Psyllid ID: psy7340

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MLGVGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKTPKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTPQGTGSTQEHQKDSNPGLSEEVADEVVESGGDGGENTSTRGRGGGLRGHVMRGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccEEEEEEEEcccEEEcccccEEEEEccccEEEEEEEcccccEEEEEEEEccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHcccccccccEccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccccccccccccccccccHHHcHHEEEcccccccccccHEEEcccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccEccccEccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcEcccEEEcccccEEEEEcccEEEEEEEEcccccEEEEEEEcccccEEEEEEEcccccccccHHHHHHcccccccccccccEEEcccEEEEccccEEEEEEcc
mlgvggggasgeQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISnreekkssvktpkfwgqggsyvsiFPIRWairhstpyrpscrDAFLFIICEFILYQIHKTLFRLGifystpqgtgstqehqkdsnpglseEVADEVVesggdggentstrgrggglrghvmrggggasgeQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGvqgfvtddlgnpvekaslkikgrdvgfqttkygeFWRILLpgiyklevyadgyvpreIDFMVVEQHPTLLNVTLHTSKWLALWTsdlevggssptlgffpykVALDHGEALVNEEGCVLVQTLS
mlgvggggasgeqqKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISnreekkssvktpkfwgqggsYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTPQGTGSTQEHQKDSNPGLSEEVADEVvesggdggentstrgrggglrgHVMRGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGvqgfvtddlgnpvekaslkikgrdvgfqttkygefwriLLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
MLgvggggasgeqqkaaqerqeqIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKTPKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTPQGTGSTQEHQKDSNPGLseevadevvesggdggeNTSTrgrggglrghvmrggggasgeqqkaaqerqeqIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEkkssvkslvkFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
****************************************RARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQ*************PKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYS*****************************************************************************************RARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQ************SLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQ***
**********************************VLDQSARARLNTIMLCKPEKAQQIENMICQMAQ***********ELI**********************GQGGSYVSIFPIRW************RDAFLFIICEFILYQIHKTLFRLGIFYS***********************************************************************************VLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSK*******************FFPYKVALDHGEALVNEEGCVLVQTL*
***********************IKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISN*********TPKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTP**********************************NTSTRGRGGGLRGHVMR*******************IKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISN*********SLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
********************QEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNRE***SSVKTPKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTPQ************NPGLSEEVADEVVESGGDGGENTSTRGRGGGLRGHVMRGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSAR****TIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGVGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKTPKFWGQGGSYVSIFPIRWAIRHSTPYRPSCRDAFLFIICEFILYQIHKTLFRLGIFYSTPQGTGSTQEHQKDSNPGLSEEVADEVVESGGDGGENTSTRGRGGGLRGHVMRGGGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSSVKSLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADGYVPREIDFMVVEQHPTLLNVTLHTSKWLALWTSDLEVGGSSPTLGFFPYKVALDHGEALVNEEGCVLVQTLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
P56812126 Programmed cell death pro yes N/A 0.188 0.658 0.518 7e-16
Q2HJH9125 Programmed cell death pro yes N/A 0.188 0.664 0.518 1e-15
Q5RBT0125 Programmed cell death pro yes N/A 0.188 0.664 0.493 1e-14
O14737125 Programmed cell death pro yes N/A 0.188 0.664 0.493 1e-14
P16870476 Carboxypeptidase E OS=Hom no N/A 0.152 0.140 0.447 1e-11
Q4R4M3476 Carboxypeptidase E OS=Mac N/A N/A 0.152 0.140 0.447 1e-11
A5A6K7476 Carboxypeptidase E OS=Pan no N/A 0.152 0.140 0.447 1e-11
P04836475 Carboxypeptidase E OS=Bos no N/A 0.152 0.141 0.447 2e-11
P15087476 Carboxypeptidase E OS=Rat no N/A 0.152 0.140 0.447 2e-11
Q8IUX7 1158 Adipocyte enhancer-bindin no N/A 0.215 0.082 0.333 3e-11
>sp|P56812|PDCD5_MOUSE Programmed cell death protein 5 OS=Mus musculus GN=Pdcd5 PE=1 SV=3 Back     alignment and function desciption
 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 63/83 (75%)

Query: 16  AAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKL 75
           A QE +++  +M+NSIL+QVLDQSARARL+ + L KPEK + +EN + QMA+ GQ+  K+
Sbjct: 28  AQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKV 87

Query: 76  GENELIGLLEQISNREEKKSSVK 98
            E  LI +LE++S + EKK++VK
Sbjct: 88  SEQGLIEILEKVSQQTEKKTTVK 110
May function in the process of apoptosis.
Mus musculus (taxid: 10090)
>sp|Q2HJH9|PDCD5_BOVIN Programmed cell death protein 5 OS=Bos taurus GN=PDCD5 PE=2 SV=3 Back     alignment and function description
>sp|Q5RBT0|PDCD5_PONAB Programmed cell death protein 5 OS=Pongo abelii GN=PDCD5 PE=2 SV=3 Back     alignment and function description
>sp|O14737|PDCD5_HUMAN Programmed cell death protein 5 OS=Homo sapiens GN=PDCD5 PE=1 SV=3 Back     alignment and function description
>sp|P16870|CBPE_HUMAN Carboxypeptidase E OS=Homo sapiens GN=CPE PE=1 SV=1 Back     alignment and function description
>sp|Q4R4M3|CBPE_MACFA Carboxypeptidase E OS=Macaca fascicularis GN=CPE PE=2 SV=1 Back     alignment and function description
>sp|A5A6K7|CBPE_PANTR Carboxypeptidase E OS=Pan troglodytes GN=CPE PE=2 SV=1 Back     alignment and function description
>sp|P04836|CBPE_BOVIN Carboxypeptidase E OS=Bos taurus GN=CPE PE=1 SV=2 Back     alignment and function description
>sp|P15087|CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus GN=Cpe PE=1 SV=1 Back     alignment and function description
>sp|Q8IUX7|AEBP1_HUMAN Adipocyte enhancer-binding protein 1 OS=Homo sapiens GN=AEBP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
328721831 660 PREDICTED: carboxypeptidase M-like [Acyr 0.204 0.136 0.877 7e-42
270012709493 carboxypeptidase A [Tribolium castaneum] 0.204 0.182 0.844 1e-39
347964450495 AGAP000756-PB [Anopheles gambiae str. PE 0.236 0.210 0.711 3e-38
170072562533 carboxypeptidase D [Culex quinquefasciat 0.234 0.193 0.712 3e-38
242006217504 carboxypeptidase M precursor, putative [ 0.204 0.178 0.822 4e-38
347964448504 AGAP000756-PA [Anopheles gambiae str. PE 0.204 0.178 0.788 4e-38
312379694 1395 hypothetical protein AND_08372 [Anophele 0.204 0.064 0.788 6e-38
195446760474 GK25411 [Drosophila willistoni] gi|19416 0.209 0.194 0.782 6e-37
195393884517 GJ19439 [Drosophila virilis] gi|19415009 0.209 0.177 0.771 9e-37
195039526510 GH12395 [Drosophila grimshawi] gi|193900 0.204 0.176 0.8 1e-36
>gi|328721831|ref|XP_001942938.2| PREDICTED: carboxypeptidase M-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/90 (87%), Positives = 86/90 (95%)

Query: 305 SLVKFLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEV 364
           SLVKFLAEAHRGV GFV D+ GNP+EKASLKIKGRDVGFQTTKYGEFWRILLPG+YKLE+
Sbjct: 518 SLVKFLAEAHRGVHGFVMDEHGNPIEKASLKIKGRDVGFQTTKYGEFWRILLPGVYKLEI 577

Query: 365 YADGYVPREIDFMVVEQHPTLLNVTLHTSK 394
           Y DGY+P+E+DFMVVEQHPTLLNVTLHTSK
Sbjct: 578 YGDGYIPKEMDFMVVEQHPTLLNVTLHTSK 607

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270012709|gb|EFA09157.1| carboxypeptidase A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347964450|ref|XP_003437092.1| AGAP000756-PB [Anopheles gambiae str. PEST] gi|333467537|gb|EGK96595.1| AGAP000756-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170072562|ref|XP_001870207.1| carboxypeptidase D [Culex quinquefasciatus] gi|167868971|gb|EDS32354.1| carboxypeptidase D [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242006217|ref|XP_002423950.1| carboxypeptidase M precursor, putative [Pediculus humanus corporis] gi|212507220|gb|EEB11212.1| carboxypeptidase M precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|347964448|ref|XP_311292.4| AGAP000756-PA [Anopheles gambiae str. PEST] gi|333467536|gb|EAA06873.5| AGAP000756-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312379694|gb|EFR25889.1| hypothetical protein AND_08372 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195446760|ref|XP_002070913.1| GK25411 [Drosophila willistoni] gi|194166998|gb|EDW81899.1| GK25411 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195393884|ref|XP_002055583.1| GJ19439 [Drosophila virilis] gi|194150093|gb|EDW65784.1| GJ19439 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195039526|ref|XP_001990898.1| GH12395 [Drosophila grimshawi] gi|193900656|gb|EDV99522.1| GH12395 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
FB|FBgn0030778527 CG4678 [Drosophila melanogaste 0.2 0.166 0.772 2.2e-34
FB|FBgn0036580133 PDCD-5 "PDCD-5" [Drosophila me 0.168 0.556 0.546 3.4e-16
UNIPROTKB|Q2HJH9125 PDCD5 "Programmed cell death p 0.165 0.584 0.547 4.4e-16
UNIPROTKB|F1Q4K1111 PDCD5 "Uncharacterized protein 0.165 0.657 0.547 4.4e-16
UNIPROTKB|F1RNX2125 PDCD5 "Programmed cell death p 0.165 0.584 0.547 4.4e-16
UNIPROTKB|I3L5D0133 PDCD5 "Uncharacterized protein 0.165 0.548 0.547 4.4e-16
RGD|1310561125 Pdcd5 "programmed cell death 5 0.165 0.584 0.547 4.4e-16
ZFIN|ZDB-GENE-040426-980128 pdcd5 "programmed cell death 5 0.165 0.570 0.547 1.2e-15
UNIPROTKB|K7EL31111 PDCD5 "Programmed cell death p 0.165 0.657 0.520 5.9e-15
UNIPROTKB|O14737125 PDCD5 "Programmed cell death p 0.165 0.584 0.520 5.9e-15
FB|FBgn0030778 CG4678 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 68/88 (77%), Positives = 79/88 (89%)

Query:   309 FLAEAHRGVQGFVTDDLGNPVEKASLKIKGRDVGFQTTKYGEFWRILLPGIYKLEVYADG 368
             FLAEAHRGVQGFV D  G P+E+AS+KIKGRDVGFQTTKYGEFWRILLPG YK+EV+A+G
Sbjct:   374 FLAEAHRGVQGFVFDPAGMPIERASIKIKGRDVGFQTTKYGEFWRILLPGYYKVEVFAEG 433

Query:   369 YVPREIDFMVVEQHPTLLNVTLHTSKWL 396
             + PRE++F++VEQHPTLLNVTL  SK L
Sbjct:   434 FAPREVEFVIVEQHPTLLNVTLQPSKRL 461
GO:0004185 "serine-type carboxypeptidase activity" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004181 "metallocarboxypeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
FB|FBgn0036580 PDCD-5 "PDCD-5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJH9 PDCD5 "Programmed cell death protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q4K1 PDCD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNX2 PDCD5 "Programmed cell death protein 5" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5D0 PDCD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310561 Pdcd5 "programmed cell death 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-980 pdcd5 "programmed cell death 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|K7EL31 PDCD5 "Programmed cell death protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O14737 PDCD5 "Programmed cell death protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P56812PDCD5_MOUSENo assigned EC number0.51800.18860.6587yesN/A
Q2HJH9PDCD5_BOVINNo assigned EC number0.51800.18860.664yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
pfam01984105 pfam01984, dsDNA_bind, Double-stranded DNA-binding 1e-29
pfam01984105 pfam01984, dsDNA_bind, Double-stranded DNA-binding 1e-29
cd1130876 cd11308, Peptidase_M14NE-CP-C_like, Peptidase asso 8e-21
COG2118116 COG2118, COG2118, DNA-binding protein [General fun 5e-17
COG2118116 COG2118, COG2118, DNA-binding protein [General fun 5e-17
PRK04239110 PRK04239, PRK04239, hypothetical protein; Provisio 6e-17
PRK04239110 PRK04239, PRK04239, hypothetical protein; Provisio 6e-17
pfam1362081 pfam13620, CarboxypepD_reg, Carboxypeptidase regul 1e-10
pfam1371586 pfam13715, Cna_B_2, Cna protein B-type domain 3e-05
>gnl|CDD|216828 pfam01984, dsDNA_bind, Double-stranded DNA-binding domain Back     alignment and domain information 
 Score =  111 bits (279), Expect = 1e-29
 Identities = 37/91 (40%), Positives = 61/91 (67%)

Query: 8   GASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQ 67
               E+Q+  +E+Q+Q +  K +IL Q+L   AR RL+ I L KPE+A+ +EN + Q+AQ
Sbjct: 13  QGGLEEQQQQEEQQQQEEAQKQAILRQILTPEARERLSRIRLVKPERAEAVENQLIQLAQ 72

Query: 68  TGQIMNKLGENELIGLLEQISNREEKKSSVK 98
           +G+I  K+ E +L  +LEQI+ ++ KK+ +K
Sbjct: 73  SGRIRGKITEEQLKEILEQIAPQKRKKTKIK 103

This domain is believed to bind double-stranded DNA of 20 bases length. Length = 105
>gnl|CDD|216828 pfam01984, dsDNA_bind, Double-stranded DNA-binding domain Back     alignment and domain information
>gnl|CDD|200604 cd11308, Peptidase_M14NE-CP-C_like, Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain Back     alignment and domain information
>gnl|CDD|225029 COG2118, COG2118, DNA-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|225029 COG2118, COG2118, DNA-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|179798 PRK04239, PRK04239, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179798 PRK04239, PRK04239, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222268 pfam13620, CarboxypepD_reg, Carboxypeptidase regulatory-like domain Back     alignment and domain information
>gnl|CDD|222338 pfam13715, Cna_B_2, Cna protein B-type domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
KOG3431|consensus129 99.95
PRK04239110 hypothetical protein; Provisional 99.94
PF01984107 dsDNA_bind: Double-stranded DNA-binding domain; In 99.93
COG2118116 DNA-binding protein [General function prediction o 99.92
PRK04239110 hypothetical protein; Provisional 99.87
KOG3431|consensus129 99.85
PF01984107 dsDNA_bind: Double-stranded DNA-binding domain; In 99.84
COG2118116 DNA-binding protein [General function prediction o 99.83
PF1371588 DUF4480: Domain of unknown function (DUF4480) 99.58
cd03863375 M14_CPD_II The second carboxypeptidase (CP)-like d 99.51
cd03864392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als 99.41
cd06245363 M14_CPD_III The third carboxypeptidase (CP)-like d 99.4
cd03865402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C 99.4
PF1362082 CarboxypepD_reg: Carboxypeptidase regulatory-like 99.29
cd03867395 M14_CPZ Peptidase M14-like domain of carboxypeptid 99.23
cd03868372 M14_CPD_I The first carboxypeptidase (CP)-like dom 99.2
KOG2649|consensus500 99.19
cd03869405 M14_CPX_like Peptidase M14-like domain of carboxyp 99.14
cd03858374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 99.14
cd03866376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM 99.12
PF08400134 phage_tail_N: Prophage tail fibre N-terminal; Inte 97.85
PRK15036137 hydroxyisourate hydrolase; Provisional 97.16
PF0830871 PEGA: PEGA domain; InterPro: IPR013229 This domain 96.77
cd00421146 intradiol_dioxygenase Intradiol dioxygenases catal 96.45
PF0721085 DUF1416: Protein of unknown function (DUF1416); In 96.36
PF02369100 Big_1: Bacterial Ig-like domain (group 1); InterPr 95.75
KOG1948|consensus 1165 95.16
PF1468695 fn3_3: Polysaccharide lyase family 4, domain II; P 95.12
cd03458256 Catechol_intradiol_dioxygenases Catechol intradiol 94.81
smart0063492 BID_1 Bacterial Ig-like domain (group 1). 94.79
cd03462247 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) 94.49
TIGR02465246 chlorocat_1_2 chlorocatechol 1,2-dioxygenase. Memb 94.45
PF00775183 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 Th 94.44
TIGR02439285 catechol_proteo catechol 1,2-dioxygenase, proteoba 94.32
cd03463185 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4 94.25
cd03459158 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) 94.12
cd03460282 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyz 93.96
COG3485226 PcaH Protocatechuate 3,4-dioxygenase beta subunit 93.56
TIGR02438281 catachol_actin catechol 1,2-dioxygenase, Actinobac 93.55
TIGR02423193 protocat_alph protocatechuate 3,4-dioxygenase, alp 93.38
cd03464220 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4- 93.03
TIGR02422220 protocat_beta protocatechuate 3,4-dioxygenase, bet 92.99
cd03461277 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) ca 92.92
PF0573870 Cna_B: Cna protein B-type domain; InterPro: IPR008 92.61
PF10670215 DUF4198: Domain of unknown function (DUF4198) 91.65
PF09430123 DUF2012: Protein of unknown function (DUF2012); In 91.19
PF12866222 DUF3823: Protein of unknown function (DUF3823); In 90.58
TIGR02962112 hdxy_isourate hydroxyisourate hydrolase. Members o 89.33
KOG1948|consensus 1165 88.69
PF0119097 Pollen_Ole_e_I: Pollen proteins Ole e I like; Inte 88.07
PF1197497 MG1: Alpha-2-macroglobulin MG1 domain; InterPro: I 87.49
PF12985104 DUF3869: Domain of unknown function (DUF3869); Int 86.51
COG5266264 CbiK ABC-type Co2+ transport system, periplasmic c 84.57
PF00576112 Transthyretin: HIUase/Transthyretin family; InterP 81.28
>KOG3431|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.9e-28  Score=212.81  Aligned_cols=96  Identities=51%  Similarity=0.729  Sum_probs=85.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHhhhccccCchHHHHHHHHHHHHHHcCCCCCCCCHHHHHHHHH
Q psy7340           6 GGGASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLE   85 (440)
Q Consensus         6 ~~~~~~e~~~~~~~~~~~~e~~~~~~L~qiL~~eAreRL~~i~lvkPe~a~~vE~~li~~aq~G~i~~kv~e~~l~~iL~   85 (440)
                      ||++++.++++.+++++ ++|||++||+|||++.||+||+||+|||||||++||+|||+||++|||.+||||++||.||+
T Consensus        21 G~~~~~~~q~a~q~~~~-q~e~r~~~lsQvLdqqAr~RLsrlAlvkpekAq~VE~~lirma~~gQvs~Kise~~lisiLe   99 (129)
T KOG3431|consen   21 GGANDAAQQQANQEQQE-QEEMRQSMLSQVLDQQARERLSRLALVKPEKAQAVENYLIRMAQTGQVSHKISEAELISILE   99 (129)
T ss_pred             CCCccccccchhhhhhh-HHHHHHhHHHHHhhHHHHHHHHhhhhcCHHHHHHHHHHHHHHHHhCCccccccHHHHHHHHH
Confidence            34444555666665555 89999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhhhhh-cccceeEeccc
Q psy7340          86 QISNRE-EKKSSVKTPKF  102 (440)
Q Consensus        86 ~i~~~~-~~~~~vk~~~~  102 (440)
                      +|+.++ ++.++|||..+
T Consensus       100 ~is~Qt~qk~tkV~f~RR  117 (129)
T KOG3431|consen  100 KISAQTNQKNTKVKFDRR  117 (129)
T ss_pred             HHHHhhccccceeeeecc
Confidence            999998 88999998544

>PRK04239 hypothetical protein; Provisional Back     alignment and domain information
>PF01984 dsDNA_bind: Double-stranded DNA-binding domain; InterPro: IPR002836 This protein family is found in archaea and eukaryota Back     alignment and domain information
>COG2118 DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK04239 hypothetical protein; Provisional Back     alignment and domain information
>KOG3431|consensus Back     alignment and domain information
>PF01984 dsDNA_bind: Double-stranded DNA-binding domain; InterPro: IPR002836 This protein family is found in archaea and eukaryota Back     alignment and domain information
>COG2118 DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF13715 DUF4480: Domain of unknown function (DUF4480) Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>KOG2649|consensus Back     alignment and domain information
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PF08400 phage_tail_N: Prophage tail fibre N-terminal; InterPro: IPR013609 This entry represents the N terminus of phage 933W tail fibre protein Back     alignment and domain information
>PRK15036 hydroxyisourate hydrolase; Provisional Back     alignment and domain information
>PF08308 PEGA: PEGA domain; InterPro: IPR013229 This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins Back     alignment and domain information
>cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates Back     alignment and domain information
>PF07210 DUF1416: Protein of unknown function (DUF1416); InterPro: IPR010814 This family consists of several hypothetical bacterial proteins of around 100 residues in length Back     alignment and domain information
>PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>PF14686 fn3_3: Polysaccharide lyase family 4, domain II; PDB: 1NKG_A 2XHN_B 3NJX_A 3NJV_A Back     alignment and domain information
>cd03458 Catechol_intradiol_dioxygenases Catechol intradiol dioxygenases can be divided into several subgroups according to their substrate specificity for catechol, chlorocatechols and hydroxyquinols Back     alignment and domain information
>smart00634 BID_1 Bacterial Ig-like domain (group 1) Back     alignment and domain information
>cd03462 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) (type II enzymes) are homodimeric intradiol dioxygenases that degrade chlorocatechols via the addition of molecular oxygen and the subsequent cleavage between two adjacent hydroxyl groups Back     alignment and domain information
>TIGR02465 chlorocat_1_2 chlorocatechol 1,2-dioxygenase Back     alignment and domain information
>PF00775 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 This entry represents the C-terminal domain common to several intradiol ring-cleavage dioxygenases Back     alignment and domain information
>TIGR02439 catechol_proteo catechol 1,2-dioxygenase, proteobacterial Back     alignment and domain information
>cd03463 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4-PCD) , alpha subunit Back     alignment and domain information
>cd03459 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate Back     alignment and domain information
>cd03460 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyzes an intradiol cleavage reaction of catechol to form cis,cis-muconate Back     alignment and domain information
>COG3485 PcaH Protocatechuate 3,4-dioxygenase beta subunit [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02438 catachol_actin catechol 1,2-dioxygenase, Actinobacterial Back     alignment and domain information
>TIGR02423 protocat_alph protocatechuate 3,4-dioxygenase, alpha subunit Back     alignment and domain information
>cd03464 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4-PCD) , beta subunit Back     alignment and domain information
>TIGR02422 protocat_beta protocatechuate 3,4-dioxygenase, beta subunit Back     alignment and domain information
>cd03461 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes the ring cleavage of hydroxyquinol (1,2,4-trihydroxybenzene), a intermediate in the degradation of a large variety of aromatic compounds including some polychloro- and nitroaromatic pollutants, to form 3-hydroxy-cis,cis-muconates Back     alignment and domain information
>PF05738 Cna_B: Cna protein B-type domain; InterPro: IPR008454 This entry represents a repeated B region domain found in the collagen-binding surface protein Cna in Staphylococcus aureus, as well as other related domains Back     alignment and domain information
>PF10670 DUF4198: Domain of unknown function (DUF4198) Back     alignment and domain information
>PF09430 DUF2012: Protein of unknown function (DUF2012); InterPro: IPR019008 This domain is found in different proteins, including uncharacterised protein family UPF0480 and nodal modulators Back     alignment and domain information
>PF12866 DUF3823: Protein of unknown function (DUF3823); InterPro: IPR024278 This is a family of uncharacterised proteins from Bacteroidetes Back     alignment and domain information
>TIGR02962 hdxy_isourate hydroxyisourate hydrolase Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>PF01190 Pollen_Ole_e_I: Pollen proteins Ole e I like; InterPro: IPR006041 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information
>PF11974 MG1: Alpha-2-macroglobulin MG1 domain; InterPro: IPR021868 This is the N-terminal MG1 domain from alpha-2-macroglobulin [] Back     alignment and domain information
>PF12985 DUF3869: Domain of unknown function (DUF3869); InterPro: IPR024620 This functionally uncharacterised domain is found in bacterial sequences, including the N-terminal region of a putative pore-forming toxin (YP_001301288 Back     alignment and domain information
>COG5266 CbiK ABC-type Co2+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00576 Transthyretin: HIUase/Transthyretin family; InterPro: IPR023416 This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
2cru_A118 Solution Structure Of Programmed Cell Death 5 Lengt 3e-15
2cru_A118 Solution Structure Of Programmed Cell Death 5 Lengt 1e-13
2k6b_A113 Solution Structure Of 1-112 Fragment Of Human Progr 4e-15
2k6b_A113 Solution Structure Of 1-112 Fragment Of Human Progr 2e-13
2nsm_A439 Crystal Structure Of The Human Carboxypeptidase N ( 4e-09
3mn8_A435 Structure Of Drosophila Melanogaster Carboxypeptida 4e-08
1uwy_A426 Crystal Structure Of Human Carboxypeptidase M Lengt 2e-06
1qmu_A380 Duck Carboxypeptidase D Domain Ii Length = 380 2e-05
1eij_A80 Nmr Ensemble Of Methanobacterium Thermoautotrophicu 2e-04
1eij_A80 Nmr Ensemble Of Methanobacterium Thermoautotrophicu 2e-04
>pdb|2CRU|A Chain A, Solution Structure Of Programmed Cell Death 5 Length = 118 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (76%)
Query: 26  DMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLE 85
           +M+NSIL+QVLDQSARARL+ + L KPEK + +EN + QMA+ GQ+  K+ E  LI +L+
Sbjct: 37  EMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILK 96
Query: 86  QISNREEKKSSVK 98
           ++S + EK ++VK
Sbjct: 97  KVSQQTEKTTTVK 109
>pdb|2CRU|A Chain A, Solution Structure Of Programmed Cell Death 5 Length = 118 Back     alignment and structure
>pdb|2K6B|A Chain A, Solution Structure Of 1-112 Fragment Of Human Programmed Cell Death 5 Protein Length = 113 Back     alignment and structure
>pdb|2K6B|A Chain A, Solution Structure Of 1-112 Fragment Of Human Programmed Cell Death 5 Protein Length = 113 Back     alignment and structure
>pdb|2NSM|A Chain A, Crystal Structure Of The Human Carboxypeptidase N (kininase I) Catalytic Domain Length = 439 Back     alignment and structure
>pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short Length = 435 Back     alignment and structure
>pdb|1UWY|A Chain A, Crystal Structure Of Human Carboxypeptidase M Length = 426 Back     alignment and structure
>pdb|1QMU|A Chain A, Duck Carboxypeptidase D Domain Ii Length = 380 Back     alignment and structure
>pdb|1EIJ|A Chain A, Nmr Ensemble Of Methanobacterium Thermoautotrophicum Protein 1615 Length = 80 Back     alignment and structure
>pdb|1EIJ|A Chain A, Nmr Ensemble Of Methanobacterium Thermoautotrophicum Protein 1615 Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
2cru_A118 Programmed cell death protein 5; three helix bundl 99.96
2fh0_A81 Hypothetical 16.0 kDa protein in ABF2-CHL12 interg 99.94
2jxn_A127 Uncharacterized protein YMR074C; YMR074CP, PDCD5-l 99.94
1eij_A80 Hypothetical protein MTH1615; beta-helix, structur 99.94
2hvu_A116 PDCD5-like protein; YMR074CP, solution structure, 99.93
2cru_A118 Programmed cell death protein 5; three helix bundl 99.89
2jxn_A127 Uncharacterized protein YMR074C; YMR074CP, PDCD5-l 99.85
2hvu_A116 PDCD5-like protein; YMR074CP, solution structure, 99.83
2fh0_A81 Hypothetical 16.0 kDa protein in ABF2-CHL12 interg 99.82
1eij_A80 Hypothetical protein MTH1615; beta-helix, structur 99.82
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 99.42
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 99.41
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 99.36
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 99.31
1nkg_A 508 Rhamnogalacturonase B; polysaccharide lyase, carbo 97.47
3e8v_A82 Possible transglutaminase-family protein; structur 96.61
2xsu_A312 Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE 96.15
3kcp_A321 Cellulosomal-scaffolding protein A; dockerin, X-mo 95.95
2boy_A254 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxi 95.56
2azq_A311 Catechol 1,2-dioxygenase; CTD, lipid, isozyme, int 95.54
3th1_A260 Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxy 95.14
1dmh_A311 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydroc 94.49
1tmx_A293 Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidor 94.34
3o5u_A257 Chlorocatechol 1,2-dioxygenase; beta barrel,oxidor 93.96
3n9t_A290 PNPC; phospholipid binds, N-terminal helix tunnel, 93.9
3hhy_A280 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, 93.56
2bum_A209 Protocatechuate 3,4-dioxygenase alpha chain; oxido 93.53
2bum_B241 Protocatechuate 3,4-dioxygenase beta chain; oxidor 93.21
3irp_X429 URO-adherence factor A; DEV-IGG fold, cell WALL, h 92.13
3t63_M238 3,4-PCD, protocatechuate 3,4-dioxygenase beta chai 91.51
3t63_A200 3,4-PCD, protocatechuate 3,4-dioxygenase alpha cha 91.36
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 87.56
1cwv_A 492 Invasin; integrin-binding protein, INV gene, struc 85.83
3g3l_A 327 Putative uncharacterized membrane-associated PROT; 82.83
3qva_A116 Transthyretin-like protein; transthyretin-related 82.66
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 80.67
4eiu_A249 Uncharacterized hypothetical protein; PF12866 fami 80.52
>2cru_A Programmed cell death protein 5; three helix bundle, apoptosis, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.6.1 PDB: 2k6b_A Back     alignment and structure
Probab=99.96  E-value=2.3e-29  Score=218.77  Aligned_cols=90  Identities=46%  Similarity=0.637  Sum_probs=81.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcCHHHHHHhhhccccCchHHHHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHhhhhhccc
Q psy7340          15 KAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKK   94 (440)
Q Consensus        15 ~~~~~~~~~~e~~~~~~L~qiL~~eAreRL~~i~lvkPe~a~~vE~~li~~aq~G~i~~kv~e~~l~~iL~~i~~~~~~~   94 (440)
                      +++++++++++++|++||+||||||||+||+||+|||||+|++||+|||+|||+|+|++||||++||+||++|+.++.++
T Consensus        26 ~~~e~~~~~~ee~r~~iL~qiLtpeAreRL~rI~lVKPEkA~~VE~~LI~lAq~Gqi~~kItee~Lk~lL~~i~~~~~~~  105 (118)
T 2cru_A           26 AAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT  105 (118)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHBCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHTCCCSCBCHHHHHHHHHHHTTSCCCC
T ss_pred             hHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHhhhhcCHHHHHHHHHHHHHHHHcCCCCCCcCHHHHHHHHHHHHhccCCC
Confidence            44556677889999999999999999999999999999999999999999999999999999999999999999877777


Q ss_pred             ceeEeccc-cC
Q psy7340          95 SSVKTPKF-WG  104 (440)
Q Consensus        95 ~~vk~~~~-~~  104 (440)
                      ++|+|... |+
T Consensus       106 ~~i~i~Rr~~~  116 (118)
T 2cru_A          106 TTVKFNRSGPS  116 (118)
T ss_dssp             CCCCCCCCCCC
T ss_pred             ceeEeeecCCC
Confidence            77777544 54
>2fh0_A Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic region; ensemble, YMR074CP, unknown function; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jxn_A Uncharacterized protein YMR074C; YMR074CP, PDCD5-like protein, phosphoprotein, unknown functi; HET: MTN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1eij_A Hypothetical protein MTH1615; beta-helix, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: a.5.6.1 Back     alignment and structure
>2cru_A Programmed cell death protein 5; three helix bundle, apoptosis, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.6.1 PDB: 2k6b_A Back     alignment and structure
>2jxn_A Uncharacterized protein YMR074C; YMR074CP, PDCD5-like protein, phosphoprotein, unknown functi; HET: MTN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fh0_A Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic region; ensemble, YMR074CP, unknown function; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1eij_A Hypothetical protein MTH1615; beta-helix, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: a.5.6.1 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin, LY; 1.50A {Aspergillus aculeatus} SCOP: b.3.1.2 b.18.1.25 b.30.5.10 PDB: 2xhn_A* 3njv_A* 3njx_A Back     alignment and structure
>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2xsu_A Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE; 1.60A {Acinetobacter radioresistens} PDB: 2xsr_A* 2xsv_A* Back     alignment and structure
>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 3p0d_C 4fl4_C 2b59_B Back     alignment and structure
>2boy_A 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: BHO LPP; 1.9A {Rhodococcus opacus} Back     alignment and structure
>2azq_A Catechol 1,2-dioxygenase; CTD, lipid, isozyme, intradiol, oxido; HET: PCF; 2.65A {Pseudomonas putida} Back     alignment and structure
>3th1_A Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxygenase family, oxidoreductase, iron bindin; HET: 3PH GOL; 3.40A {Pseudomonas putida} Back     alignment and structure
>1dmh_A 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydrocarbon degradation, alpha/beta FO metalloenzyme, substrate, oxidoreductase; HET: LIO; 1.70A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1dlq_A* 1dlm_A* 1dlt_A* Back     alignment and structure
>1tmx_A Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: HGX; 1.75A {Pimelobacter simplex} Back     alignment and structure
>3o5u_A Chlorocatechol 1,2-dioxygenase; beta barrel,oxidoreductase, oxidoreductase; HET: MYY DHB; 2.35A {Rhodococcus opacus} PDB: 3o32_A* 1s9a_A* 3o6j_A* 3o6r_A* Back     alignment and structure
>3n9t_A PNPC; phospholipid binds, N-terminal helix tunnel, oxidoreductase; HET: HGX FLC; 2.00A {Pseudomonas putida} Back     alignment and structure
>3hhy_A 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, aromatic hydrocarbons catabolism, dioxygenase metal-binding, oxidoreductase; HET: 6PL; 1.55A {Rhodococcus opacus} PDB: 3hhx_A* 3hgi_A* 3hj8_A* 3hjq_A* 3hjs_A* 3i4v_A* 3hkp_A* 3i51_A* 3i4y_A* Back     alignment and structure
>2bum_A Protocatechuate 3,4-dioxygenase alpha chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_A 1eob_A* 1eoc_A* 1eoa_A 2buq_A 2bur_A* 2but_A 2buu_A* 2buv_A* 2buw_A* 1eo9_A 2bux_A 2buy_A 2buz_A* 2bv0_A* Back     alignment and structure
>2bum_B Protocatechuate 3,4-dioxygenase beta chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_B 1eoa_B 1eob_B* 1eoc_B* 1eo9_B 2buq_B 2bur_B* 2bux_B 2buy_B 2buz_B* 2bv0_B* 2buu_B* 2but_B* 2buv_B* 2buw_B* Back     alignment and structure
>3irp_X URO-adherence factor A; DEV-IGG fold, cell WALL, hemagglutinin, peptidoglycan-anchor secreted, virulence, cell adhesion; 1.50A {Staphylococcus saprophyticus subsp} PDB: 3irz_A 3is0_X 3is1_X Back     alignment and structure
>3t63_M 3,4-PCD, protocatechuate 3,4-dioxygenase beta chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 3mi1_M* 3mv4_M* 3mi5_M* 3mfl_M* 3mv6_M* 3t67_M 3pca_M* 3pcb_M* 2pcd_M* 3pce_M* 3pcf_M* 3pcc_M* 3pch_M* 3pci_M* 3pcj_M* 3pck_M* 3pcl_M* 3pcm_M* 3pcn_M* 3pcg_M ... Back     alignment and structure
>3t63_A 3,4-PCD, protocatechuate 3,4-dioxygenase alpha chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 1ykl_A* 1ykm_A* 1ykn_A* 1yko_A* 1ykp_A* 2pcd_A 1ykk_A* 3lmx_A* 3lxv_A* 3mfl_A* 3mi1_A* 3mi5_A* 3lkt_A* 3mv6_A* 3pca_A* 3pcb_A* 3pcc_A* 3pcd_A 3pce_A* 3pcf_A* ... Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>3g3l_A Putative uncharacterized membrane-associated PROT; YP_211325.1, putative membrane-associated protein of unknown function; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qva_A Transthyretin-like protein; transthyretin-related protein, 5-hydroxyisourate hydrolase,; HET: PO4; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>4eiu_A Uncharacterized hypothetical protein; PF12866 family protein, DUF3823, structural genomics, joint for structural genomics, JCSG; HET: PGE; 1.90A {Bacteroides uniformis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d2crua1105 a.5.6.1 (A:8-112) Programmed cell death protein 5 1e-29
d2crua1105 a.5.6.1 (A:8-112) Programmed cell death protein 5 1e-29
d1eija_72 a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeo 7e-24
d1eija_72 a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeo 7e-24
d1h8la179 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal 1e-10
d1uwya1107 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal 1e-08
d1nkga187 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, m 3e-04
>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: Double-stranded DNA-binding domain
family: Double-stranded DNA-binding domain
domain: Programmed cell death protein 5
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  109 bits (273), Expect = 1e-29
 Identities = 41/90 (45%), Positives = 61/90 (67%)

Query: 9   ASGEQQKAAQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQT 68
                  A QE + +  +M+NSIL+QVLDQSARARL+ + L KPEK + +EN + QMA+ 
Sbjct: 13  HGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARY 72

Query: 69  GQIMNKLGENELIGLLEQISNREEKKSSVK 98
           GQ+  K+ E  LI +L+++S + EK ++VK
Sbjct: 73  GQLSEKVSEQGLIEILKKVSQQTEKTTTVK 102
>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 72 Back     information, alignment and structure
>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 72 Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 79 Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d2crua1105 Programmed cell death protein 5 {Human (Homo sapie 99.95
d1eija_72 Hypothetical protein MTH1615 {Archaeon Methanobact 99.92
d2crua1105 Programmed cell death protein 5 {Human (Homo sapie 99.88
d1eija_72 Hypothetical protein MTH1615 {Archaeon Methanobact 99.81
d1h8la179 Carboxypeptidase D C-terminal domain {Crested duck 99.54
d1uwya1107 Carboxypeptidase M C-terminal domain {Human (Homo 99.41
d1nkga187 Rhamnogalacturonase B, RhgB, middle domain {Asperg 99.3
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal do 98.86
d2b59b296 Cellulosomal scaffolding protein A {Clostridium th 96.54
d3pcca_200 Protocatechuate-3,4-dioxygenase, alpha chain {Pseu 95.03
d1dmha_309 Catechol 1,2-dioxygenase {Acinetobacter calcoaceti 94.98
d1s9aa_256 Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus 94.84
d1cwva194 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 94.53
d2burb1238 Protocatechuate-3,4-dioxygenase, beta chain {Acine 94.53
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 94.4
d3pccm_236 Protocatechuate-3,4-dioxygenase, beta chain {Pseud 93.37
d2bura1202 Protocatechuate-3,4-dioxygenase, alpha chain {Acin 92.59
d1f00i195 Intimin {Escherichia coli [TaxId: 562]} 89.51
d1cwva3103 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 89.43
>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: Double-stranded DNA-binding domain
family: Double-stranded DNA-binding domain
domain: Programmed cell death protein 5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=3.4e-29  Score=211.84  Aligned_cols=84  Identities=48%  Similarity=0.693  Sum_probs=78.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhcCHHHHHHhhhccccCchHHHHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHhhhhhcccce
Q psy7340          17 AQERQEQIKDMKNSILSQVLDQSARARLNTIMLCKPEKAQQIENMICQMAQTGQIMNKLGENELIGLLEQISNREEKKSS   96 (440)
Q Consensus        17 ~~~~~~~~e~~~~~~L~qiL~~eAreRL~~i~lvkPe~a~~vE~~li~~aq~G~i~~kv~e~~l~~iL~~i~~~~~~~~~   96 (440)
                      +++++++++++|++||++|||||||+||+||+|||||+|++||+|||+||++|+|++||||++||+||++|+.+++++++
T Consensus        21 ~~e~~~~~ee~k~~iL~qiLt~eAreRL~rI~lvkPe~A~~VE~~liqlaq~G~i~~kisd~~Lk~iL~~is~~~~~~~~  100 (105)
T d2crua1          21 QQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTT  100 (105)
T ss_dssp             HHHHHHHHHHHHHHHHHHHBCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHTCCCSCBCHHHHHHHHHHHTTSCCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHhhcccCHHHHHHHHHHHHHHHHcCCCCCCcCHHHHHHHHHHHhhcccccCc
Confidence            34555667899999999999999999999999999999999999999999999999999999999999999999888888


Q ss_pred             eEec
Q psy7340          97 VKTP  100 (440)
Q Consensus        97 vk~~  100 (440)
                      |||.
T Consensus       101 ik~~  104 (105)
T d2crua1         101 VKFN  104 (105)
T ss_dssp             CCCC
T ss_pred             cccC
Confidence            8874
>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3pcca_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dmha_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]} Back     information, alignment and structure
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2burb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d3pccm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bura1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure