Psyllid ID: psy7337

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIEKESKKEGGDGGGTEEKTKVNDERVEKKPKALEKEEREVKMEGKEMKEEEEDKDVVEKKRKRYLRVSGGKDKDSRCQVR
cccHHHHHHHHHHHHHcccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccHHHHHHHccHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccHHHHHHHccHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccccHHHHHHHHHHHccccEHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccHcccccccccEEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHEEEEccccccccccccc
VSERNDIKTALEfldesdlisiedilpffsdftcmdqFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRYHMIQNCDTCLLcevqlvsntfyifpcghtfhshcivqdldpeqkakldseetgSEAVNNYLsrecpycgshmiekeskkeggdgggteektkvndervekkPKALEKEEREVKMEGkemkeeeeDKDVVEKKRKRYLrvsggkdkdsrcqvr
vserndiktalefldesdliSIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIEkeskkeggdgggteektkvndervekkpkalekeerevkmegkemkeeeedkdvvekkrkrylrvsggkdkdsrcqvr
VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIekeskkeggdgggteektkVNDERVEKKPKALekeerevkmegkemkeeeedkdvvekkrkrYLRVSGGKDKDSRCQVR
********TALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLK************VRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQD******************************************************************************************************************
*****DIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVD**********************ANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQD********************NYLSRECPYCGSHMIEKESKKEGG******************************************************************C***
VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDM*********VRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQ***********EAVNNYLSRECPYCGSHMIEK******************************************************EKKRKRY****************
**ERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIEKES*****************************K**REVKMEGKEMKEEEEDKDVVEKKRKRYLRVS************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIEKESKKEGGDGGGTEEKTKVNDERVEKKPKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGGKDKDSRCQVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query233 2.2.26 [Sep-21-2011]
P59015974 Vacuolar protein sorting- yes N/A 0.716 0.171 0.389 3e-30
Q9P253973 Vacuolar protein sorting- yes N/A 0.755 0.180 0.372 7e-29
Q8R307973 Vacuolar protein sorting- yes N/A 0.523 0.125 0.450 1e-28
Q243141002 Vacuolar protein sorting- yes N/A 0.506 0.117 0.440 2e-24
P27801918 Vacuolar membrane protein yes N/A 0.472 0.119 0.285 7e-11
O74925900 Vacuolar membrane protein yes N/A 0.583 0.151 0.255 5e-10
>sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 103/177 (58%), Gaps = 10/177 (5%)

Query: 1   VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDM 60
           V E  D+K A+  L   +L+ IEDILPFF DF  +D FK AIC+SLE+YN+HI +LK++M
Sbjct: 764 VQEEKDVKKAMNCLSSCNLLKIEDILPFFPDFVTIDHFKEAICSSLEEYNKHIEELKQEM 823

Query: 61  SEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDL 120
            EAT SA+++R DIQ   N+Y ++++ + C  C+  L++  FY+F CGH FH  C++Q++
Sbjct: 824 EEATESAKRIREDIQEMRNKYGVVESQEKCATCDFPLLNRPFYLFLCGHMFHYDCLLQEV 883

Query: 121 DPE----QKAKLDSEETGSEAVNNYLSRECPYCGSHMIEKESKKEGGDGGGTEEKTK 173
            P     ++ KLD  +    A              H   +E     G G G+ E+ K
Sbjct: 884 IPHLSVYKQNKLDELQKKLAATTQTTK------ARHKPREEDTVSLGKGQGSREQIK 934
May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. May be involved in vesicle trafficking to the hepatocyte apical membrane and play a role in development of the intra-hepatic biliary tree. May target endosomes to the pigment granule in melanocytes. Essential for early embryonic development.
Danio rerio (taxid: 7955)
>sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 Back     alignment and function description
>sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 Back     alignment and function description
>sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 Back     alignment and function description
>sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP3 PE=1 SV=1 Back     alignment and function description
>sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
332024232 984 Vacuolar protein sorting-associated prot 0.665 0.157 0.461 1e-37
307171845 1002 Vacuolar protein sorting-associated prot 0.703 0.163 0.451 3e-37
307201923 1011 Vacuolar protein sorting-associated prot 0.665 0.153 0.461 4e-37
242017718 922 vacuolar protein sorting, putative [Pedi 0.682 0.172 0.430 2e-36
328776251 948 PREDICTED: vacuolar protein sorting-asso 0.665 0.163 0.451 2e-36
380027571 982 PREDICTED: vacuolar protein sorting-asso 0.665 0.157 0.451 2e-36
383848354 950 PREDICTED: vacuolar protein sorting-asso 0.665 0.163 0.456 8e-36
383848352 1000 PREDICTED: vacuolar protein sorting-asso 0.665 0.155 0.456 8e-36
350422090 952 PREDICTED: vacuolar protein sorting-asso 0.682 0.167 0.446 8e-36
340724948 1002 PREDICTED: vacuolar protein sorting-asso 0.682 0.158 0.446 9e-36
>gi|332024232|gb|EGI64436.1| Vacuolar protein sorting-associated protein 18-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (58%), Gaps = 29/184 (15%)

