Psyllid ID: psy7357


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHcccEEEEccccHHHHHccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccccHHHHHHHHccc
cccccHHccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHcccEEEccEEcccccEEcccHHHHHHHHHHHHHEEEEEccccccccHHHHHHHHHHHHHcccEEEEcccccccEEcccccccccccccHEccccEEEccccccccccccHcHHHHccccccccccccccccccEEEccccccccHHHHHHHHHHHHHccccEEEEccccccEEEEEEEEccHHHHHccccHHHHHHHHHcc
mklnattemipcsfpqltnmhpfipqdqaRGYEQLIGELETDlceitgydkisfqpnsgaqgeyaGLRAIQCYHQAqdahhrnvclipvsahgtnpasaqmagmsvepvsvrkdgtidfsdLETKVKKNKETLSCLMitypstfgvfEENITDVCELIHEhggqvyldganmnaqvglcrpgdygsdvshlnlhktfciphggggpgmgpigvkshlapflpvhplssidssigavsaahygsasilPISWAYIRRLESHYKTLfrssrsglvahEFVIDVRDFKKSANIEAVDIAKRLMDY
MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKdgtidfsdletkvkknketlsCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLfrssrsglvAHEFvidvrdfkksanieaVDIAKRLMDY
MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIphggggpgmgpigVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
*********IPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSA*************************IDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDI*******
MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSS*****GAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
********MIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
*******EMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSSIGAVSAAHYGSASILPISWAYIRRLESHYKTLFRSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
P15505 1004 Glycine dehydrogenase [de yes N/A 0.996 0.299 0.657 1e-115
P23378 1020 Glycine dehydrogenase [de yes N/A 0.996 0.295 0.639 1e-111
Q91W43 1025 Glycine dehydrogenase [de yes N/A 0.996 0.293 0.636 1e-111
Q92Q11 954 Glycine dehydrogenase [de yes N/A 0.986 0.312 0.617 1e-100
Q89I86 955 Glycine dehydrogenase [de yes N/A 0.996 0.315 0.584 7e-99
A6U8Q3 954 Glycine dehydrogenase [de yes N/A 0.986 0.312 0.611 1e-98
A9I7K9 957 Glycine dehydrogenase [de yes N/A 0.996 0.314 0.580 7e-98
Q8UFD6 954 Glycine dehydrogenase [de yes N/A 0.986 0.312 0.589 1e-97
A6TDR5 957 Glycine dehydrogenase [de yes N/A 0.996 0.314 0.564 2e-97
A1RFY8 962 Glycine dehydrogenase [de yes N/A 0.996 0.312 0.585 6e-97
>sp|P15505|GCSP_CHICK Glycine dehydrogenase [decarboxylating], mitochondrial OS=Gallus gallus GN=GLDC PE=1 SV=2 Back     alignment and function desciption
 Score =  413 bits (1062), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/330 (65%), Positives = 253/330 (76%), Gaps = 29/330 (8%)

Query: 1   MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
           MKLN++ E+ P S+ +  N+HPF+P DQA+GY+QL  +LE DLCEITGYDKISFQPNSGA
Sbjct: 544 MKLNSSAELAPISWKEFANIHPFVPLDQAQGYQQLFKDLEKDLCEITGYDKISFQPNSGA 603

Query: 61  QGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFS 120
           QGEYAGL AI+ Y  A+   HR+VCLIP SAHGTNPASAQMAGM ++P+ V K+G+ID S
Sbjct: 604 QGEYAGLAAIKAYLNAKGERHRSVCLIPRSAHGTNPASAQMAGMKIQPIEVDKNGSIDIS 663

Query: 121 DLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCR 180
            L+  V K+KE L+ +MITYPST GVFEE I DVC+LIH+HGGQVYLDGANMNAQVGLCR
Sbjct: 664 HLKAMVDKHKENLAAIMITYPSTNGVFEEEIGDVCDLIHKHGGQVYLDGANMNAQVGLCR 723

Query: 181 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDSS-----IGA 235
           PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVK HLAP+LP HP+  I +      +G 
Sbjct: 724 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIKIQTDKDACPLGT 783

Query: 236 VSAAHYGSASILPISWAYI-----------------------RRLESHYKTLFRSSRSGL 272
           VSAA +GS++ILPISW YI                       +RLE HYK LFR  R G 
Sbjct: 784 VSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRLEKHYKILFRGVR-GY 842

Query: 273 VAHEFVIDVRDFKKSANIEAVDIAKRLMDY 302
           VAHEF++D R FKK+ANIEAVD+AKRL DY
Sbjct: 843 VAHEFILDTRPFKKTANIEAVDLAKRLQDY 872




The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.
Gallus gallus (taxid: 9031)
EC: 1EC: .EC: 4EC: .EC: 4EC: .EC: 2
>sp|P23378|GCSP_HUMAN Glycine dehydrogenase [decarboxylating], mitochondrial OS=Homo sapiens GN=GLDC PE=1 SV=2 Back     alignment and function description
>sp|Q91W43|GCSP_MOUSE Glycine dehydrogenase [decarboxylating], mitochondrial OS=Mus musculus GN=Gldc PE=1 SV=1 Back     alignment and function description
>sp|Q92Q11|GCSP_RHIME Glycine dehydrogenase [decarboxylating] OS=Rhizobium meliloti (strain 1021) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|Q89I86|GCSP_BRAJA Glycine dehydrogenase [decarboxylating] OS=Bradyrhizobium japonicum (strain USDA 110) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|A6U8Q3|GCSP_SINMW Glycine dehydrogenase [decarboxylating] OS=Sinorhizobium medicae (strain WSM419) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|A9I7K9|GCSP_BORPD Glycine dehydrogenase [decarboxylating] OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|Q8UFD6|GCSP_AGRT5 Glycine dehydrogenase [decarboxylating] OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|A6TDR5|GCSP_KLEP7 Glycine dehydrogenase [decarboxylating] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|A1RFY8|GCSP_SHESW Glycine dehydrogenase [decarboxylating] OS=Shewanella sp. (strain W3-18-1) GN=gcvP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
289724561 670 glycine decarboxylase [Glossina morsitan 1.0 0.450 0.686 1e-122
195107935 985 GI23575 [Drosophila mojavensis] gi|19391 1.0 0.306 0.680 1e-121
195388752 985 GJ23552 [Drosophila virilis] gi|19415112 1.0 0.306 0.677 1e-121
195449363 988 GK22634 [Drosophila willistoni] gi|19416 1.0 0.305 0.674 1e-120
195143805 985 GL23685 [Drosophila persimilis] gi|19410 1.0 0.306 0.677 1e-120
195037176 985 GH19120 [Drosophila grimshawi] gi|193894 1.0 0.306 0.668 1e-120
24645648 985 CG3999, isoform A [Drosophila melanogast 1.0 0.306 0.671 1e-120
198450985 985 GA26702 [Drosophila pseudoobscura pseudo 1.0 0.306 0.674 1e-120
195330133 887 GM23871 [Drosophila sechellia] gi|194120 1.0 0.340 0.671 1e-120
194740958 985 GF17458 [Drosophila ananassae] gi|190626 1.0 0.306 0.668 1e-120
>gi|289724561|gb|ADD18274.1| glycine decarboxylase [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/329 (68%), Positives = 260/329 (79%), Gaps = 27/329 (8%)

Query: 1   MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
           MKLNATTEM+PCSF   T +HPF P +QARGY  +  ELE DLCEITGYDKISFQPNSGA
Sbjct: 221 MKLNATTEMMPCSFRHFTEIHPFAPVEQARGYHLMFEELEHDLCEITGYDKISFQPNSGA 280

Query: 61  QGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFS 120
           QGEYAGLRAI+ YH+ +   HRNVCLIP+SAHGTNPASAQMAGM VEP+ +  DG+ID +
Sbjct: 281 QGEYAGLRAIRSYHEHRKEGHRNVCLIPISAHGTNPASAQMAGMKVEPIRILSDGSIDMA 340

Query: 121 DLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCR 180
            L  K  ++   LSC+M+TYPST GVFEE ITD+C+LIH HGGQVYLDGANMNAQVGLCR
Sbjct: 341 HLRDKASEHASNLSCVMVTYPSTMGVFEETITDICDLIHRHGGQVYLDGANMNAQVGLCR 400

Query: 181 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVH----PLSSIDSSIGAV 236
           PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAP+LP H    PL S D+S G V
Sbjct: 401 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPYLPGHPVISPLESEDASFGVV 460

Query: 237 SAAHYGSASILPISWAYI-----------------------RRLESHYKTLFRSSRSGLV 273
           SAA +GS++ILPISW+YI                       +RLE HYKTL++  ++GLV
Sbjct: 461 SAAPFGSSAILPISWSYIKLMGSRGLKRATQVAILNANYMSKRLEQHYKTLYKEPKTGLV 520

Query: 274 AHEFVIDVRDFKKSANIEAVDIAKRLMDY 302
           AHEF++D+RD KK+ANIEAVD+AKRLMDY
Sbjct: 521 AHEFILDIRDLKKTANIEAVDVAKRLMDY 549




Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195107935|ref|XP_001998549.1| GI23575 [Drosophila mojavensis] gi|193915143|gb|EDW14010.1| GI23575 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195388752|ref|XP_002053043.1| GJ23552 [Drosophila virilis] gi|194151129|gb|EDW66563.1| GJ23552 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195449363|ref|XP_002072041.1| GK22634 [Drosophila willistoni] gi|194168126|gb|EDW83027.1| GK22634 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195143805|ref|XP_002012887.1| GL23685 [Drosophila persimilis] gi|194101830|gb|EDW23873.1| GL23685 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195037176|ref|XP_001990040.1| GH19120 [Drosophila grimshawi] gi|193894236|gb|EDV93102.1| GH19120 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|24645648|ref|NP_649989.1| CG3999, isoform A [Drosophila melanogaster] gi|442618429|ref|NP_001262456.1| CG3999, isoform B [Drosophila melanogaster] gi|7299318|gb|AAF54512.1| CG3999, isoform A [Drosophila melanogaster] gi|28316874|gb|AAO39460.1| RH34107p [Drosophila melanogaster] gi|220949308|gb|ACL87197.1| CG3999-PA [synthetic construct] gi|440217293|gb|AGB95838.1| CG3999, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198450985|ref|XP_002137194.1| GA26702 [Drosophila pseudoobscura pseudoobscura] gi|198131282|gb|EDY67752.1| GA26702 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195330133|ref|XP_002031762.1| GM23871 [Drosophila sechellia] gi|194120705|gb|EDW42748.1| GM23871 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194740958|ref|XP_001952956.1| GF17458 [Drosophila ananassae] gi|190626015|gb|EDV41539.1| GF17458 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
UNIPROTKB|E2R9Z7 1023 GLDC "Uncharacterized protein" 0.850 0.251 0.637 2.2e-105
UNIPROTKB|E1BJQ1 1020 GLDC "Uncharacterized protein" 0.850 0.251 0.641 7.3e-105
UNIPROTKB|P23378 1020 GLDC "Glycine dehydrogenase [d 0.850 0.251 0.629 4e-104
MGI|MGI:1341155 1025 Gldc "glycine decarboxylase" [ 0.850 0.250 0.625 1.1e-103
FB|FBgn0037801 985 CG3999 [Drosophila melanogaste 0.857 0.262 0.661 1.8e-94
WB|WBGene00020022 979 R12C12.1 [Caenorhabditis elega 0.850 0.262 0.604 2.6e-94
TIGR_CMR|SO_0781 962 SO_0781 "glycine cleavage syst 0.913 0.286 0.572 1.9e-91
UNIPROTKB|F1NX32 912 GLDC "Glycine dehydrogenase [d 0.850 0.281 0.648 1.5e-90
UNIPROTKB|P15505 1004 GLDC "Glycine dehydrogenase [d 0.850 0.255 0.648 1.5e-90
UNIPROTKB|F1NS43 906 GLDC "Glycine dehydrogenase [d 0.850 0.283 0.648 1.5e-90
UNIPROTKB|E2R9Z7 GLDC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 884 (316.2 bits), Expect = 2.2e-105, Sum P(2) = 2.2e-105
 Identities = 167/262 (63%), Positives = 201/262 (76%)

Query:     1 MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
             MKLN+++E+ P ++ +  N+HPF+P DQA+GY+QL  ELE DLCE+TGYD+ISFQPNSGA
Sbjct:   563 MKLNSSSELTPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDRISFQPNSGA 622

Query:    61 QGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFS 120
             QGEYAGL  I+ Y   +   HR VCLIP SAHGTNPASA MAGM ++PV V K G ID +
Sbjct:   623 QGEYAGLATIRAYLDGKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDTA 682

Query:   121 DLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCR 180
              L+  V K+KE L+ +MITYPST GVFEENI DVC+LIH++GGQVYLDGANMNAQVG+CR
Sbjct:   683 HLKAMVDKHKENLAAIMITYPSTNGVFEENIGDVCDLIHQNGGQVYLDGANMNAQVGICR 742

Query:   181 PGDYGSDVSHLNLHKTFCIXXXXXXXXXXXXXVKSHLAPFLPVHPLSSI-----DSSIGA 235
             PGD+GSDVSHLNLHKTFCI             VK HLAPFLP HP+ S+     D  +G 
Sbjct:   743 PGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPIVSVKPSEDDRPVGT 802

Query:   236 VSAAHYGSASILPISWAYIRRL 257
             VSAA +GS+SILPISWAYI+ +
Sbjct:   803 VSAAPWGSSSILPISWAYIKMM 824


GO:0005739 "mitochondrion" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0016829 "lyase activity" evidence=IEA
GO:0006546 "glycine catabolic process" evidence=IEA
GO:0004375 "glycine dehydrogenase (decarboxylating) activity" evidence=IEA
UNIPROTKB|E1BJQ1 GLDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P23378 GLDC "Glycine dehydrogenase [decarboxylating], mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1341155 Gldc "glycine decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0037801 CG3999 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00020022 R12C12.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0781 SO_0781 "glycine cleavage system P protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F1NX32 GLDC "Glycine dehydrogenase [decarboxylating], mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P15505 GLDC "Glycine dehydrogenase [decarboxylating], mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS43 GLDC "Glycine dehydrogenase [decarboxylating], mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A5GWN4GCSP_SYNR31, ., 4, ., 4, ., 20.56260.99660.3145yesN/A
Q07YC9GCSP_SHEFN1, ., 4, ., 4, ., 20.58960.99330.3118yesN/A
A6TDR5GCSP_KLEP71, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
A8GIR9GCSP_SERP51, ., 4, ., 4, ., 20.57310.99660.3138yesN/A
B2J427GCSP_NOSP71, ., 4, ., 4, ., 20.57570.99660.3074yesN/A
B7MM89GCSP_ECO451, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
B1KG87GCSP_SHEWM1, ., 4, ., 4, ., 20.58230.99660.3106yesN/A
Q1R7C8GCSP_ECOUT1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q31WG4GCSP_SHIBS1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
A4WE55GCSP_ENT381, ., 4, ., 4, ., 20.57620.99660.3145yesN/A
Q9RTF5GCSP_DEIRA1, ., 4, ., 4, ., 20.57970.99660.3171yesN/A
Q8DII3GCSP_THEEB1, ., 4, ., 4, ., 20.58760.99660.3155yesN/A
A6U8Q3GCSP_SINMW1, ., 4, ., 4, ., 20.61110.98670.3123yesN/A
Q92Q11GCSP_RHIME1, ., 4, ., 4, ., 20.61720.98670.3123yesN/A
B7LPB7GCSP_ESCF31, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q91W43GCSP_MOUSE1, ., 4, ., 4, ., 20.63630.99660.2936yesN/A
A3D085GCSP_SHEB51, ., 4, ., 4, ., 20.58960.99330.3118yesN/A
A1RFY8GCSP_SHESW1, ., 4, ., 4, ., 20.58530.99660.3128yesN/A
Q7WP29GCSP_BORBR1, ., 4, ., 4, ., 20.56830.99660.3155yesN/A
A6WSL1GCSP_SHEB81, ., 4, ., 4, ., 20.58960.99330.3118yesN/A
A8APB1GCSP_CITK81, ., 4, ., 4, ., 20.57310.99660.3145yesN/A
O80988GCSP1_ARATH1, ., 4, ., 4, ., 20.57050.99660.2883yesN/A
B7MZ55GCSP_ECO811, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q3IFW1GCSP_PSEHT1, ., 4, ., 4, ., 20.58230.99660.3125yesN/A
Q3YXW7GCSP_SHISS1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q2NRF0GCSP_SODGM1, ., 4, ., 4, ., 20.57010.99660.3158yesN/A
Q89I86GCSP_BRAJA1, ., 4, ., 4, ., 20.58460.99660.3151yesN/A
Q54KM7GCSP_DICDI1, ., 4, ., 4, ., 20.57490.99330.3018yesN/A
Q7W0E3GCSP_BORPE1, ., 4, ., 4, ., 20.56830.99660.3155yesN/A
B1XEJ0GCSP_ECODH1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
A9L330GCSP_SHEB91, ., 4, ., 4, ., 20.59270.99330.3118yesN/A
Q6LHN5GCSP_PHOPR1, ., 4, ., 4, ., 20.58890.99660.3138yesN/A
B9JFK7GCSP_AGRRK1, ., 4, ., 4, ., 20.58640.98670.3123yesN/A
A9I7K9GCSP_BORPD1, ., 4, ., 4, ., 20.58050.99660.3145yesN/A
Q7W1C4GCSP_BORPA1, ., 4, ., 4, ., 20.56830.99660.3155yesN/A
A7MR85GCSP_CROS81, ., 4, ., 4, ., 20.57310.99660.3145yesN/A
A0L103GCSP_SHESA1, ., 4, ., 4, ., 20.58350.99330.3118yesN/A
A1AF92GCSP_ECOK11, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
B6I736GCSP_ECOSE1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
P23378GCSP_HUMAN1, ., 4, ., 4, ., 20.63930.99660.2950yesN/A
P15505GCSP_CHICK1, ., 4, ., 4, ., 20.65750.99660.2998yesN/A
B5YQ95GCSP_ECO5E1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q8UFD6GCSP_AGRT51, ., 4, ., 4, ., 20.58950.98670.3123yesN/A
A4YAD8GCSP_SHEPC1, ., 4, ., 4, ., 20.58530.99660.3128yesN/A
B7LF89GCSP_ECO551, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
Q0TDU9GCSP_ECOL51, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
C5A0H5GCSP_ECOBW1, ., 4, ., 4, ., 20.56400.99660.3145yesN/A
B7UHV1GCSP_ECO271, ., 4, ., 4, ., 20.56400.99660.3145yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
PRK05367 954 PRK05367, PRK05367, glycine dehydrogenase; Provisi 0.0
COG1003496 COG1003, GcvP, Glycine cleavage system protein P ( 1e-171
PLN02414 993 PLN02414, PLN02414, glycine dehydrogenase (decarbo 1e-164
TIGR00461 939 TIGR00461, gcvP, glycine dehydrogenase (decarboxyl 1e-160
PRK12566 954 PRK12566, PRK12566, glycine dehydrogenase; Provisi 1e-142
PRK04366481 PRK04366, PRK04366, glycine dehydrogenase subunit 1e-109
cd00613398 cd00613, GDC-P, Glycine cleavage system P-protein, 1e-106
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-09
COG0403450 COG0403, GcvP, Glycine cleavage system protein P ( 5e-07
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 1e-06
PRK00451447 PRK00451, PRK00451, glycine dehydrogenase subunit 4e-06
COG2008342 COG2008, GLY1, Threonine aldolase [Amino acid tran 5e-06
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 2e-05
cd06502338 cd06502, TA_like, Low-specificity threonine aldola 5e-04
pfam02347429 pfam02347, GDC-P, Glycine cleavage system P-protei 0.002
>gnl|CDD|235432 PRK05367, PRK05367, glycine dehydrogenase; Provisional Back     alignment and domain information
 Score =  600 bits (1550), Expect = 0.0
 Identities = 196/327 (59%), Positives = 238/327 (72%), Gaps = 26/327 (7%)

Query: 1   MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
           MKLNA  EMIP ++P+  N+HPF P +QA GY +LI +LE  L EITGYD +S QPN+GA
Sbjct: 509 MKLNAAAEMIPITWPEFANLHPFAPAEQAAGYRELIDQLEAWLAEITGYDAVSLQPNAGA 568

Query: 61  QGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFS 120
           QGEYAGL AI+ YH+++   HR+VCLIP SAHGTNPASA MAGM V  V+  ++G ID  
Sbjct: 569 QGEYAGLLAIRAYHESRGEGHRDVCLIPSSAHGTNPASAVMAGMKVVVVACDENGNIDLD 628

Query: 121 DLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCR 180
           DL  K +++ + L+ +MITYPST GVFEE I ++CE++HEHGGQVYLDGANMNAQVGL R
Sbjct: 629 DLRAKAEEHADNLAAIMITYPSTHGVFEETIREICEIVHEHGGQVYLDGANMNAQVGLAR 688

Query: 181 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSI--DSSIGAVSA 238
           PGD G+DVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPFLP HP+     ++ IGAVSA
Sbjct: 689 PGDIGADVSHLNLHKTFCIPHGGGGPGVGPIGVKAHLAPFLPGHPVQIAGGETGIGAVSA 748

Query: 239 AHYGSASILPISWAYIR-----------------------RLESHYKTLFRSSRSGLVAH 275
           A +GSASILPISW YIR                       RL+ HY  L+    +G VAH
Sbjct: 749 APFGSASILPISWMYIRMMGAEGLRQATEVAILNANYIAKRLKDHYPVLYT-GANGRVAH 807

Query: 276 EFVIDVRDFKKSANIEAVDIAKRLMDY 302
           E ++D+R  K+S  I   DIAKRL+DY
Sbjct: 808 ECILDLRPLKESTGITVDDIAKRLIDY 834


