gi~~~vi~~~~l~Pld~~~l~~~~~~ 127 (158)
|.+++||++++++ |.|++|||+|.|+..|++|++.|+++|++++|||++|++|||.+.+.+++++
T Consensus 2 Y~~~iGk~~v~r~---------------G~dvtiis~G~~~~~al~aa~~L~~~gi~~~vid~~~lkPlD~~~i~~sv~k 66 (137)
T d1umdb2 2 YTLPIGKAALRRE---------------GKDLTLICYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAK 66 (137)
T ss_dssp CCCCTTCCEEEEC---------------CSSEEEEECGGGHHHHHHHHHHHHHTTCCEEEEECCEEETCCHHHHHHHHHH
T ss_pred ceEeCCEEEEEEe---------------CCCEEEEEcchhhhhhhhhhhcccccCcceEEEeecccCCcchhhhhHHHhc
Confidence 5678999999999 9999999999999999999999999999999999999999999999999999
Q ss_pred CCeEEEEeCCcCCCChHHHHHHHHHcCC
Q psy7291 128 TNYLISVEGGWPQCGIGSEISARIMEIP 155 (158)
Q Consensus 128 ~~~vvvvEe~~~~GG~g~~i~~~l~~~~ 155 (158)
+++++|+|||...||+|+.|++.+++++
T Consensus 67 t~~vv~veE~~~~gg~g~~v~~~l~e~~ 94 (137)
T d1umdb2 67 TGRVVLVSDAPRHASFVSEVAATIAEDL 94 (137)
T ss_dssp HSCEEEEEEEESTTCHHHHHHHHHHHHH
T ss_pred cCcEEEEEcccccchhHHHHHHHHHHhh
Confidence 9999999999999999999999998764
|
| >d2bfdb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozlb2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w85b2 c.48.1.2 (B:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ik6a2 c.48.1.2 (A:192-326) E1-beta subunit of pyruvate dehydrogenase, C-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1qs0b2 c.48.1.2 (B:206-339) 2-oxoisovalerate dehydrogenase E1b, C-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2c42a3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2r8oa3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r9ja3 c.48.1.1 (A:527-669) Transketolase (TK), C-domain {Leishmania mexicana mexicana [TaxId: 44270]} | Back information, alignment and structure |
|---|
| >d1itza3 c.48.1.1 (A:540-675) Transketolase (TK), C-domain {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ieaa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|