Query: 1   VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDM 60
           V E++DI+ A+EFL   DL+ IEDILPFFSDF  +D FK AIC SL++YNQHI DLKE+M
Sbjct: 781 VREKDDIQQAMEFLQHCDLVRIEDILPFFSDFVTIDHFKEAICNSLQEYNQHIQDLKEEM 840

Query: 61  SEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDL 120
            EAT++AE +R DIQA   R   +   DTC  CEVQL+   FY+FPCGH FHS C+V  L
Sbjct: 841 QEATKAAELIRKDIQAFRTRCTFVHARDTCNTCEVQLLLRPFYVFPCGHKFHSDCLVAAL 900

Query: 121 DP----EQKAKLDSEETGSEAVNN-------------------------YLSRECPYCGS 151
            P    +Q+ KL   +    A++N                          ++ EC YCG 
Sbjct: 901 TPMLSMDQRTKLADLQRQFTAISNRPEDTTSTTSVSLSTRDKIKTDIDELVASECLYCGE 960

Query: 152 HMIE 155
            MIE
Sbjct: 961 LMIE 964

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307171845|gb|EFN63500.1| Vacuolar protein sorting-associated protein 18-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307201923|gb|EFN81545.1| Vacuolar protein sorting-associated protein 18-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242017718|ref|XP_002429334.1| vacuolar protein sorting, putative [Pediculus humanus corporis] gi|212514237|gb|EEB16596.1| vacuolar protein sorting, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328776251|ref|XP_396968.3| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|380027571|ref|XP_003697495.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Apis florea] Back     alignment and taxonomy information
>gi|383848354|ref|XP_003699816.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383848352|ref|XP_003699815.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350422090|ref|XP_003493053.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724948|ref|XP_003400840.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
ZFIN|ZDB-GENE-020419-33974 vps18 "vacuolar protein sortin 0.523 0.125 0.475 7.6e-32
UNIPROTKB|E1BSK2974 VPS18 "Uncharacterized protein 0.553 0.132 0.451 4e-30
UNIPROTKB|F1SSU6973 VPS18 "Uncharacterized protein 0.523 0.125 0.450 4.5e-29
UNIPROTKB|A6QR33973 VPS18 "VPS18 protein" [Bos tau 0.523 0.125 0.450 5.8e-29
UNIPROTKB|Q9P253973 VPS18 "Vacuolar protein sortin 0.523 0.125 0.450 5.8e-29
UNIPROTKB|E2RAT8973 VPS18 "Uncharacterized protein 0.523 0.125 0.450 7.4e-29
MGI|MGI:2443626973 Vps18 "vacuolar protein sortin 0.523 0.125 0.450 7.4e-29
RGD|1311556973 Vps18 "vacuolar protein sortin 0.523 0.125 0.450 7.4e-29
DICTYBASE|DDB_G02699241077 vps18 "7-fold repeat in clathr 0.549 0.118 0.439 2.2e-28
FB|FBgn00004821002 dor "deep orange" [Drosophila 0.506 0.117 0.440 3.3e-25
ZFIN|ZDB-GENE-020419-33 vps18 "vacuolar protein sorting protein 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 7.6e-32, Sum P(2) = 7.6e-32
 Identities = 58/122 (47%), Positives = 86/122 (70%)

Query:     1 VSERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDM 60
             V E  D+K A+  L   +L+ IEDILPFF DF  +D FK AIC+SLE+YN+HI +LK++M
Sbjct:   764 VQEEKDVKKAMNCLSSCNLLKIEDILPFFPDFVTIDHFKEAICSSLEEYNKHIEELKQEM 823

Query:    61 SEATRSAEQVRNDIQACANRYHMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDL 120
              EAT SA+++R DIQ   N+Y ++++ + C  C+  L++  FY+F CGH FH  C++Q++
Sbjct:   824 EEATESAKRIREDIQEMRNKYGVVESQEKCATCDFPLLNRPFYLFLCGHMFHYDCLLQEV 883

Query:   121 DP 122
              P
Sbjct:   884 IP 885
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0007634 "optokinetic behavior" evidence=IMP
GO:0048757 "pigment granule maturation" evidence=IMP
GO:0048069 "eye pigmentation" evidence=IMP
GO:0015721 "bile acid and bile salt transport" evidence=IMP
GO:0043485 "endosome to pigment granule transport" evidence=IMP
GO:0008333 "endosome to lysosome transport" evidence=IMP
GO:0045176 "apical protein localization" evidence=IMP
GO:0005622 "intracellular" evidence=IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005764 "lysosome" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0005768 "endosome" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0031902 "late endosome membrane" evidence=IEA
GO:0005765 "lysosomal membrane" evidence=IEA
UNIPROTKB|E1BSK2 VPS18 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSU6 VPS18 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6QR33 VPS18 "VPS18 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P253 VPS18 "Vacuolar protein sorting-associated protein 18 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAT8 VPS18 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2443626 Vps18 "vacuolar protein sorting 18 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311556 Vps18 "vacuolar protein sorting 18 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269924 vps18 "7-fold repeat in clathrin and VPS proteins repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0000482 dor "deep orange" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
KOG2034|consensus911 100.0
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 99.83
KOG2114|consensus933 99.68
KOG2066|consensus846 99.25
PHA02929238 N1R/p28-like protein; Provisional 98.6
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.59
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.39
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.09
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.0
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.9
KOG4628|consensus348 97.9
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.83
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.78
PF1463444 zf-RING_5: zinc-RING finger domain 97.65
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.55
KOG1734|consensus328 97.54
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.54
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.43
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.4
KOG0317|consensus293 97.18
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.04
KOG0978|consensus698 97.03
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.01
PHA02926242 zinc finger-like protein; Provisional 96.94
KOG0802|consensus 543 96.94
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.89
KOG0320|consensus187 96.76
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.67
KOG1493|consensus84 96.61
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.6
KOG1941|consensus518 96.56
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.55
KOG2930|consensus114 96.51
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.47
KOG2063|consensus877 96.38
KOG0828|consensus636 96.25
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.15
KOG0804|consensus 493 96.09
KOG0827|consensus 465 96.02
KOG4445|consensus 368 95.76
KOG0823|consensus230 95.56
KOG2164|consensus 513 95.15
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 95.02
KOG2879|consensus298 94.73
KOG4739|consensus 233 94.65
KOG2177|consensus 386 94.45
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.1
COG52191525 Uncharacterized conserved protein, contains RING Z 94.03
KOG3268|consensus234 94.01
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 93.63
KOG3970|consensus 299 93.58
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 93.42
PHA02862156 5L protein; Provisional 93.41
PF04641260 Rtf2: Rtf2 RING-finger 93.33
KOG2079|consensus1206 93.22
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.32
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 91.13
COG5152259 Uncharacterized conserved protein, contains RING a 91.04
KOG0269|consensus839 91.03
KOG1039|consensus344 90.55
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 90.4
KOG1645|consensus 463 90.22
KOG2932|consensus 389 89.2
KOG1785|consensus563 88.54
KOG4159|consensus 398 88.16
KOG0287|consensus 442 87.46
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 87.2
KOG1428|consensus 3738 85.77
KOG4275|consensus350 85.35
PF09943101 DUF2175: Uncharacterized protein conserved in arch 85.28
KOG4692|consensus489 84.37
KOG1814|consensus 445 84.33
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 84.14
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 84.04
PF13901202 DUF4206: Domain of unknown function (DUF4206) 83.69
KOG0825|consensus 1134 83.35
KOG1813|consensus313 83.17
KOG0309|consensus1081 82.39
KOG4265|consensus349 81.23
KOG2660|consensus 331 80.84
>KOG2034|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-38  Score=314.80  Aligned_cols=163  Identities=39%  Similarity=0.784  Sum_probs=147.6

Q ss_pred             CCchhHHHHHHHHhhcCCCChhhhhhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCc
Q psy7337           2 SERNDIKTALEFLDESDLISIEDILPFFSDFTCMDQFKHAICASLEQYNQHIVDLKEDMSEATRSAEQVRNDIQACANRY   81 (233)
Q Consensus         2 ~~~~dI~~al~~l~es~~L~ieDLLp~fpd~v~I~~fKd~I~~sL~ey~~~Ie~lk~eie~~~~~~~~l~~el~~l~~r~   81 (233)
                      ++.+||+++|++|+++++|+|+|||||||+|++|++||++||++|++||.+|++++.+|.++++.+.+++++++.+++||
T Consensus       732 ~~~~~ikk~i~~Lk~~~lLkiedlLpffpdf~~id~~keaic~~L~~~n~rieel~~em~eat~~a~~I~~~~~~l~~ry  811 (911)
T KOG2034|consen  732 KQENDIKKAIRFLKENELLTIEDLLPFFPDFTKIDNLKEAICDFLEDYNKRIEELQEEMIEATELADEIRTEISKLRQRY  811 (911)
T ss_pred             HhhccHHHHHHHhccCcccchhhhhccccchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhcce
Confidence            45589999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCchhhhhhccCCCCeEEecCCCccchhhhhhcCChHHHhhcccc-----cc----chhhHhhhhhCCCCCCChh
Q psy7337          82 HMIQNCDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSE-----ET----GSEAVNNYLSRECPYCGSH  152 (233)
Q Consensus        82 ~iI~~~~~C~~C~~~L~~~~f~vFpCgH~FH~~CL~~~~~~~~~~~l~~~-----~t----~~~eld~ila~eCPlCG~~  152 (233)
                      .++.+++.|.+|+++|+..|||+|||||+||++||.+.+-+..-..+...     .+    .+++|++|++++||+||+.
T Consensus       812 ~v~ep~d~C~~C~~~ll~~pF~vf~CgH~FH~~Cl~~~v~~~~~~~~~~~~a~~l~~k~~~l~~~l~~iiaaeC~lCg~l  891 (911)
T KOG2034|consen  812 RVLEPQDSCDHCGRPLLIKPFYVFPCGHCFHRDCLIRHVLSLLSEELSQKTAIELQAKRKKLKNELEDIIAAECPLCGEL  891 (911)
T ss_pred             EEecCccchHHhcchhhcCcceeeeccchHHHHHHHHHHHccccHhhhhhhhhhhhhHHHHHHHHHHHHHHhhCccchHH
Confidence            99999999999999999999999999999999999987621110111110     11    4899999999999999999


Q ss_pred             hhhhhhccCCCC
Q psy7337         153 MIEKESKKEGGD  164 (233)
Q Consensus       153 ~i~~Id~pf~~~  164 (233)
                      +|+.||.||++|
T Consensus       892 ~I~~Id~Pf~~d  903 (911)
T KOG2034|consen  892 AINKIDQPFSDD  903 (911)
T ss_pred             HHHhccCCCCCc
Confidence            999999999998

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.69
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.57
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.55
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.55
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.46
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.45
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.45
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.43
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.4
2ect_A78 Ring finger protein 126; metal binding protein, st 98.39
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.35
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.31
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.3
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.3
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.29
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.27
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.25
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.23
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.2
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.18
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.17
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.16
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.15
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.1
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.04
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.01
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.98
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.98
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.97
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.91
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.88
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.88
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.87
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.85
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.81
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.81
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.73
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.69
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.63
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.58
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.58
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.44
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.29
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.24
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.21
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.18
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.18
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.15
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.09
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.8
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.78
2ea5_A68 Cell growth regulator with ring finger domain prot 96.7
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.68
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.53
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.5
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.4
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.33
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.28
3nw0_A238 Non-structural maintenance of chromosomes element 95.69
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 95.4
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.28
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.45
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 94.29
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 88.69
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 88.03
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 85.68
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 84.07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 83.78
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 82.93
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 82.79
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 81.4
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 81.14
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=98.69  E-value=2.8e-08  Score=79.11  Aligned_cols=43  Identities=28%  Similarity=0.675  Sum_probs=34.6