Length = 954

>gnl|CDD|223935 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178035 PLN02414, PLN02414, glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|129553 TIGR00461, gcvP, glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|171585 PRK12566, PRK12566, glycine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235292 PRK04366, PRK04366, glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|99737 cd00613, GDC-P, Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|223480 COG0403, GcvP, Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|234769 PRK00451, PRK00451, glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99748 cd06502, TA_like, Low-specificity threonine aldolase (TA) Back     alignment and domain information
>gnl|CDD|216983 pfam02347, GDC-P, Glycine cleavage system P-protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
KOG2040|consensus 1001 100.0
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 100.0
PLN02414 993 glycine dehydrogenase (decarboxylating) 100.0
PRK12566 954 glycine dehydrogenase; Provisional 100.0
PRK05367 954 glycine dehydrogenase; Provisional 100.0
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 100.0
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
PRK04366481 glycine dehydrogenase subunit 2; Validated 100.0
PRK12566 954 glycine dehydrogenase; Provisional 100.0
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 100.0
PRK05367 954 glycine dehydrogenase; Provisional 100.0
PLN02414 993 glycine dehydrogenase (decarboxylating) 100.0
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 100.0
PRK00451447 glycine dehydrogenase subunit 1; Validated 100.0
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.96
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.96
PLN02271586 serine hydroxymethyltransferase 99.96
KOG2040|consensus 1001 99.95
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.94
PRK13580493 serine hydroxymethyltransferase; Provisional 99.92
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.91
PLN02651364 cysteine desulfurase 99.89
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.88
KOG2467|consensus 477 99.88
PLN03226 475 serine hydroxymethyltransferase; Provisional 99.87
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.87
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.87
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.87
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.86
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.86
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.86
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.86
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.86
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.86
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.86
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.86
PLN02409401 serine--glyoxylate aminotransaminase 99.85
PRK02769380 histidine decarboxylase; Provisional 99.85
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.84
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.84
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.84
KOG1549|consensus428 99.84
KOG0257|consensus420 99.84
PLN03032374 serine decarboxylase; Provisional 99.84
PRK02948381 cysteine desulfurase; Provisional 99.83
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.83
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.83
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.83
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.83
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.83
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.82
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.82
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.82
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.82
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.82
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.82
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.82
PRK14012404 cysteine desulfurase; Provisional 99.81
PRK13520371 L-tyrosine decarboxylase; Provisional 99.81
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.8
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.79
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.79
KOG2862|consensus385 99.79
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.79
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.78
PRK06234400 methionine gamma-lyase; Provisional 99.78
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.78
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.77
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.77
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.77
PRK05968389 hypothetical protein; Provisional 99.77
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.77
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.77
PRK07503403 methionine gamma-lyase; Provisional 99.76
PRK07681399 aspartate aminotransferase; Provisional 99.76
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.76
PRK05957389 aspartate aminotransferase; Provisional 99.76
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.76
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.76
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.75
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.75
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.75
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.75
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.75
PRK06207405 aspartate aminotransferase; Provisional 99.75
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.75
PRK08114395 cystathionine beta-lyase; Provisional 99.75
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.75
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.75
PLN02263470 serine decarboxylase 99.75
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.75
PRK08776405 cystathionine gamma-synthase; Provisional 99.75
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.75
PRK09028394 cystathionine beta-lyase; Provisional 99.74
PRK08064390 cystathionine beta-lyase; Provisional 99.74
PRK05939 397 hypothetical protein; Provisional 99.74
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.74
PRK12414384 putative aminotransferase; Provisional 99.74
PRK07811388 cystathionine gamma-synthase; Provisional 99.74
PRK06225380 aspartate aminotransferase; Provisional 99.74
TIGR01814406 kynureninase kynureninase. This model describes ky 99.74
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.74
PRK06108382 aspartate aminotransferase; Provisional 99.74
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.74
PLN00175413 aminotransferase family protein; Provisional 99.74
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 99.74
PRK06767386 methionine gamma-lyase; Provisional 99.74
PRK08861388 cystathionine gamma-synthase; Provisional 99.74
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.73
PRK09105370 putative aminotransferase; Provisional 99.73
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.73
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.73
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.73
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 99.73
PRK05942394 aspartate aminotransferase; Provisional 99.73
PRK05764393 aspartate aminotransferase; Provisional 99.73
PLN02721353 threonine aldolase 99.73
PLN02242418 methionine gamma-lyase 99.73
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.73
PRK07324373 transaminase; Validated 99.73
PRK07050394 cystathionine beta-lyase; Provisional 99.73
PRK09082386 methionine aminotransferase; Validated 99.73
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.73
PRK08249398 cystathionine gamma-synthase; Provisional 99.72
PRK08912387 hypothetical protein; Provisional 99.72
PLN02509464 cystathionine beta-lyase 99.72
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.72
PRK08960387 hypothetical protein; Provisional 99.72
PRK08574385 cystathionine gamma-synthase; Provisional 99.72
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.72
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 99.72
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.72
PRK08361391 aspartate aminotransferase; Provisional 99.72
PRK08068389 transaminase; Reviewed 99.71
PRK07309391 aromatic amino acid aminotransferase; Validated 99.71
PRK04311464 selenocysteine synthase; Provisional 99.71
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.71
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 99.71
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.71
PRK05967395 cystathionine beta-lyase; Provisional 99.71
PRK07671377 cystathionine beta-lyase; Provisional 99.71
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.71
PRK08247366 cystathionine gamma-synthase; Reviewed 99.71
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.71
PLN02368407 alanine transaminase 99.71
KOG0259|consensus447 99.71
PRK07682378 hypothetical protein; Validated 99.71
PRK07777387 aminotransferase; Validated 99.71
PRK09148405 aminotransferase; Validated 99.7
PRK06290410 aspartate aminotransferase; Provisional 99.7
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.7
PRK07337388 aminotransferase; Validated 99.7
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.7
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.7
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.7
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.7
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.7
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.69
PRK15029 755 arginine decarboxylase; Provisional 99.69
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.69
PLN02187462 rooty/superroot1 99.69
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.69
PRK07550386 hypothetical protein; Provisional 99.69
PRK08045386 cystathionine gamma-synthase; Provisional 99.69
PRK06460376 hypothetical protein; Provisional 99.69
PRK03321352 putative aminotransferase; Provisional 99.69
PRK08636403 aspartate aminotransferase; Provisional 99.69
PLN02880490 tyrosine decarboxylase 99.69
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.69
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.68
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 99.68
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.68
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.68
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.68
PRK06348384 aspartate aminotransferase; Provisional 99.67
PLN02656409 tyrosine transaminase 99.67
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.67
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 99.67
PTZ00377481 alanine aminotransferase; Provisional 99.67
PRK07683387 aminotransferase A; Validated 99.67
PLN02590539 probable tyrosine decarboxylase 99.67
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.67
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.67
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.66
PTZ00433412 tyrosine aminotransferase; Provisional 99.66
PRK07049427 methionine gamma-lyase; Validated 99.66
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.66
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.66
PRK08175395 aminotransferase; Validated 99.66
PRK07582366 cystathionine gamma-lyase; Validated 99.66
PRK06107402 aspartate aminotransferase; Provisional 99.65
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.65
PRK07179407 hypothetical protein; Provisional 99.65
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.65
PRK07269364 cystathionine gamma-synthase; Reviewed 99.65
PTZ00376404 aspartate aminotransferase; Provisional 99.65
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.64
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.64
PRK08363398 alanine aminotransferase; Validated 99.64
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.64
PRK07568397 aspartate aminotransferase; Provisional 99.64
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.63
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.63
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.63
PLN02231534 alanine transaminase 99.63
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.63
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.63
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.63
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.63
PRK03080378 phosphoserine aminotransferase; Provisional 99.62
PLN02724 805 Molybdenum cofactor sulfurase 99.62
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.62
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.62
PRK09265404 aminotransferase AlaT; Validated 99.62
PRK06836394 aspartate aminotransferase; Provisional 99.62
PRK13392410 5-aminolevulinate synthase; Provisional 99.62
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.62
PRK05839374 hypothetical protein; Provisional 99.62
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.62
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.61
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.61
PRK06855433 aminotransferase; Validated 99.61
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.6
PLN02397423 aspartate transaminase 99.6
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.6
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.6
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.6
PRK13578 720 ornithine decarboxylase; Provisional 99.6
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.6
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.6
PLN02483489 serine palmitoyltransferase 99.59
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.59
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.59
PRK09275 527 aspartate aminotransferase; Provisional 99.58
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.58
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.57
PRK09064407 5-aminolevulinate synthase; Validated 99.56
PRK06434384 cystathionine gamma-lyase; Validated 99.56
PLN026721082 methionine S-methyltransferase 99.56
KOG0053|consensus409 99.56
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.56
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.55
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.55
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.55
PRK07392360 threonine-phosphate decarboxylase; Validated 99.55
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.55
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.54
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.53
PRK13237460 tyrosine phenol-lyase; Provisional 99.53
PRK10534333 L-threonine aldolase; Provisional 99.53
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.53
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.53
PRK15400 714 lysine decarboxylase CadA; Provisional 99.52
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.52
PRK13393406 5-aminolevulinate synthase; Provisional 99.51
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.51
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.51
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.5
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.49
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.49
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.49
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.48
PRK08354311 putative aminotransferase; Provisional 99.48
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.48
PLN02822481 serine palmitoyltransferase 99.47
PRK07908349 hypothetical protein; Provisional 99.47
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.46
PRK08637388 hypothetical protein; Provisional 99.46
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.44
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.44
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.43
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.42
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.42
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.41
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.41
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.4
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.4
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.38
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.37
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.36
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.34
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.34
PLN02955476 8-amino-7-oxononanoate synthase 99.32
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.32
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.32
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.31
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.29
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.29
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.28
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.28
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.27
PLN02624474 ornithine-delta-aminotransferase 99.26
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.24
KOG0633|consensus375 99.24
PRK07505402 hypothetical protein; Provisional 99.24
KOG1368|consensus384 99.23
KOG0256|consensus471 99.23
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.22
PRK02627396 acetylornithine aminotransferase; Provisional 99.22
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.21
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.19
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.19
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.18
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.14
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.14
PLN02452365 phosphoserine transaminase 99.13
PRK09792421 4-aminobutyrate transaminase; Provisional 99.13
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.11
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.1
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.1
PRK06541460 hypothetical protein; Provisional 99.09
PRK04260375 acetylornithine aminotransferase; Provisional 99.09
PRK12403460 putative aminotransferase; Provisional 99.08
PRK07046453 aminotransferase; Validated 99.08
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.07
PRK07482461 hypothetical protein; Provisional 99.06
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.06
PLN00144382 acetylornithine transaminase 99.05
PRK07678451 aminotransferase; Validated 99.05
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.05
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.04
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.04
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.04
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.03
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.02
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.02
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.02
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.01
KOG0629|consensus510 99.0
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.0
KOG1383|consensus491 99.0
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.0
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.0
PRK05965459 hypothetical protein; Provisional 98.99
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 98.99
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 98.98
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 98.98
PRK06058443 4-aminobutyrate aminotransferase; Provisional 98.97
PRK12462364 phosphoserine aminotransferase; Provisional 98.97
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 98.96
PRK05639457 4-aminobutyrate aminotransferase; Provisional 98.96
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 98.95
PRK09221445 beta alanine--pyruvate transaminase; Provisional 98.94
PLN02760504 4-aminobutyrate:pyruvate transaminase 98.93
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 98.92
PRK13360442 omega amino acid--pyruvate transaminase; Provision 98.92
PRK06105460 aminotransferase; Provisional 98.91
PRK06082459 4-aminobutyrate aminotransferase; Provisional 98.91
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 98.91
PRK06917447 hypothetical protein; Provisional 98.9
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 98.9
PRK08088425 4-aminobutyrate aminotransferase; Validated 98.9
PRK06062451 hypothetical protein; Provisional 98.89
PRK07481449 hypothetical protein; Provisional 98.88
PRK07480456 putative aminotransferase; Validated 98.87
KOG1360|consensus570 98.87
PRK06149972 hypothetical protein; Provisional 98.85
PRK07483443 hypothetical protein; Provisional 98.85
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 98.84
PRK07036466 hypothetical protein; Provisional 98.83
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 98.81
KOG1402|consensus427 98.78
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 98.77
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 98.76
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 98.75
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 98.74
KOG1404|consensus442 98.74
KOG0258|consensus475 98.74
COG4100416 Cystathionine beta-lyase family protein involved i 98.71
KOG1357|consensus519 98.67
KOG0634|consensus472 98.66
KOG1401|consensus433 98.65
PRK061481013 hypothetical protein; Provisional 98.65
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.61
KOG1359|consensus417 98.57
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 98.52
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.48
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.45
PRK08297443 L-lysine aminotransferase; Provisional 98.44
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 98.42
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 98.42
KOG0628|consensus 511 98.34
KOG3846|consensus465 97.81
KOG1358|consensus467 97.43
KOG1411|consensus427 97.36
KOG1412|consensus410 97.36
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 96.44
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 95.64
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 95.22
KOG1403|consensus452 94.74
KOG3843|consensus432 94.33
KOG1405|consensus484 91.87
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.3e-71  Score=508.23  Aligned_cols=296  Identities=59%  Similarity=1.028  Sum_probs=278.6

Q ss_pred             CCccccccccccCCcCCccCCCCCCCcccccHHHHHHHHHHHHHHHhCCCeeeEeeCchHHHHHHHHHHHHHHHHhhcCC
Q psy7357           1 MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDAH   80 (302)
Q Consensus         1 ~~~~p~~~~~~~~~~~ft~~~py~p~e~sqG~l~~~~e~~~~l~~l~g~~~~~~~~~~Ga~a~~a~l~a~~~~~~~~g~~   80 (302)
                      |||||++++.++.+|||...|||||++..||.++++.++|++|++++|+|.+.+||.+||++|++.++++++|++.+|+.
T Consensus        76 MK~Np~~e~~~~~~p~f~~iHP~~pe~~vqG~l~li~~Lq~~L~~ITG~DavsLQP~AGAqGE~aGll~Ir~YHe~rG~~  155 (496)
T COG1003          76 MKLNPKAEMKPATWPEFANIHPFQPEEQVQGYLELIYELQEWLKEITGMDAVSLQPNAGAQGEYAGLLAIRAYHESRGEG  155 (496)
T ss_pred             cccCchhhcccccccchhhcCCCCChHHHHHHHHHHHHHHHHHHHhcCCceeeccCCCCcchhhHHHHHHHHHHHHcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCEEEEcCCCCcccHHHHHhCCCEEEEeecCCCCCCCHHHHHHHHhccCCCeEEEEEecCCCceeccccHHHHHHHHHH
Q psy7357          81 HRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHE  160 (302)
Q Consensus        81 ~~d~Vlv~~~~hg~~~~~~~~~g~~v~~i~~~~~g~iD~~~l~~~i~~~~~~t~~V~i~~Pn~~G~~~~di~~I~~ia~~  160 (302)
                      .|++||||+++||+|++++.+.|++|+.|+++++|.+|+++|++++.   ++++++|++|||+.|+++++|.+|++++|+
T Consensus       156 ~R~~~LIP~SAHGTNPASAam~G~~VV~V~~~~~G~VDlddLk~k~~---~~~AalMiTnPsT~GvFE~~I~ei~~ivH~  232 (496)
T COG1003         156 HRNICLIPDSAHGTNPASAAMAGFKVVVVKCDENGNVDLDDLRAKAE---DNLAALMITNPSTLGVFEEDIREICEIVHE  232 (496)
T ss_pred             cCcEEEeeccccCCChhhHhhcCceEEEEecCCCCCccHHHHHHHhc---cceeEEEeccCcccccchhhHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999   899999999999999998899999999999


Q ss_pred             hCCEEEEecCCcccccccCCCCccCCcEEEeCCCcccCCCCCCCCCcceeEEEeCCCCCCCCCCc----ccC------CC
Q psy7357         161 HGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHP----LSS------ID  230 (302)
Q Consensus       161 ~g~llivD~a~~~~~~~~~~p~~~gaDiv~~~~hK~l~~p~~~gGp~~G~l~~~~~l~~~lpg~~----~~~------~~  230 (302)
                      +|++|++|+||.+++.++.+||++|+||++.++||||++|||+||||.|.+.+++++++++|+++    .+.      ..
T Consensus       233 ~Gg~vY~DGANlNA~vG~~rPGd~G~DV~HlNLHKTF~iPHGGGGPG~GPvgVk~~L~pfLP~p~~~~~~~~y~~~~~~~  312 (496)
T COG1003         233 AGGQVYYDGANLNAIVGLARPGDMGFDVVHLNLHKTFCIPHGGGGPGAGPVGVKAHLAPFLPGPVVYHDVGEYRLDYDGK  312 (496)
T ss_pred             cCCEEEecCcchhhhhccccccccccceEEeecccccccCCCCCCCCCCceehHhhccccCCCCcccCCCccccccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999953    322      12


Q ss_pred             CcchhhhHHHHhhHhhHHHHHHHHH-----------------------HHhcccccccccCCCcceeEEEEEEecccccc
Q psy7357         231 SSIGAVSAAHYGSASILPISWAYIR-----------------------RLESHYKTLFRSSRSGLVAHEFVIDVRDFKKS  287 (302)
Q Consensus       231 ~~l~~~~a~~~~~~~~~~~~~~y~~-----------------------~l~~g~~~~~~~~~~~~~~he~~~~~~~~~~~  287 (302)
                      .+.+.++ ++|++++++.++|.|++                       +|++.|+++|.+.  ..|.|||++|.+++|++
T Consensus       313 ~s~g~~~-a~~Gs~~il~~a~~YI~~mG~~GL~~ase~AvLNANYia~rL~~~y~~~y~~~--~~~~HE~ild~r~l~~~  389 (496)
T COG1003         313 KSIGVSA-APYGSASILPIAWAYIRMMGADGLKQASEVAVLNANYIARRLKGYYPVPYTGE--NRVAHECILDARPLKKE  389 (496)
T ss_pred             ccceeec-cccCcchHHHHHHHHHHHHhHHHHHHHHHHHHHhHHHHHHHhhhcCccccCCC--CcceeEEEeechHhHhh
Confidence            3445555 79999999999998877                       6767899999764  37899999999999999


Q ss_pred             CCCCHHHHHHHhhcC
Q psy7357         288 ANIEAVDIAKRLMDY  302 (302)
Q Consensus       288 ~g~~~~~~~~~l~~~  302 (302)
                      +|+++.||+|||+||
T Consensus       390 ~Gv~~~DvAKrLlD~  404 (496)
T COG1003         390 TGVRALDVAKRLLDY  404 (496)
T ss_pred             cCCcHHHHHHHHHhc
Confidence            999999999999997



>KOG2040|consensus Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>KOG3846|consensus Back     alignment and domain information
>KOG1358|consensus Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>KOG3843|consensus Back     alignment and domain information
>KOG1405|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1wyt_B474 Crystal Structure Of Glycine Decarboxylase (P-Prote 6e-44
>pdb|1WYT|B Chain B, Crystal Structure Of Glycine Decarboxylase (P-Protein) Of The Glycine Cleavage System, In Apo Form Length = 474 Back     alignment and structure

Iteration: 1

Score = 174 bits (440), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 114/317 (35%), Positives = 163/317 (51%), Gaps = 42/317 (13%) Query: 17 LTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQA 76 ++HP+ A+G +L+ EL L +TG D I+ +P +GA GE G+ I+ YH+ Sbjct: 90 FADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED 149 Query: 77 Q-DAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSC 135 + + R V L+P SAHG+NPA+A MAG V + +G +D L+ ++ + ++ Sbjct: 150 RGEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDLEALKRELGPH---VAA 206 Query: 136 LMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHK 195 LM+T P+T G+FE I ++ L E G Q+Y DGAN+NA +G RPGD G DV HLNLHK Sbjct: 207 LMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWARPGDMGFDVVHLNLHK 266 Query: 196 TFCIXXXXXXXXXXXXXVKSHLAPFLPVHPLSS-------ID----SSIGAVSAAHYGSA 244 TF + VK+HLAP+LPV PL +D SIG V + YG+ Sbjct: 267 TFTVPHGGGGPGSGPVGVKAHLAPYLPV-PLVERGEEGFYLDFDRPKSIGRVR-SFYGNF 324 Query: 245 SILPISWAYIRRL---------------ESHYKTL-----FRSSRSGLVAHEFVIDVRDF 284 L +WAYIR L + K L +R G HEFV Sbjct: 325 LALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVA----- 379 Query: 285 KKSANIEAVDIAKRLMD 301 + A+D+AK L++ Sbjct: 380 QPPEGFRALDLAKGLLE 396

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 1e-171
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 1e-07
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 5e-07
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-05
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 1e-05
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 2e-05
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 9e-05
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 1e-04
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 2e-04
3pj0_A359 LMO0305 protein; structural genomics, joint center 6e-04
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 8e-04
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Length = 474 Back     alignment and structure
 Score =  482 bits (1243), Expect = e-171
 Identities = 124/337 (36%), Positives = 174/337 (51%), Gaps = 50/337 (14%)

Query: 1   MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
           MK N              ++HP+     A+G  +L+ EL   L  +TG D I+ +P +GA
Sbjct: 76  MKYNPKLHEEAA--RLFADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGA 133

Query: 61  QGEYAGLRAIQCYHQAQ-DAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDF 119
            GE  G+  I+ YH+ + +   R V L+P SAHG+NPA+A MAG  V  +    +G +D 
Sbjct: 134 HGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDL 193

Query: 120 SDLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLC 179
             L+ ++  +   ++ LM+T P+T G+FE  I ++  L  E G Q+Y DGAN+NA +G  
Sbjct: 194 EALKRELGPH---VAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWA 250

Query: 180 RPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSSIDS-------- 231
           RPGD G DV HLNLHKTF +PHGGGGPG GP+GVK+HLAP+LPV  +   +         
Sbjct: 251 RPGDMGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYLDFDR 310

Query: 232 --SIGAVSAAHYGSASILPISWAYIRRL------------------------ESHYKTLF 265
             SIG V +  YG+   L  +WAYIR L                        E  Y+  +
Sbjct: 311 PKSIGRVRSF-YGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPY 369

Query: 266 RSSRSGLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY 302
                G   HEFV             A+D+AK L++ 
Sbjct: 370 D----GPSMHEFVAQ-----PPEGFRALDLAKGLLEL 397


>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Length = 438 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Length = 501 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Length = 450 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Length = 359 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 100.0
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 100.0
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 99.97
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.91
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.89
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.89
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.88
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.87
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.87
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.87
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.87
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.87
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.87
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.86
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.86
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.86
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.85
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.85
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.85
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.85
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.85
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.85
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.84
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.84
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.84
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.84
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.84
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.84
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.84
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.84
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.84
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.83
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.83
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.83
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.83
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.83
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.82
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.82
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.82
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.82
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.82
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.81
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.81
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.81
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.81
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.81
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.81
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.81
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.8
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.8
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.8
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.8
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.8
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.8
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.8
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.8
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.8
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.8
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.8
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.8
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.79
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.79
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.79
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.79
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.79
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.79
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.79
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.79
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.78
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.78
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.78
3ele_A398 Amino transferase; RER070207001803, structural gen 99.78
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.78
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.78
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.78
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.78
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.78
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.78
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.77
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.77
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.77
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.77
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.77
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.77
1svv_A359 Threonine aldolase; structural genomics, structura 99.77
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.77
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.77
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.77
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.77
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.77
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.77
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.77
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.77
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.76
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.76
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.76
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.76
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.76
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.76
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.76
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.75
2fnu_A375 Aminotransferase; protein-product complex, structu 99.75
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.75
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.75
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.75
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.75
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.75
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.75
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.75
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.75
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.75
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.75
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.75
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.75
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.75
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.75
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.75
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.75
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.74
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.74
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.74
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.74
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.74
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.74
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.74
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.74
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.73
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.73
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.73
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.73
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.73
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.73
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.73
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.73
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.73
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.73
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.72
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.72
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.71
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.71
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.71
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.71
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.71
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.71
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.7
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.7
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.7
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.7
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.7
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.7
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.7
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.69
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.69
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.69
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.68
3rq1_A418 Aminotransferase class I and II; structural genomi 99.68
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.68
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.68
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.68
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.67
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.67
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.67
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.67
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.65
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.64
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.64
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.64
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.64
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.64
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.64
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.64
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.63
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.63
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.62
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.62
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.62
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.62
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.62
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.62
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.62
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.61
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.61
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.61
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.61
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.61
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.61
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.6
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.6
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.6
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.59
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.58
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.58
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.57
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.33
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.56
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.56
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.55
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.55
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.55
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.54
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.53
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.53
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.52
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.51
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.5
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.5
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.5
3hmu_A472 Aminotransferase, class III; structural genomics, 99.5
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.48
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.48
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.48
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.48
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.47
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.47
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.46
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.46
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.45
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.44
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.43
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.42
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.41
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.4
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.4
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.39
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.38
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.38
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.37
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.3
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.29
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.23
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 98.86
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.15
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.04
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.01
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.92
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
Probab=100.00  E-value=7.6e-38  Score=302.50  Aligned_cols=287  Identities=39%  Similarity=0.713  Sum_probs=226.1

Q ss_pred             CCccccccccccCCcCCccCCCCCCCcccccHHHHHHHHHHHHHHHhCCCeeeEeeCchHHHHHHHHHHHHHHHHhhcC-
Q psy7357           1 MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDA-   79 (302)
Q Consensus         1 ~~~~p~~~~~~~~~~~ft~~~py~p~e~sqG~l~~~~e~~~~l~~l~g~~~~~~~~~~Ga~a~~a~l~a~~~~~~~~g~-   79 (302)
                      |+++|++++.+..+  |++||||+|.+.+||.+++++++++++++++|++...+++++|++|+.+++++++.++..+|+ 
T Consensus        76 ~~~~p~v~~~~~~~--~~~~~~~~~~~~~~g~~~l~~~l~~~la~~~g~~~~~~~~~ggt~a~~~al~~~~~~~~~~Gd~  153 (474)
T 1wyu_B           76 MKYNPKLHEEAARL--FADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHEDRGEG  153 (474)
T ss_dssp             CCCCCHHHHHHHHT--TSSCCTTSCGGGCHHHHHHHHHHHHHHHHHHTCSEEECCCSSHHHHHHHHHHHHHHHHHHTTCT
T ss_pred             ccCCHHHHHHHHHH--HHhcCCCCchhhChHHHHHHHHHHHHHHHHHCCCceeecChHHHHHHHHHHHHHHHHHHhcCCc
Confidence            78999999999887  999999999558999999999999999999999987667788888887777777765433332 


Q ss_pred             CCCCEEEEcCCCCcccHHHHHhCCCEEEEeecCCCCCCCHHHHHHHHhccCCCeEEEEEecCCCceec-cccHHHHHHHH
Q psy7357          80 HHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVF-EENITDVCELI  158 (302)
Q Consensus        80 ~~~d~Vlv~~~~hg~~~~~~~~~g~~v~~i~~~~~g~iD~~~l~~~i~~~~~~t~~V~i~~Pn~~G~~-~~di~~I~~ia  158 (302)
                      .++++|+++++.|+++...++..|++++.+|+++++.+|+++|+++++   ++|++|++++||++|.+ + |+++|+++|
T Consensus       154 ~~r~~Vlv~~~~h~~~~~~~~~~G~~vv~v~~~~~~~~d~~~L~~~i~---~~t~~v~~~~pn~~G~~~~-~l~~i~~l~  229 (474)
T 1wyu_B          154 RTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDLEALKRELG---PHVAALMLTNPNTLGLFER-RILEISRLC  229 (474)
T ss_dssp             TTCCEEEEETTSCTHHHHHHHHTTCEEEEECBCTTSSBCHHHHHHHCS---TTEEEEEECSSCTTSCCCT-THHHHHHHH
T ss_pred             cCCCEEEEeCCcChhhHHHHHHCCCEEEEecCCCCCCcCHHHHHHhhC---CCceEEEEECCCCCcccCC-CHHHHHHHH
Confidence            234599999999999998899999999999998889999999999998   78999999999999988 6 799999999


Q ss_pred             HHhCCEEEEecCCcccccccCCCCccCCcEEEeCCCcccCCCCCCCCCcceeEEEeCCCCCCCCCCcccC----------
Q psy7357         159 HEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSS----------  228 (302)
Q Consensus       159 ~~~g~llivD~a~~~~~~~~~~p~~~gaDiv~~~~hK~l~~p~~~gGp~~G~l~~~~~l~~~lpg~~~~~----------  228 (302)
                      |++|+++|+|+++.....+..+++++++|++++++||+|+.|+|+||||+|++++++++++++++++++.          
T Consensus       230 ~~~g~~li~Dea~~~~~~g~~~~~~~g~di~~~s~~K~~~~p~g~gG~~~G~~~~~~~l~~~l~~~~~~~~g~~~~~~~~  309 (474)
T 1wyu_B          230 KEAGVQLYYDGANLNAIMGWARPGDMGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYLDFD  309 (474)
T ss_dssp             HHHTCEEEEEGGGGGGTTTTCCHHHHTCSEEECCTTTTTCCCCTTSCCCCCCEEECGGGGGGCCSCEEEECSSCEEEECC
T ss_pred             HHcCCEEEEeCchhhhhccCCCcccCCCcEEEEeCccccccCCCCCCCCeEEEEEcHHHHHhCCCCeeeccCCeeEeccc
Confidence            9999999999998544433346677899999999999999999999999999999999999888544320          


Q ss_pred             -----------CCCcchhhhHHHHhhH-h---h---HHHH---HHHHH-HHh-cccccccccCCCcceeEEEEEEecccc
Q psy7357         229 -----------IDSSIGAVSAAHYGSA-S---I---LPIS---WAYIR-RLE-SHYKTLFRSSRSGLVAHEFVIDVRDFK  285 (302)
Q Consensus       229 -----------~~~~l~~~~a~~~~~~-~---~---~~~~---~~y~~-~l~-~g~~~~~~~~~~~~~~he~~~~~~~~~  285 (302)
                                 .++.+...+|..++.. +   +   .+..   ..|+. +|. .|++++++++.    +|+|+++++   
T Consensus       310 ~~~~~~~~~~~~~~~~~~~aa~~~l~~~g~~~l~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~~----~~~~~~~~~---  382 (474)
T 1wyu_B          310 RPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPS----MHEFVAQPP---  382 (474)
T ss_dssp             CTTCCCCSSSTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCBCSSCSSC----CSCEEEBCS---
T ss_pred             CcccCcccccCcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcEecCCCCc----ceEEEEEcC---
Confidence                       1222223333333321 1   1   1111   13433 555 37887665444    889999873   


Q ss_pred             ccCCCCHHHHHHHhhcC
Q psy7357         286 KSANIEAVDIAKRLMDY  302 (302)
Q Consensus       286 ~~~g~~~~~~~~~l~~~  302 (302)
                        .|.+..++.++|+++
T Consensus       383 --~~~~~~~l~~~L~~~  397 (474)
T 1wyu_B          383 --EGFRALDLAKGLLEL  397 (474)
T ss_dssp             --TTCCHHHHHHHHHHT
T ss_pred             --CCCCHHHHHHHHHHC
Confidence              257899999999763



>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1wyub1471 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 9e-55
d1wyua1437 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarbox 1e-36
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 6e-31
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 7e-31
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 2e-23
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 8e-17
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 5e-12
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 8e-10
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 3e-04
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Length = 471 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Glycine dehydrogenase subunits (GDC-P)
domain: Glycine dehydrogenase subunit 2 (P-protein)
species: Thermus thermophilus [TaxId: 274]
 Score =  182 bits (463), Expect = 9e-55
 Identities = 108/332 (32%), Positives = 156/332 (46%), Gaps = 40/332 (12%)

Query: 1   MKLNATTEMIPCSFPQLTNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGA 60
           MK N              ++HP+     A+G  +L+ EL   L  +TG D I+ +P +GA
Sbjct: 75  MKYNPKLHEEAARL--FADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGA 132

Query: 61  QGEYAGLRAIQCYHQAQDAHHRNVCLIPVSAHGTNPASAQMAGMSVEPVSVRKDGTIDFS 120
            GE  G+  I+ YH+ +        ++   +   +  +          V     G     
Sbjct: 133 HGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAG--YQVREIPSGPEGEV 190

Query: 121 DLETKVKKNKETLSCLMITYPSTFGVFEENITDVCELIHEHGGQVYLDGANMNAQVGLCR 180
           DLE   ++    ++ LM+T P+T G+FE  I ++  L  E G Q+Y DGAN+NA +G  R
Sbjct: 191 DLEALKRELGPHVAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWAR 250

Query: 181 PGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPL----------SSID 230
           PGD G DV HLNLHKTF +PHGGGGPG GP+GVK+HLAP+LPV  +              
Sbjct: 251 PGDMGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYLDFDRP 310

Query: 231 SSIGAVSAAHYGSASILPISWAYIRRL------ESHYKTLFRSSR--------------S 270
            SIG V  + YG+   L  +WAYIR L      ++    +  +                 
Sbjct: 311 KSIGRVR-SFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYD 369

Query: 271 GLVAHEFVIDVRDFKKSANIEAVDIAKRLMDY 302
           G   HEFV      +      A+D+AK L++ 
Sbjct: 370 GPSMHEFVA-----QPPEGFRALDLAKGLLEL 396


>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Length = 437 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 100.0
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.96
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.96
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 99.95
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.95
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.92
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.89
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.87
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.86
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.83
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.82
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.81
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.81
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.81
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.8
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.79
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.78
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.78
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.75
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.73
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.72
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.71
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.71
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.7
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.7
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.7
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.7
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.7
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.69
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.68
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.68
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.66
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.66
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.65
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.65
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.65
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.64
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.64
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.63
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.63
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.63
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.62
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 99.61
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.6
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.6
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.6
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.6
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.59
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.58
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.58
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.58
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.57
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.56
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.55
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.54
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.54
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.53
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.53
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.53
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.53
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.53
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.52
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.52
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.51
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.49
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.48
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.47
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.46
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.43
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.35
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.23
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.22
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.21
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.12
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.12
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.05
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.05
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.03
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.01
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 98.94
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.85
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.83
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.75
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.68
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 98.63
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 80.56
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Glycine dehydrogenase subunits (GDC-P)
domain: Glycine dehydrogenase (decarboxylating) subunit 1
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=2.5e-53  Score=402.28  Aligned_cols=272  Identities=19%  Similarity=0.255  Sum_probs=234.3

Q ss_pred             CCccccccccccCCcCC-ccCCCCCCCcccccHHHHHHHHHHHHHHHhCCCeeeEeeCchHHHHHHHHHHHHHHHHhhcC
Q psy7357           1 MKLNATTEMIPCSFPQL-TNMHPFIPQDQARGYEQLIGELETDLCEITGYDKISFQPNSGAQGEYAGLRAIQCYHQAQDA   79 (302)
Q Consensus         1 ~~~~p~~~~~~~~~~~f-t~~~py~p~e~sqG~l~~~~e~~~~l~~l~g~~~~~~~~~~Ga~a~~a~l~a~~~~~~~~g~   79 (302)
                      |||+|. ++++++|+|| |+|||||| |++||++|+++|+|+++|+++|||.+++++++|++|+.++++.++.+      
T Consensus        76 ~~~p~~-i~~~~~~~~~~t~ytPyqp-E~sQG~Lq~l~e~q~~l~eltGmd~~n~s~~~ga~a~~~~~~~~~~~------  147 (437)
T d1wyua1          76 HHVPPV-VQALAARGEFLTAYTPYQP-EVSQGVLQATFEYQTMIAELAGLEIANASMYDGATALAEGVLLALRE------  147 (437)
T ss_dssp             CCCCHH-HHHHHTSHHHHHCCSCCSG-GGCHHHHHHHHHHHHHHHHHHTSSEECSCBSSHHHHHHHHHHHHHHH------
T ss_pred             ceeCHH-HHHHHhChhhhhhCCCcch-HHHHHHHHHHHHHHHHHHHhhCCCccccCchHHHHHHHHHHHHHHhh------
Confidence            777665 4789999999 99999999 89999999999999999999999999999999999987777776665      


Q ss_pred             CCCCEEEEcCCCCcccH----HHHHhCCCEEEEeecCCCCCCCHHHHHHHHhccCCCeEEEEEecCCCceeccccHHHHH
Q psy7357          80 HHRNVCLIPVSAHGTNP----ASAQMAGMSVEPVSVRKDGTIDFSDLETKVKKNKETLSCLMITYPSTFGVFEENITDVC  155 (302)
Q Consensus        80 ~~~d~Vlv~~~~hg~~~----~~~~~~g~~v~~i~~~~~g~iD~~~l~~~i~~~~~~t~~V~i~~Pn~~G~~~~di~~I~  155 (302)
                      .++++++++...|+.+.    .+++..|++++.+|.++++. |.++    ++   +++++||+++||++|.++ |+++|+
T Consensus       148 ~~~~~~~v~~~~~p~~~~v~~t~a~~~g~~vv~v~~~~~~~-~~~~----~~---~~~Aavmi~~Pnt~G~~e-d~~~i~  218 (437)
T d1wyua1         148 TGRMGVLVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEGGRT-PLPE----VG---EEVGAVVVQNPNFLGALE-DLGPFA  218 (437)
T ss_dssp             HTCCEEEEETTSCHHHHHHHHHHHHHTTCEEEEECCBTTBC-CCCC----CC---TTEEEEEEESSCTTSBCC-CHHHHH
T ss_pred             hcccccccccccChHHhhhhhhhcccceeeEEeeecccccc-hhhh----hc---cceeEEEEcccccccccc-chHHHH
Confidence            35677899998887653    46778999999999865443 3222    34   899999999999999999 899999


Q ss_pred             HHHHHhCCEEEEecCCcccccccCCCCccCCcEEEeCCCcccCCCCCCCCCcceeEEEeCCCCCCCCCCcccC-------
Q psy7357         156 ELIHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPVHPLSS-------  228 (302)
Q Consensus       156 ~ia~~~g~llivD~a~~~~~~~~~~p~~~gaDiv~~~~hK~l~~p~~~gGp~~G~l~~~~~l~~~lpg~~~~~-------  228 (302)
                      +++|+.|+++++| +++++++++.+|+++|+||++++ ||+|+.|+++|||+.|++++++++.+++|||++|+       
T Consensus       219 ~~~h~~G~l~~~~-ad~~al~~l~~Pg~~GaDi~~g~-~q~fg~p~g~GGP~~G~~a~~~~l~r~lPgrivg~s~d~~G~  296 (437)
T d1wyua1         219 EAAHGAGALFVAV-ADPLSLGVLKPPGAYGADIAVGD-GQSLGLPMGFGGPHFGFLATKKAFVRQLPGRLVSETVDVEGR  296 (437)
T ss_dssp             HHHHHTTCEEEEE-CCTTGGGTBCCHHHHTCSEEEEE-CTTTTCCCGGGCSCCEEEEECGGGGGGCCSCCEEEEEBTTSC
T ss_pred             HHhhhccceEEee-echhhhhccccccccccceEeec-cceeccccCCCcCccccccccchhhccccccccccccccCCc
Confidence            9999999988655 67899999999999999999999 99999999999999999999999999999999974       


Q ss_pred             ------------------------CCCcchhhhHHHHhhHh----h---HHHHH---HHHH-HHh--cccccccccCCCc
Q psy7357         229 ------------------------IDSSIGAVSAAHYGSAS----I---LPISW---AYIR-RLE--SHYKTLFRSSRSG  271 (302)
Q Consensus       229 ------------------------~~~~l~~~~a~~~~~~~----~---~~~~~---~y~~-~l~--~g~~~~~~~~~~~  271 (302)
                                              +||.+.+++|++|+.+.    +   ++++.   +|++ +|.  .|+++++++++  
T Consensus       297 ~~~~l~lqtreqhIrRekatsnict~q~l~a~~a~~Y~~~lG~~GL~~ia~~a~~~A~yl~~~L~~~~g~~~~~~~~~--  374 (437)
T d1wyua1         297 RGFILTLQAREQYIRRAKAKSNITTNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPF--  374 (437)
T ss_dssp             EEEEECCGGGSHHHHGGGSSCCCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCEECSCSSB--
T ss_pred             ccceeecccccccccccccccchhhHHHHHHHHHHHHhhhcCcccHHHHHHHHHHHHHHHHHHhhhcCCeeccCCCCe--
Confidence                                    67888999999999853    3   33333   6776 786  58998877777  


Q ss_pred             ceeEEEEEEeccccccCCCCHHHHHHHhhcC
Q psy7357         272 LVAHEFVIDVRDFKKSANIEAVDIAKRLMDY  302 (302)
Q Consensus       272 ~~~he~~~~~~~~~~~~g~~~~~~~~~l~~~  302 (302)
                        ||||+++++       ++++|++|+|+|+
T Consensus       375 --f~ef~v~~~-------~~~~~i~k~L~d~  396 (437)
T d1wyua1         375 --FNEFALALP-------KDPEAVRRALAER  396 (437)
T ss_dssp             --CSEEEEECS-------SCHHHHHHHHHHT
T ss_pred             --eeEEEEECC-------CCHHHHHHHHHhC
Confidence              999999876       7899999999986



>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure