Psyllid ID: psy7295
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
No hits with e-value below 0.001 by BLAST
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| FB|FBgn0031703 | 593 | CG12512 [Drosophila melanogast | 0.587 | 0.163 | 0.628 | 3e-38 | |
| ZFIN|ZDB-GENE-060825-7 | 606 | acsf2 "acyl-CoA synthetase fam | 0.587 | 0.160 | 0.612 | 4.3e-35 | |
| UNIPROTKB|F1PTR3 | 612 | ACSF2 "Uncharacterized protein | 0.539 | 0.145 | 0.595 | 1.1e-32 | |
| UNIPROTKB|G1K208 | 614 | ACSF2 "Acyl-CoA synthetase fam | 0.496 | 0.133 | 0.597 | 1.1e-31 | |
| UNIPROTKB|Q17QJ1 | 615 | ACSF2 "Acyl-CoA synthetase fam | 0.496 | 0.133 | 0.597 | 1.1e-31 | |
| UNIPROTKB|F1RT96 | 609 | ACSF2 "Uncharacterized protein | 0.587 | 0.159 | 0.5 | 7.6e-31 | |
| UNIPROTKB|E1BS15 | 589 | ACSF2 "Uncharacterized protein | 0.587 | 0.164 | 0.510 | 7.9e-31 | |
| UNIPROTKB|E1BVI3 | 593 | ACSF2 "Uncharacterized protein | 0.587 | 0.163 | 0.510 | 8.2e-31 | |
| UNIPROTKB|B4DUF5 | 455 | ACSF2 "Acyl-CoA synthetase fam | 0.496 | 0.180 | 0.573 | 2.5e-30 | |
| MGI|MGI:2388287 | 615 | Acsf2 "acyl-CoA synthetase fam | 0.496 | 0.133 | 0.585 | 3e-30 |
| FB|FBgn0031703 CG12512 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 350 (128.3 bits), Expect = 3.0e-38, Sum P(2) = 3.0e-38
Identities = 61/97 (62%), Positives = 78/97 (80%)
Query: 7 KVVDSDNRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGFG 66
KVVD++ R VP+GQ GEL +RGY ML Y +EEKTKE +G D WLRTGDQFVL +G+G
Sbjct: 413 KVVDAEGRCVPFGQPGELCVRGYTTMLGYHDDEEKTKETIGNDRWLRTGDQFVLEANGYG 472
Query: 67 SVVGRIKDLIIRGGENIYPSEIEDFLTTHPDILEAYV 103
+VGR+K+++IRGGENI+P EIEDFL HP ++EA+V
Sbjct: 473 RIVGRLKEMLIRGGENIFPKEIEDFLNAHPQVIEAHV 509
|
|
| ZFIN|ZDB-GENE-060825-7 acsf2 "acyl-CoA synthetase family member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PTR3 ACSF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G1K208 ACSF2 "Acyl-CoA synthetase family member 2, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QJ1 ACSF2 "Acyl-CoA synthetase family member 2, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RT96 ACSF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS15 ACSF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVI3 ACSF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DUF5 ACSF2 "Acyl-CoA synthetase family member 2, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2388287 Acsf2 "acyl-CoA synthetase family member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| cd05917 | 347 | cd05917, FACL_like_2, Uncharacterized subfamily of | 1e-62 | |
| PRK08315 | 559 | PRK08315, PRK08315, AMP-binding domain protein; Va | 1e-55 | |
| PRK12583 | 558 | PRK12583, PRK12583, acyl-CoA synthetase; Provision | 8e-44 | |
| cd05929 | 342 | cd05929, BACL_like, Bacterial Bile acid CoA ligase | 4e-41 | |
| cd05926 | 345 | cd05926, FACL_fum10p_like, Subfamily of fatty acid | 1e-39 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 5e-39 | |
| PRK06187 | 521 | PRK06187, PRK06187, long-chain-fatty-acid--CoA lig | 7e-39 | |
| cd05936 | 468 | cd05936, FC-FACS_FadD_like, Prokaryotic long-chain | 7e-39 | |
| cd05920 | 483 | cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l | 1e-36 | |
| cd05903 | 437 | cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li | 4e-36 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 2e-34 | |
| PRK07656 | 513 | PRK07656, PRK07656, long-chain-fatty-acid--CoA lig | 2e-34 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 2e-33 | |
| cd05911 | 487 | cd05911, Firefly_Luc_like, Firefly luciferase of l | 1e-32 | |
| cd05941 | 430 | cd05941, MCS, Malonyl-CoA synthetase (MCS) | 1e-31 | |
| cd05934 | 421 | cd05934, FACL_DitJ_like, Uncharacterized subfamily | 2e-31 | |
| PRK05605 | 573 | PRK05605, PRK05605, long-chain-fatty-acid--CoA lig | 2e-31 | |
| PRK05677 | 562 | PRK05677, PRK05677, long-chain-fatty-acid--CoA lig | 9e-30 | |
| PRK06188 | 524 | PRK06188, PRK06188, acyl-CoA synthetase; Validated | 8e-29 | |
| PRK06839 | 496 | PRK06839, PRK06839, acyl-CoA synthetase; Validated | 3e-28 | |
| cd05907 | 456 | cd05907, VL_LC_FACS_like, Long-chain fatty acid Co | 3e-27 | |
| PRK12492 | 562 | PRK12492, PRK12492, long-chain-fatty-acid--CoA lig | 6e-27 | |
| cd12119 | 517 | cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth | 1e-26 | |
| cd05904 | 504 | cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | 2e-26 | |
| PRK09088 | 488 | PRK09088, PRK09088, acyl-CoA synthetase; Validated | 4e-26 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 4e-26 | |
| cd05912 | 407 | cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase | 1e-25 | |
| PRK06087 | 547 | PRK06087, PRK06087, short chain acyl-CoA synthetas | 2e-25 | |
| PRK08974 | 560 | PRK08974, PRK08974, long-chain-fatty-acid--CoA lig | 2e-24 | |
| PRK03640 | 483 | PRK03640, PRK03640, O-succinylbenzoic acid--CoA li | 2e-24 | |
| cd12118 | 520 | cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt | 3e-24 | |
| COG1022 | 613 | COG1022, FAA1, Long-chain acyl-CoA synthetases (AM | 7e-24 | |
| PRK08316 | 523 | PRK08316, PRK08316, acyl-CoA synthetase; Validated | 2e-23 | |
| cd05959 | 506 | cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and | 2e-23 | |
| PRK07786 | 542 | PRK07786, PRK07786, long-chain-fatty-acid--CoA lig | 9e-23 | |
| PRK07059 | 557 | PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig | 3e-22 | |
| PRK06145 | 497 | PRK06145, PRK06145, acyl-CoA synthetase; Validated | 3e-22 | |
| PRK13295 | 547 | PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig | 3e-22 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 4e-22 | |
| cd05923 | 495 | cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | 6e-22 | |
| PRK07470 | 528 | PRK07470, PRK07470, acyl-CoA synthetase; Validated | 8e-22 | |
| cd05919 | 436 | cd05919, BCL_like, Benzoate CoA ligase (BCL) and s | 1e-21 | |
| PRK05852 | 534 | PRK05852, PRK05852, acyl-CoA synthetase; Validated | 2e-21 | |
| cd05935 | 430 | cd05935, LC_FACS_like, Putative long-chain fatty a | 2e-21 | |
| PLN02860 | 563 | PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | 3e-21 | |
| PRK08008 | 517 | PRK08008, caiC, putative crotonobetaine/carnitine- | 5e-21 | |
| PRK06178 | 567 | PRK06178, PRK06178, acyl-CoA synthetase; Validated | 7e-21 | |
| PRK08276 | 502 | PRK08276, PRK08276, long-chain-fatty-acid--CoA lig | 7e-21 | |
| COG1021 | 542 | COG1021, EntE, Peptide arylation enzymes [Secondar | 4e-20 | |
| TIGR01923 | 436 | TIGR01923, menE, O-succinylbenzoate-CoA ligase | 4e-20 | |
| PRK08751 | 560 | PRK08751, PRK08751, putative long-chain fatty acyl | 5e-20 | |
| PRK07788 | 549 | PRK07788, PRK07788, acyl-CoA synthetase; Validated | 8e-20 | |
| PRK08162 | 545 | PRK08162, PRK08162, acyl-CoA synthetase; Validated | 1e-19 | |
| PRK13382 | 537 | PRK13382, PRK13382, acyl-CoA synthetase; Provision | 3e-19 | |
| TIGR03208 | 538 | TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate | 5e-19 | |
| PRK07514 | 504 | PRK07514, PRK07514, malonyl-CoA synthase; Validate | 5e-19 | |
| PRK07529 | 632 | PRK07529, PRK07529, AMP-binding domain protein; Va | 6e-19 | |
| TIGR02275 | 526 | TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP | 8e-19 | |
| cd05944 | 359 | cd05944, FACL_like_4, Uncharacterized subfamily of | 6e-18 | |
| cd05971 | 439 | cd05971, MACS_like_3, Uncharacterized subfamily of | 6e-18 | |
| PRK06155 | 542 | PRK06155, PRK06155, crotonobetaine/carnitine-CoA l | 8e-18 | |
| cd05932 | 504 | cd05932, LC_FACS_bac, Bacterial long-chain fatty a | 9e-18 | |
| cd05906 | 560 | cd05906, A_NRPS_TubE_like, The adenylation domain | 1e-17 | |
| TIGR03205 | 541 | TIGR03205, pimA, dicarboxylate--CoA ligase PimA | 1e-17 | |
| cd05933 | 594 | cd05933, ACSBG_like, Bubblegum-like very long-chai | 3e-17 | |
| PLN02246 | 537 | PLN02246, PLN02246, 4-coumarate--CoA ligase | 4e-17 | |
| PRK08314 | 546 | PRK08314, PRK08314, long-chain-fatty-acid--CoA lig | 5e-17 | |
| PLN02330 | 546 | PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | 6e-17 | |
| PRK10946 | 536 | PRK10946, entE, enterobactin synthase subunit E; P | 6e-17 | |
| PRK12406 | 509 | PRK12406, PRK12406, long-chain-fatty-acid--CoA lig | 7e-17 | |
| cd05972 | 430 | cd05972, MACS_like, Medium-chain acyl-CoA syntheta | 7e-17 | |
| PLN02574 | 560 | PLN02574, PLN02574, 4-coumarate--CoA ligase-like | 8e-17 | |
| cd05908 | 499 | cd05908, A_NRPS_MycA_like, The adenylation domain | 8e-17 | |
| PRK06164 | 540 | PRK06164, PRK06164, acyl-CoA synthetase; Validated | 1e-16 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 2e-16 | |
| PRK06710 | 563 | PRK06710, PRK06710, long-chain-fatty-acid--CoA lig | 2e-16 | |
| cd05958 | 487 | cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | 3e-16 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 1e-15 | |
| PRK13391 | 511 | PRK13391, PRK13391, acyl-CoA synthetase; Provision | 1e-15 | |
| PRK13383 | 516 | PRK13383, PRK13383, acyl-CoA synthetase; Provision | 3e-15 | |
| PRK09192 | 579 | PRK09192, PRK09192, acyl-CoA synthetase; Validated | 3e-15 | |
| PRK07787 | 471 | PRK07787, PRK07787, acyl-CoA synthetase; Validated | 3e-15 | |
| PRK07768 | 545 | PRK07768, PRK07768, long-chain-fatty-acid--CoA lig | 1e-14 | |
| PRK08633 | 1146 | PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola | 2e-14 | |
| cd05924 | 365 | cd05924, FACL_like_5, Uncharacterized subfamily of | 3e-14 | |
| PRK07798 | 533 | PRK07798, PRK07798, acyl-CoA synthetase; Validated | 3e-14 | |
| PRK05857 | 540 | PRK05857, PRK05857, acyl-CoA synthetase; Validated | 4e-14 | |
| PLN02479 | 567 | PLN02479, PLN02479, acetate-CoA ligase | 4e-14 | |
| cd05928 | 530 | cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co | 6e-14 | |
| cd05969 | 443 | cd05969, MACS_like_4, Uncharacterized subfamily of | 6e-14 | |
| TIGR02262 | 508 | TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil | 6e-14 | |
| PLN03102 | 579 | PLN03102, PLN03102, acyl-activating enzyme; Provis | 3e-13 | |
| PRK05850 | 578 | PRK05850, PRK05850, acyl-CoA synthetase; Validated | 4e-13 | |
| cd05970 | 537 | cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s | 1e-12 | |
| cd05927 | 539 | cd05927, LC-FACS_euk, Eukaryotic long-chain fatty | 1e-12 | |
| cd05973 | 440 | cd05973, MACS_like_2, Uncharacterized subfamily of | 3e-12 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 3e-12 | |
| PRK04319 | 570 | PRK04319, PRK04319, acetyl-CoA synthetase; Provisi | 1e-11 | |
| PRK06018 | 542 | PRK06018, PRK06018, putative acyl-CoA synthetase; | 3e-11 | |
| PRK05620 | 576 | PRK05620, PRK05620, long-chain-fatty-acid--CoA lig | 4e-11 | |
| PRK05851 | 525 | PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c | 7e-11 | |
| PRK07008 | 539 | PRK07008, PRK07008, long-chain-fatty-acid--CoA lig | 1e-10 | |
| PRK13390 | 501 | PRK13390, PRK13390, acyl-CoA synthetase; Provision | 1e-10 | |
| cd05909 | 489 | cd05909, AAS_C, C-terminal domain of the acyl-acyl | 3e-10 | |
| PRK07769 | 631 | PRK07769, PRK07769, long-chain-fatty-acid--CoA lig | 4e-10 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 7e-10 | |
| cd05914 | 448 | cd05914, FACL_like_3, Uncharacterized subfamily of | 9e-10 | |
| cd05937 | 468 | cd05937, FATP_chFAT1_like, Uncharacterized subfami | 1e-09 | |
| PRK07824 | 358 | PRK07824, PRK07824, O-succinylbenzoic acid--CoA li | 2e-09 | |
| PRK07638 | 487 | PRK07638, PRK07638, acyl-CoA synthetase; Validated | 2e-09 | |
| cd05967 | 607 | cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | 3e-09 | |
| PRK12476 | 612 | PRK12476, PRK12476, putative fatty-acid--CoA ligas | 3e-09 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 3e-09 | |
| PRK13388 | 540 | PRK13388, PRK13388, acyl-CoA synthetase; Provision | 5e-09 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 5e-09 | |
| PRK07867 | 529 | PRK07867, PRK07867, acyl-CoA synthetase; Validated | 5e-09 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 1e-08 | |
| cd05940 | 444 | cd05940, FATP_FACS, Fatty acid transport proteins | 2e-08 | |
| PRK09029 | 458 | PRK09029, PRK09029, O-succinylbenzoic acid--CoA li | 2e-08 | |
| PRK07445 | 452 | PRK07445, PRK07445, O-succinylbenzoic acid--CoA li | 3e-08 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 5e-08 | |
| cd05968 | 474 | cd05968, AACS_like, Uncharacterized acyl-CoA synth | 1e-07 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 1e-07 | |
| PTZ00216 | 700 | PTZ00216, PTZ00216, acyl-CoA synthetase; Provision | 1e-07 | |
| PRK06060 | 705 | PRK06060, PRK06060, acyl-CoA synthetase; Validated | 2e-07 | |
| cd05915 | 509 | cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase | 4e-07 | |
| PLN02736 | 651 | PLN02736, PLN02736, long-chain acyl-CoA synthetase | 8e-07 | |
| cd05966 | 602 | cd05966, ACS, Acetyl-CoA synthetase (also known as | 1e-06 | |
| PRK08308 | 414 | PRK08308, PRK08308, acyl-CoA synthetase; Validated | 2e-06 | |
| cd05974 | 433 | cd05974, MACS_like_1, Uncharacterized subfamily of | 3e-06 | |
| PRK08279 | 600 | PRK08279, PRK08279, long-chain-acyl-CoA synthetase | 5e-06 | |
| cd05910 | 455 | cd05910, FACL_like_1, Uncharacterized subfamily of | 1e-05 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 2e-05 | |
| TIGR03098 | 517 | TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form | 2e-05 | |
| cd05921 | 559 | cd05921, FCS, Feruloyl-CoA synthetase (FCS) | 2e-05 | |
| TIGR02188 | 625 | TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | 5e-05 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 7e-05 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 1e-04 | |
| PRK12582 | 624 | PRK12582, PRK12582, acyl-CoA synthetase; Provision | 2e-04 | |
| PLN02387 | 696 | PLN02387, PLN02387, long-chain-fatty-acid-CoA liga | 2e-04 | |
| PRK04813 | 503 | PRK04813, PRK04813, D-alanine--poly(phosphoribitol | 3e-04 | |
| PLN02430 | 660 | PLN02430, PLN02430, long-chain-fatty-acid-CoA liga | 3e-04 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 4e-04 | |
| PRK06814 | 1140 | PRK06814, PRK06814, acylglycerophosphoethanolamine | 6e-04 | |
| PLN02654 | 666 | PLN02654, PLN02654, acetate-CoA ligase | 0.001 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 0.002 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 0.003 | |
| PRK06334 | 539 | PRK06334, PRK06334, long chain fatty acid--[acyl-c | 0.004 | |
| TIGR01734 | 502 | TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho | 0.004 |
| >gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
Score = 195 bits (499), Expect = 1e-62
Identities = 66/157 (42%), Positives = 91/157 (57%), Gaps = 23/157 (14%)
Query: 6 VKVVDSDNRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGF 65
VK+VD D VP G+ GE+ +RGY M Y+ + E T E + D WL TGD + +DG+
Sbjct: 184 VKIVDPDGGEVPPGEVGEICVRGYSVMKGYYNDPEATAEAIDADGWLHTGDLGYMDEDGY 243
Query: 66 GSVVGRIKDLIIRGGENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGYC 125
+VGRIKD+IIRGGENIYP+EIE+ L THP + EA
Sbjct: 244 LRIVGRIKDMIIRGGENIYPAEIEEALLTHPAVAEA-----------------------A 280
Query: 126 VYGIRDERMGEEIGASIRLTENSSLTEDELRGYFKGK 162
V G+ DER+GE + A + L ++LTE+EL + +G+
Sbjct: 281 VVGVPDERLGEVVAAFVVLKPGATLTEEELIAFCRGR 317
|
Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Length = 347 |
| >gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD | Back alignment and domain information |
|---|
| >gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) | Back alignment and domain information |
|---|
| >gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) | Back alignment and domain information |
|---|
| >gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis | Back alignment and domain information |
|---|
| >gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | Back alignment and domain information |
|---|
| >gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents | Back alignment and domain information |
|---|
| >gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) | Back alignment and domain information |
|---|
| >gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) | Back alignment and domain information |
|---|
| >gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like | Back alignment and domain information |
|---|
| >gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) | Back alignment and domain information |
|---|
| >gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi | Back alignment and domain information |
|---|
| >gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | Back alignment and domain information |
|---|
| >gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180374 PRK06060, PRK06060, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) | Back alignment and domain information |
|---|
| >gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated | Back alignment and domain information |
|---|
| >gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) | Back alignment and domain information |
|---|
| >gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215353 PLN02654, PLN02654, acetate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| KOG1176|consensus | 537 | 100.0 | ||
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.97 | |
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.96 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.96 | |
| KOG1177|consensus | 596 | 99.96 | ||
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.96 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.96 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.95 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.95 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.95 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.95 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.95 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.95 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.95 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.95 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.95 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.95 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.95 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.94 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.94 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.94 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.94 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.94 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.94 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.94 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.94 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.94 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.94 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.94 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.94 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.94 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.94 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.94 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.94 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.93 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.93 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.93 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.93 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.93 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.93 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.93 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.93 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.93 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.93 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.93 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.93 | |
| KOG1175|consensus | 626 | 99.92 | ||
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.92 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.92 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.92 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.92 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.92 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.92 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.92 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.92 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.92 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.92 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.92 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.92 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.92 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.92 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.92 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.92 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.91 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.91 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.91 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.91 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.91 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.91 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.91 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.91 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.91 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.9 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.9 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.9 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.9 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.9 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.9 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.9 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.9 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.89 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.89 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.89 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.89 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.89 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.88 | |
| KOG1256|consensus | 691 | 99.88 | ||
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.88 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.87 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.86 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.86 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.86 | |
| KOG1180|consensus | 678 | 99.79 | ||
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 99.79 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.78 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.69 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 99.69 | |
| KOG1179|consensus | 649 | 99.62 | ||
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 99.59 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 99.49 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 99.27 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 99.1 | |
| KOG1178|consensus | 1032 | 99.09 | ||
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 99.07 | |
| KOG3628|consensus | 1363 | 98.7 | ||
| PF13193 | 73 | AMP-binding_C: AMP-binding enzyme C-terminal domai | 98.11 | |
| KOG3628|consensus | 1363 | 98.03 | ||
| TIGR02304 | 430 | aden_form_hyp probable adenylate-forming enzyme. M | 97.0 | |
| PF14535 | 96 | AMP-binding_C_2: AMP-binding enzyme C-terminal dom | 96.67 | |
| PF03321 | 528 | GH3: GH3 auxin-responsive promoter; InterPro: IPR0 | 95.8 | |
| PF04443 | 365 | LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR | 92.42 | |
| PLN02249 | 597 | indole-3-acetic acid-amido synthetase | 87.27 |
| >KOG1176|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-34 Score=253.84 Aligned_cols=141 Identities=42% Similarity=0.582 Sum_probs=136.0
Q ss_pred CCCcEEEEECCCCCccCCCCceEEEEEeCcccccccCChhhhhhhhcCCCeEeeccEEEEecCCcEEEecCCCceEEECc
Q psy7295 1 MSLNIVKVVDSDNRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGFGSVVGRIKDLIIRGG 80 (165)
Q Consensus 1 ~pg~~v~vvd~~g~~~~~g~~GeL~v~g~~~~~gY~~~~~~t~~~~~~~~~~~TGD~~~~~~dG~l~~~GR~dd~i~~~G 80 (165)
+||..+.+.++.|+.+++++.||||++|+++|.|||+||+.|++.|.++|||+|||+|++|+||+|+|.+|++|+||.+|
T Consensus 359 ~~g~~~~v~~e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G 438 (537)
T KOG1176|consen 359 LPGVRVKVLDETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGG 438 (537)
T ss_pred ccceEEEeeCCCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhheeeCC
Confidence 35778888888899999999999999999999999999999999998889999999999999999999999999999999
Q ss_pred EEEChHHHHHHHhcCCChHHhHhhhhhhhccccccccccCCCceeEEeecCCCCCceEEEEEEeCCCCCCCHHHHHHHHH
Q psy7295 81 ENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGYCVYGIRDERMGEEIGASIRLTENSSLTEDELRGYFK 160 (165)
Q Consensus 81 ~~v~~~eIE~~l~~~~~v~~a~v~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~a~v~~~~~~~~~~~~l~~~l~ 160 (165)
++|+|.|||++|.+||.|.||+ |++.+|+..|+.++|||+.+++...+++++.++|+
T Consensus 439 ~qv~P~EiE~vL~~hP~V~eaa-----------------------VvgipDe~~Ge~p~A~VV~k~g~~lte~di~~~v~ 495 (537)
T KOG1176|consen 439 EQVSPAEIEAVLLTHPDVLEAA-----------------------VVGIPDEVWGETPAAFVVLKKGSTLTEKDIIEYVR 495 (537)
T ss_pred EEeCHHHHHHHHHhCCCccEEE-----------------------EEcccccccCCcceEEEEecCCCcCCHHHHHHHHH
Confidence 9999999999999999999999 99999999999999999999989999999999999
Q ss_pred hhhc
Q psy7295 161 GKAI 164 (165)
Q Consensus 161 ~~l~ 164 (165)
++|.
T Consensus 496 k~l~ 499 (537)
T KOG1176|consen 496 KKLP 499 (537)
T ss_pred hhCC
Confidence 9986
|
|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1177|consensus | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >KOG1175|consensus | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >KOG1256|consensus | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >KOG1180|consensus | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >KOG1179|consensus | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1178|consensus | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG3628|consensus | Back alignment and domain information |
|---|
| >PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B | Back alignment and domain information |
|---|
| >KOG3628|consensus | Back alignment and domain information |
|---|
| >TIGR02304 aden_form_hyp probable adenylate-forming enzyme | Back alignment and domain information |
|---|
| >PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B | Back alignment and domain information |
|---|
| >PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin | Back alignment and domain information |
|---|
| >PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria | Back alignment and domain information |
|---|
| >PLN02249 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 9e-56 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 7e-54 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 5e-53 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 3e-51 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 8e-50 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 4e-46 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 5e-45 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 1e-44 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 2e-44 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 3e-44 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 4e-44 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 3e-42 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 5e-41 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 9e-39 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 9e-39 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 8e-32 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 8e-26 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 3e-22 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 6e-22 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 6e-18 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 1e-10 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 7e-09 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 1e-08 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 3e-08 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 1e-06 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 2e-05 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 6e-05 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 6e-05 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 2e-04 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 2e-04 |
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 | Back alignment and structure |
|---|
Score = 182 bits (464), Expect = 9e-56
Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 24/159 (15%)
Query: 6 VKVVDSDNRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGF 65
+V D +R V G+ G LL RG + Y+ EE ED + RTGD LT+DG+
Sbjct: 363 SRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFYRTGDIVRLTRDGY 422
Query: 66 GSVVGRIKDLIIRGGENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGYC 125
V GR KD I RGGE + E+E+ L HP + +A
Sbjct: 423 IVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDA-----------------------A 459
Query: 126 VYGIRDERMGEEIGASIRLTENSSLTEDELRGYFKGKAI 164
+ + D+ +GE I + + EL+ + + + +
Sbjct: 460 MVSMPDQFLGERSCVFIIPRDE-APKAAELKAFLRERGL 497
|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 | Back alignment and structure |
|---|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Length = 437 | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Length = 436 | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Length = 443 | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Length = 652 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 100.0 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 99.98 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.97 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 99.97 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.97 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.97 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.97 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.97 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.97 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.97 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.97 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.97 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.97 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.97 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 99.97 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 99.97 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.97 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.97 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.96 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.96 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.96 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.96 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.96 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.96 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.96 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.95 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.95 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.95 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.95 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.94 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.89 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.88 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.87 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.81 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 99.71 | |
| 3lax_A | 109 | Phenylacetate-coenzyme A ligase; structural genomi | 99.24 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 99.18 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 98.01 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 97.63 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 97.61 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 97.4 |
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-32 Score=236.01 Aligned_cols=141 Identities=28% Similarity=0.504 Sum_probs=134.1
Q ss_pred CCCcEEEEEC-CCCCccCCCCceEEEEEeCcccccccCChhhhhhhhcCCCeEeeccEEEEecCCcEEEecCCCceEEEC
Q psy7295 1 MSLNIVKVVD-SDNRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGFGSVVGRIKDLIIRG 79 (165)
Q Consensus 1 ~pg~~v~vvd-~~g~~~~~g~~GeL~v~g~~~~~gY~~~~~~t~~~~~~~~~~~TGD~~~~~~dG~l~~~GR~dd~i~~~ 79 (165)
+|+++++|+| ++|+++|.|+.|||+|+||+++.|||++|+.|.+.|.++|||+|||++++++||+++|+||.||+||++
T Consensus 326 ~~~~~~~i~d~~~g~~~~~g~~GEl~v~g~~v~~GY~~~~~~t~~~f~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~ 405 (503)
T 4fuq_A 326 LPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITG 405 (503)
T ss_dssp CTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCCCBTTCHHHHHHTBCTTSCEEEEEEEEECTTCEEEECCSSTTCEEET
T ss_pred CCCeEEEEEECCCCCCCcCCCceEEEEECCchhhhhcCChhhhHhhhCCCCCeEcceeEEEcCCCcEEEEecCCCEEEEC
Confidence 5799999999 569999999999999999999999999999999999889999999999999999999999999999999
Q ss_pred cEEEChHHHHHHHhcCCChHHhHhhhhhhhccccccccccCCCceeEEeecCCCCCceEEEEEEeCCCCCCCHHHHHHHH
Q psy7295 80 GENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGYCVYGIRDERMGEEIGASIRLTENSSLTEDELRGYF 159 (165)
Q Consensus 80 G~~v~~~eIE~~l~~~~~v~~a~v~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~a~v~~~~~~~~~~~~l~~~l 159 (165)
|++|+|.|||+.|.+||+|.+++ |++.+++..++.+++++++.++...+.++++++|
T Consensus 406 G~~v~p~eIE~~l~~~p~V~~a~-----------------------vv~~~~~~~~~~~~a~v~~~~~~~~~~~~l~~~l 462 (503)
T 4fuq_A 406 GFNVYPKEIESEIDAMPGVVESA-----------------------VIGVPHADFGEGVTAVVVRDKGATIDEAQVLHGL 462 (503)
T ss_dssp TEEECHHHHHHHHHTSTTEEEEE-----------------------EEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHH
T ss_pred CEEECHHHHHHHHHhCCCeeEEE-----------------------EEEeEchhcCceeEEEEEeCCCCCCCHHHHHHHH
Confidence 99999999999999999999998 9999999999999999999888888999999999
Q ss_pred Hhhhc
Q psy7295 160 KGKAI 164 (165)
Q Consensus 160 ~~~l~ 164 (165)
+++|.
T Consensus 463 ~~~L~ 467 (503)
T 4fuq_A 463 DGQLA 467 (503)
T ss_dssp BTTBC
T ss_pred Hhhcc
Confidence 88764
|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 165 | ||||
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 9e-38 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 3e-34 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 6e-34 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 1e-29 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 3e-29 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 8e-29 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 6e-28 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Score = 133 bits (334), Expect = 9e-38
Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 24/158 (15%)
Query: 6 VKVVDSDN-RMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDG 64
KVVD D + + Q+GEL +RG M Y N E T ++ +D WL +GD +D
Sbjct: 368 AKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDE 427
Query: 65 FGSVVGRIKDLIIRGGENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGY 124
+V R+K LI G + P+E+E L HP+I +A
Sbjct: 428 HFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDA----------------------- 464
Query: 125 CVYGIRDERMGEEIGASIRLTENSSLTEDELRGYFKGK 162
V G+ D+ GE A + L ++TE E+ Y +
Sbjct: 465 GVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQ 502
|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 99.97 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.96 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.96 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.96 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.95 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.94 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 99.91 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=99.97 E-value=1.8e-31 Score=225.66 Aligned_cols=141 Identities=33% Similarity=0.517 Sum_probs=129.0
Q ss_pred CCCcEEEEECCC-CCccCCCCceEEEEEeCcccccccCChhhhhhhhcCCCeEeeccEEEEecCCcEEEecCCCceEEEC
Q psy7295 1 MSLNIVKVVDSD-NRMVPYGQQGELLIRGYCNMLRYWGNEEKTKEILGEDNWLRTGDQFVLTKDGFGSVVGRIKDLIIRG 79 (165)
Q Consensus 1 ~pg~~v~vvd~~-g~~~~~g~~GeL~v~g~~~~~gY~~~~~~t~~~~~~~~~~~TGD~~~~~~dG~l~~~GR~dd~i~~~ 79 (165)
+||++++|+|++ |++++.|+.|||+|+|++++.|||++++.+...+..++||+|||+++++++|++++.||.||+||++
T Consensus 363 ~~~~~~~i~d~d~~~~~~~g~~Gel~v~g~~~~~gY~~~~~~~~~~~~~~~~~~TGDl~~~~~~G~~~~~GR~~d~i~~~ 442 (541)
T d1lcia_ 363 VPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYK 442 (541)
T ss_dssp CTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEETTBHHHHHHHBCTTSCEEEEEEEEECTTCCEEEC-----CEEET
T ss_pred cCCCEEEEEECCCCcCCCCCCeEEEEEccCccCCeeCCChhhhhhcccCCccccCCCeeEEcCCeEEEEeeeecCEEEEC
Confidence 589999999975 9999999999999999999999999999999888889999999999999999999999999999999
Q ss_pred cEEEChHHHHHHHhcCCChHHhHhhhhhhhccccccccccCCCceeEEeecCCCCCceEEEEEEeCCCCCCCHHHHHHHH
Q psy7295 80 GENIYPSEIEDFLTTHPDILEAYVSEYRLKLDFTGLLQQCSIPGYCVYGIRDERMGEEIGASIRLTENSSLTEDELRGYF 159 (165)
Q Consensus 80 G~~v~~~eIE~~l~~~~~v~~a~v~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~a~v~~~~~~~~~~~~l~~~l 159 (165)
|++|+|.+||+.|.+||+|.+|+ |++.+++..++.++++|+++++...+.++++++|
T Consensus 443 G~~v~~~~IE~~l~~~p~V~~~~-----------------------v~~~~~~~~g~~~~a~v~~~~~~~~~~~~l~~~~ 499 (541)
T d1lcia_ 443 GYQVAPAELESILLQHPNIFDAG-----------------------VAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYV 499 (541)
T ss_dssp TEEECHHHHHHHHHTSTTEEEEE-----------------------EEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHH
T ss_pred CEEECHHHHHHHHHhCCCccEEE-----------------------EEEEECCCCCEEEEEEEEECCCCCCCHHHHHHHH
Confidence 99999999999999999999998 8999999899999999999888888999999999
Q ss_pred Hhhhc
Q psy7295 160 KGKAI 164 (165)
Q Consensus 160 ~~~l~ 164 (165)
+++|.
T Consensus 500 ~~~l~ 504 (541)
T d1lcia_ 500 ASQVT 504 (541)
T ss_dssp HHHSC
T ss_pred HHhCC
Confidence 98764
|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|