Q ss_pred             CCchhhhhhccCCCCeEEecCCCccchhhhhhcCChHHHhhccccccchhhHhhhhhCCCCCCCh
Q psy7337          87 CDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGS  151 (233)
Q Consensus        87 ~~~C~~C~~~L~~~~f~vFpCgH~FH~~CL~~~~~~~~~~~l~~~~t~~~eld~ila~eCPlCG~  151 (233)
                      ...|++|...+ ..| ++.||||.||..|+..|+..                    ...||+|+.
T Consensus        53 ~~~C~iC~~~~-~~~-~~~~CgH~fc~~Ci~~~~~~--------------------~~~CP~Cr~   95 (138)
T 4ayc_A           53 ELQCIICSEYF-IEA-VTLNCAHSFCSYCINEWMKR--------------------KIECPICRK   95 (138)
T ss_dssp             HSBCTTTCSBC-SSE-EEETTSCEEEHHHHHHHTTT--------------------CSBCTTTCC
T ss_pred             cCCCcccCccc-CCc-eECCCCCCccHHHHHHHHHc--------------------CCcCCCCCC
Confidence            35799999987 444 56799999999999999621                    368999986
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.83
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.57
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.46
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.34
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.31
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.3
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.25
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.12
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.05
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.97
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.65
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.63
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.44
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.35
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.17
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.37
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 93.66
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 89.75
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 89.48
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 88.09
d2co8a236 Nedd9 interacting protein with calponin homology, 86.96
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 86.31
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 85.85
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 85.21
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 83.88
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 83.67
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 83.08
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

Probab=98.83  E-value=3.9e-10  Score=78.59  Aligned_cols=61  Identities=25%  Similarity=0.482  Sum_probs=45.3

Q ss_pred             CCchhhhhhccCCCCeEEecCCCccchhhhhhcCChHHHhhccccccchhhHhhhhhCCCCCCChhhhhhhhccCCCCCC
Q psy7337          87 CDTCLLCEVQLVSNTFYIFPCGHTFHSHCIVQDLDPEQKAKLDSEETGSEAVNNYLSRECPYCGSHMIEKESKKEGGDGG  166 (233)
Q Consensus        87 ~~~C~~C~~~L~~~~f~vFpCgH~FH~~CL~~~~~~~~~~~l~~~~t~~~eld~ila~eCPlCG~~~i~~Id~pf~~~~~  166 (233)
                      ++.|++|...+ ..+.+.+||||.||..|+..|+.                    ...+||+|... +..+...+.+++.
T Consensus         5 ~d~C~IC~~~~-~~~~~~~~C~H~Fc~~Ci~~w~~--------------------~~~~CP~CR~~-i~~~~~~~~~~~~   62 (68)
T d1chca_           5 AERCPICLEDP-SNYSMALPCLHAFCYVCITRWIR--------------------QNPTCPLCKVP-VESVVHTIESDSE   62 (68)
T ss_dssp             CCCCSSCCSCC-CSCEEETTTTEEESTTHHHHHHH--------------------HSCSTTTTCCC-CCCEECCCCSCCC
T ss_pred             CCCCccCCcCc-cCCcEEeCCCCcCcHHHHHHHHH--------------------hCCcCCCCCcc-hHhhcccccCCCc
Confidence            47899999987 56778899999999999999961                    13799999874 3444455555554


Q ss_pred             Cch
Q psy7337         167 GTE  169 (233)
Q Consensus       167 ~~e  169 (233)
                      +.+
T Consensus        63 ~~~   65 (68)
T d1chca_          63 FGD   65 (68)
T ss_dssp             CSS
T ss_pred             cce
Confidence            443
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure