Psyllid ID: psy7433


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
cEEccccccEEEEEEcccccEEEEEccccccccEEEEEcccccccccEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEcccEEEEEEEccccEEEEEEccccEEEEEcccccEEccccc
cccccccccEEEEEEcccccEEEEcccccccccEEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccccEEEEEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEcccccEEEEEEccccEEEEEEccccEEEEEEcccccccEEEcc
mtyqchnkitsdfvFLGSCSLvataghssesknvclwdsllpQKKALVQAFVChdqgasslvfapQHQLLISagkkgdicvIDLRQRVIRSRFnahespvkclaidpheeffvtgagdgdikspvkclaidpheeffvtgagdgdikvwslsgnhllynfpgeharssfFKHIGQGVTQlhvdggsrlfscgadgsmkvrqlpdrdavvhtly
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFnahespvkclaidPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCgadgsmkvrqlpdrdavvhtly
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
***QCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGA********************
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q8TDJ63036 DmX-like protein 2 OS=Hom yes N/A 0.840 0.058 0.470 3e-54
Q9Y4853027 DmX-like protein 1 OS=Hom no N/A 0.845 0.059 0.492 2e-53
Q6PNC03013 DmX-like protein 1 OS=Mus yes N/A 0.845 0.059 0.497 7e-53
Q8BPN83032 DmX-like protein 2 OS=Mus no N/A 0.835 0.058 0.467 8e-52
D3ZW91 477 POC1 centriolar protein h yes N/A 0.713 0.318 0.268 2e-08
Q8BHD1 476 POC1 centriolar protein h no N/A 0.718 0.321 0.261 6e-08
P87053 605 F-box/WD repeat-containin yes N/A 0.835 0.294 0.266 1e-07
O13615473 Pre-mRNA-splicing factor no N/A 0.723 0.325 0.259 2e-07
Q7ZUV2 694 Katanin p80 WD40 repeat-c no N/A 0.760 0.233 0.243 3e-07
Q12417451 Pre-mRNA-splicing factor yes N/A 0.600 0.283 0.270 4e-07
>sp|Q8TDJ6|DMXL2_HUMAN DmX-like protein 2 OS=Homo sapiens GN=DMXL2 PE=1 SV=2 Back     alignment and function desciption
 Score =  211 bits (536), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 139/204 (68%), Gaps = 25/204 (12%)

Query: 1    MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASS 60
            M++QCH+K TSDF F+ S SLVAT+GHS++++NVCLWD+L+    +L+  F CHD GA+ 
Sbjct: 2846 MSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATV 2905

Query: 61   LVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGD 120
            L +AP+ QLLIS G+KG +C+ D+RQR +   F AH+S +K LA+DP+EE+F T      
Sbjct: 2906 LQYAPKQQLLISGGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTT------ 2959

Query: 121  IKSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQL 180
                               G+ +G+IKVW L+G+ L+++F  EHA+ S F++IG GV Q+
Sbjct: 2960 -------------------GSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQI 3000

Query: 181  HVDGGSRLFSCGADGSMKVRQLPD 204
             +  G+RLFSCGADG++K R LP+
Sbjct: 3001 DIIQGNRLFSCGADGTLKTRVLPN 3024




May serve as a scaffold protein for MADD and RAB3GA on synaptic vesicles.
Homo sapiens (taxid: 9606)
>sp|Q9Y485|DMXL1_HUMAN DmX-like protein 1 OS=Homo sapiens GN=DMXL1 PE=1 SV=3 Back     alignment and function description
>sp|Q6PNC0|DMXL1_MOUSE DmX-like protein 1 OS=Mus musculus GN=Dmxl1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BPN8|DMXL2_MOUSE DmX-like protein 2 OS=Mus musculus GN=Dmxl2 PE=1 SV=3 Back     alignment and function description
>sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=2 SV=1 Back     alignment and function description
>sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=1 SV=1 Back     alignment and function description
>sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 Back     alignment and function description
>sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
170045722 3407 rabconnectin [Culex quinquefasciatus] gi 0.877 0.054 0.702 2e-82
242016272 3332 rabconnectin, putative [Pediculus humanu 0.877 0.056 0.669 2e-81
157113444 3324 rabconnectin [Aedes aegypti] gi|10887771 0.877 0.056 0.698 2e-81
158293116 3521 AGAP010490-PA [Anopheles gambiae str. PE 0.877 0.053 0.693 1e-80
322787403 1599 hypothetical protein SINV_00907 [Solenop 0.877 0.116 0.669 9e-76
3096961 3512 CPY [Chironomus thummi] 0.868 0.052 0.632 9e-76
332022080 3374 DmX-like protein 2 [Acromyrmex echinatio 0.877 0.055 0.669 1e-75
350417854 3370 PREDICTED: dmX-like protein 2-like [Bomb 0.873 0.055 0.668 7e-75
328791656 3364 PREDICTED: LOW QUALITY PROTEIN: rabconne 0.873 0.055 0.668 8e-75
380017047 3308 PREDICTED: LOW QUALITY PROTEIN: dmX-like 0.873 0.056 0.668 8e-75
>gi|170045722|ref|XP_001850447.1| rabconnectin [Culex quinquefasciatus] gi|167868657|gb|EDS32040.1| rabconnectin [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 168/212 (79%), Gaps = 25/212 (11%)

Query: 2    TYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSL 61
            TYQCHNK  +DFVFLGSCSLVATAGHSSESKNV +WD+LLPQKKALV AF CHDQGASSL
Sbjct: 3221 TYQCHNKGITDFVFLGSCSLVATAGHSSESKNVAIWDTLLPQKKALVSAFTCHDQGASSL 3280

Query: 62   VFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDI 121
             +APQHQLLISAGKKGD+C+ D+RQRV+R RF AHE+ +KCLAIDPHEE FVTG      
Sbjct: 3281 AYAPQHQLLISAGKKGDVCIFDVRQRVLRHRFQAHENAIKCLAIDPHEEHFVTG------ 3334

Query: 122  KSPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLH 181
                               + DGDIKVW L+ + LLY+F GEHARSSFFKHIGQGVTQL 
Sbjct: 3335 -------------------SADGDIKVWGLTVHTLLYSFMGEHARSSFFKHIGQGVTQLQ 3375

Query: 182  VDGGSRLFSCGADGSMKVRQLPDRDAVVHTLY 213
            +D G RLFSCGADGSMKVRQLPDR+++VH+LY
Sbjct: 3376 IDQGGRLFSCGADGSMKVRQLPDRESIVHSLY 3407




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242016272|ref|XP_002428753.1| rabconnectin, putative [Pediculus humanus corporis] gi|212513438|gb|EEB16015.1| rabconnectin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157113444|ref|XP_001657831.1| rabconnectin [Aedes aegypti] gi|108877718|gb|EAT41943.1| AAEL006472-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|158293116|ref|XP_558026.3| AGAP010490-PA [Anopheles gambiae str. PEST] gi|157016804|gb|EAL40333.3| AGAP010490-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|322787403|gb|EFZ13491.1| hypothetical protein SINV_00907 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|3096961|emb|CAA57760.1| CPY [Chironomus thummi] Back     alignment and taxonomy information
>gi|332022080|gb|EGI62405.1| DmX-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350417854|ref|XP_003491612.1| PREDICTED: dmX-like protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328791656|ref|XP_003251609.1| PREDICTED: LOW QUALITY PROTEIN: rabconnectin-3A [Apis mellifera] Back     alignment and taxonomy information
>gi|380017047|ref|XP_003692477.1| PREDICTED: LOW QUALITY PROTEIN: dmX-like protein 2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
FB|FBgn00234583429 Rbcn-3A "Rabconnectin-3A" [Dro 0.436 0.027 0.688 4.4e-50
MGI|MGI:24439263013 Dmxl1 "Dmx-like 1" [Mus muscul 0.572 0.040 0.581 6.6e-36
UNIPROTKB|Q8TDJ63036 DMXL2 "DmX-like protein 2" [Ho 0.572 0.040 0.540 9.8e-35
MGI|MGI:24446303032 Dmxl2 "Dmx-like 2" [Mus muscul 0.572 0.040 0.540 3e-33
RGD|15861633055 Dmxl2 "Dmx-like 2" [Rattus nor 0.572 0.039 0.532 1.3e-32
DICTYBASE|DDB_G02835352792 DDB_G0283535 "DmX-like protein 0.558 0.042 0.459 1.5e-22
RGD|2323942 477 Poc1b "POC1 centriolar protein 0.535 0.238 0.308 3.5e-08
MGI|MGI:1918511 476 Poc1b "POC1 centriolar protein 0.539 0.241 0.297 2.4e-07
UNIPROTKB|H3BPD8208 KATNB1 "Katanin p80 WD40 repea 0.347 0.355 0.320 2.8e-06
UNIPROTKB|Q5RD06 451 POC1B "POC1 centriolar protein 0.422 0.199 0.284 0.00051
FB|FBgn0023458 Rbcn-3A "Rabconnectin-3A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 4.4e-50, Sum P(2) = 4.4e-50
 Identities = 64/93 (68%), Positives = 80/93 (86%)

Query:     1 MTYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASS 60
             ++YQCHNK  SDFVFLGSCSL+A+AG SSE+KN+ +WD+LLP KK+ V AF CHDQG+S 
Sbjct:  3239 ISYQCHNKALSDFVFLGSCSLLASAGQSSENKNINIWDTLLPHKKSCVSAFTCHDQGSSC 3298

Query:    61 LVFAPQHQLLISAGKKGDICVIDLRQRVIRSRF 93
             LVFAPQHQ+LIS GK+GD+CV D+RQR +R R+
Sbjct:  3299 LVFAPQHQVLISCGKRGDVCVFDVRQRTLRHRY 3331


GO:0007424 "open tracheal system development" evidence=IMP
GO:0008593 "regulation of Notch signaling pathway" evidence=IMP
GO:0007035 "vacuolar acidification" evidence=IMP
MGI|MGI:2443926 Dmxl1 "Dmx-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDJ6 DMXL2 "DmX-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444630 Dmxl2 "Dmx-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1586163 Dmxl2 "Dmx-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283535 DDB_G0283535 "DmX-like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|2323942 Poc1b "POC1 centriolar protein homolog B (Chlamydomonas)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1918511 Poc1b "POC1 centriolar protein homolog B (Chlamydomonas)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H3BPD8 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RD06 POC1B "POC1 centriolar protein homolog B" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-21
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-21
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 7e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-13
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-04
smart0032040 smart00320, WD40, WD40 repeats 6e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-04
smart0032040 smart00320, WD40, WD40 repeats 0.001
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 89.7 bits (223), Expect = 1e-21
 Identities = 50/216 (23%), Positives = 80/216 (37%), Gaps = 34/216 (15%)

Query: 2   TYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSL 61
           T   H    S   F     ++++   SS  K + +WD  +   K  +     H    +S+
Sbjct: 88  TLTGHTSYVSSVAFSPDGRILSS---SSRDKTIKVWD--VETGK-CLTTLRGHTDWVNSV 141

Query: 62  VFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDI 121
            F+P    + S+ + G I + DLR     +    H   V  +A  P  E  ++ + DG I
Sbjct: 142 AFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTI 201

Query: 122 K-----------------SPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEH 164
           K                 + V  +A  P      +G+ DG I+VW L     +    G  
Sbjct: 202 KLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHT 261

Query: 165 ARSSFFKHIGQGVTQLHVD-GGSRLFSCGADGSMKV 199
                       VT L     G RL S  ADG++++
Sbjct: 262 NS----------VTSLAWSPDGKRLASGSADGTIRI 287


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0263|consensus707 100.0
KOG0279|consensus315 100.0
KOG0272|consensus459 100.0
KOG0279|consensus315 100.0
KOG0286|consensus343 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0271|consensus480 100.0
KOG0295|consensus406 100.0
KOG0315|consensus311 100.0
KOG0645|consensus312 100.0
KOG0293|consensus519 100.0
KOG0282|consensus503 100.0
KOG0284|consensus 464 100.0
KOG0316|consensus307 100.0
KOG0266|consensus456 100.0
KOG0273|consensus524 100.0
KOG0318|consensus 603 100.0
KOG0285|consensus460 100.0
KOG0284|consensus464 100.0
KOG0266|consensus456 100.0
KOG0315|consensus311 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0265|consensus338 100.0
KOG0645|consensus312 99.98
KOG0291|consensus 893 99.98
KOG0283|consensus 712 99.97
KOG0291|consensus 893 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0273|consensus524 99.97
KOG0640|consensus430 99.97
KOG0296|consensus 399 99.97
KOG0276|consensus 794 99.97
KOG0292|consensus 1202 99.97
KOG0276|consensus 794 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0277|consensus311 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0296|consensus399 99.97
KOG0319|consensus 775 99.97
KOG0295|consensus406 99.97
KOG0278|consensus334 99.97
KOG0281|consensus499 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0313|consensus423 99.96
KOG0306|consensus 888 99.96
KOG1407|consensus313 99.96
KOG0277|consensus311 99.96
KOG0643|consensus327 99.96
KOG0275|consensus508 99.96
KOG0319|consensus 775 99.96
KOG0973|consensus 942 99.96
KOG0318|consensus 603 99.96
KOG0294|consensus362 99.96
KOG0643|consensus327 99.96
KOG0285|consensus 460 99.96
KOG0283|consensus 712 99.96
KOG0647|consensus347 99.96
KOG0281|consensus 499 99.96
KOG0265|consensus338 99.96
KOG0289|consensus506 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0313|consensus423 99.95
KOG0264|consensus422 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG0310|consensus 487 99.95
KOG0269|consensus 839 99.95
KOG0306|consensus 888 99.95
PTZ00421 493 coronin; Provisional 99.95
KOG0772|consensus 641 99.95
KOG0292|consensus 1202 99.95
KOG0275|consensus508 99.95
KOG0299|consensus479 99.95
KOG1446|consensus311 99.94
KOG0289|consensus506 99.94
KOG0640|consensus430 99.94
KOG1446|consensus311 99.94
KOG1332|consensus299 99.94
KOG0310|consensus 487 99.94
KOG0288|consensus459 99.94
KOG1407|consensus313 99.94
KOG0264|consensus422 99.94
KOG0274|consensus537 99.94
KOG0772|consensus 641 99.94
KOG0269|consensus 839 99.94
KOG0646|consensus 476 99.93
KOG0305|consensus484 99.93
KOG0641|consensus350 99.93
KOG0267|consensus 825 99.93
KOG0268|consensus433 99.93
KOG0316|consensus307 99.93
KOG0308|consensus 735 99.93
KOG0308|consensus 735 99.93
KOG4283|consensus 397 99.93
KOG0274|consensus 537 99.93
KOG0288|consensus459 99.93
KOG0973|consensus 942 99.93
KOG0300|consensus481 99.93
KOG0305|consensus484 99.92
KOG1273|consensus 405 99.92
KOG2445|consensus361 99.92
KOG0302|consensus440 99.92
KOG0278|consensus 334 99.92
KOG0299|consensus 479 99.92
KOG2048|consensus 691 99.92
KOG2096|consensus420 99.92
KOG0301|consensus 745 99.92
KOG0267|consensus 825 99.92
KOG0270|consensus463 99.91
KOG1036|consensus323 99.91
KOG1332|consensus299 99.91
KOG0282|consensus 503 99.91
KOG0646|consensus 476 99.91
KOG0300|consensus481 99.9
KOG0647|consensus347 99.9
KOG4328|consensus498 99.9
KOG0642|consensus577 99.9
KOG1274|consensus 933 99.9
KOG0270|consensus463 99.9
KOG1408|consensus 1080 99.9
KOG0639|consensus705 99.89
KOG0302|consensus440 99.89
KOG0303|consensus 472 99.89
KOG0301|consensus 745 99.89
KOG0641|consensus350 99.88
KOG0639|consensus705 99.87
KOG1274|consensus 933 99.87
KOG1445|consensus 1012 99.87
KOG2055|consensus514 99.87
KOG1539|consensus 910 99.87
KOG1539|consensus 910 99.87
KOG1036|consensus323 99.86
KOG0307|consensus 1049 99.86
KOG2055|consensus514 99.86
KOG1063|consensus764 99.86
KOG1523|consensus 361 99.86
KOG1273|consensus405 99.86
KOG0771|consensus398 99.85
KOG1009|consensus 434 99.85
KOG1310|consensus 758 99.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.85
KOG1963|consensus 792 99.85
KOG1034|consensus385 99.85
KOG0307|consensus 1049 99.84
KOG0321|consensus 720 99.84
KOG1408|consensus 1080 99.83
KOG0322|consensus323 99.83
KOG2096|consensus420 99.83
KOG1063|consensus 764 99.83
KOG0650|consensus733 99.83
KOG0294|consensus362 99.83
KOG4378|consensus 673 99.83
KOG1007|consensus370 99.82
KOG2106|consensus 626 99.82
KOG0293|consensus 519 99.82
KOG1538|consensus 1081 99.82
KOG2106|consensus626 99.82
KOG2048|consensus 691 99.81
KOG4378|consensus 673 99.81
KOG0290|consensus364 99.81
KOG4283|consensus397 99.81
KOG2919|consensus406 99.81
KOG1445|consensus 1012 99.81
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.81
KOG1523|consensus361 99.8
KOG1538|consensus 1081 99.8
KOG0321|consensus 720 99.8
KOG0268|consensus433 99.8
KOG2110|consensus391 99.79
KOG0649|consensus325 99.78
KOG1007|consensus370 99.78
KOG0303|consensus 472 99.78
KOG0644|consensus 1113 99.77
KOG1009|consensus 434 99.77
KOG1587|consensus555 99.77
KOG1188|consensus 376 99.77
KOG1188|consensus376 99.77
KOG0650|consensus733 99.77
KOG2394|consensus 636 99.76
KOG0290|consensus364 99.76
KOG1034|consensus 385 99.75
KOG2919|consensus 406 99.75
KOG1524|consensus 737 99.75
KOG4227|consensus 609 99.75
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.75
KOG0649|consensus 325 99.74
PRK01742429 tolB translocation protein TolB; Provisional 99.74
KOG4328|consensus498 99.73
KOG1524|consensus 737 99.73
COG2319466 FOG: WD40 repeat [General function prediction only 99.73
KOG2110|consensus391 99.7
KOG2139|consensus445 99.7
KOG0642|consensus577 99.69
COG2319 466 FOG: WD40 repeat [General function prediction only 99.69
KOG1272|consensus 545 99.68
KOG2394|consensus 636 99.67
PRK11028330 6-phosphogluconolactonase; Provisional 99.67
KOG1272|consensus 545 99.67
KOG3881|consensus412 99.67
KOG2111|consensus346 99.66
PRK03629429 tolB translocation protein TolB; Provisional 99.66
KOG2445|consensus 361 99.65
KOG1310|consensus 758 99.65
PRK05137435 tolB translocation protein TolB; Provisional 99.64
PRK02889427 tolB translocation protein TolB; Provisional 99.64
KOG1240|consensus 1431 99.64
PRK11028330 6-phosphogluconolactonase; Provisional 99.63
PRK04922433 tolB translocation protein TolB; Provisional 99.63
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.63
KOG1587|consensus555 99.62
KOG2111|consensus346 99.62
KOG1334|consensus559 99.61
PRK01742429 tolB translocation protein TolB; Provisional 99.58
KOG4227|consensus 609 99.58
KOG0322|consensus323 99.57
KOG1517|consensus1387 99.57
KOG4497|consensus447 99.56
KOG1517|consensus1387 99.56
KOG2321|consensus 703 99.55
KOG2139|consensus 445 99.53
KOG1963|consensus 792 99.52
KOG1240|consensus 1431 99.52
PRK00178430 tolB translocation protein TolB; Provisional 99.49
KOG4497|consensus 447 99.49
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.49
KOG0644|consensus 1113 99.48
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.46
PRK03629429 tolB translocation protein TolB; Provisional 99.46
KOG1354|consensus 433 99.43
KOG1409|consensus 404 99.43
KOG0771|consensus398 99.43
KOG1064|consensus2439 99.43
KOG0974|consensus 967 99.43
PRK05137435 tolB translocation protein TolB; Provisional 99.43
KOG3881|consensus412 99.42
PRK04792448 tolB translocation protein TolB; Provisional 99.42
PRK02889427 tolB translocation protein TolB; Provisional 99.42
PRK01029428 tolB translocation protein TolB; Provisional 99.41
KOG1354|consensus433 99.41
KOG4547|consensus 541 99.4
KOG4190|consensus1034 99.39
KOG0974|consensus 967 99.37
KOG2315|consensus 566 99.36
PRK04922433 tolB translocation protein TolB; Provisional 99.35
KOG1064|consensus2439 99.33
KOG0280|consensus339 99.32
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.32
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.32
KOG0280|consensus339 99.31
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.31
KOG3914|consensus 390 99.29
KOG1912|consensus 1062 99.29
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.28
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.28
KOG2321|consensus 703 99.27
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.27
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.27
KOG2314|consensus 698 99.27
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.24
PRK01029428 tolB translocation protein TolB; Provisional 99.23
KOG2041|consensus 1189 99.23
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.22
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.21
PRK04043419 tolB translocation protein TolB; Provisional 99.2
KOG1334|consensus 559 99.2
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.17
KOG1409|consensus404 99.16
PRK00178430 tolB translocation protein TolB; Provisional 99.15
KOG2066|consensus 846 99.14
KOG0309|consensus 1081 99.13
KOG2695|consensus425 99.12
COG4946 668 Uncharacterized protein related to the periplasmic 99.12
KOG2315|consensus 566 99.11
PRK04792448 tolB translocation protein TolB; Provisional 99.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.1
KOG4547|consensus 541 99.06
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.06
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.05
KOG4532|consensus344 99.03
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.0
KOG2695|consensus425 98.96
KOG1645|consensus463 98.94
KOG4532|consensus344 98.93
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.9
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.88
KOG2114|consensus 933 98.88
COG4946 668 Uncharacterized protein related to the periplasmic 98.88
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.87
KOG4714|consensus319 98.87
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.85
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.82
KOG4190|consensus 1034 98.81
KOG4714|consensus319 98.8
KOG3914|consensus 390 98.8
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.8
KOG0309|consensus 1081 98.78
KOG1275|consensus 1118 98.78
KOG1912|consensus 1062 98.75
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.72
KOG1008|consensus 783 98.7
KOG0882|consensus 558 98.68
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.67
KOG0882|consensus 558 98.65
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.64
KOG1832|consensus 1516 98.64
PRK04043419 tolB translocation protein TolB; Provisional 98.63
KOG2041|consensus 1189 98.6
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.59
KOG1832|consensus 1516 98.58
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.54
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.54
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.54
KOG3617|consensus 1416 98.53
KOG1275|consensus 1118 98.52
KOG3621|consensus 726 98.51
KOG1920|consensus 1265 98.5
KOG4640|consensus 665 98.49
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.46
KOG4649|consensus 354 98.4
KOG2066|consensus 846 98.39
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 98.35
KOG1920|consensus 1265 98.32
COG3490366 Uncharacterized protein conserved in bacteria [Fun 98.32
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.28
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.25
KOG1645|consensus 463 98.23
PRK13616591 lipoprotein LpqB; Provisional 98.18
KOG1008|consensus 783 98.14
KOG2314|consensus698 98.11
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.11
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.07
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.03
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.01
KOG4640|consensus 665 97.99
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.98
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.93
KOG3621|consensus 726 97.91
KOG2079|consensus 1206 97.9
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.89
PRK02888 635 nitrous-oxide reductase; Validated 97.88
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.87
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.86
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.85
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.85
KOG2114|consensus 933 97.83
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.82
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.81
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.79
PRK02888 635 nitrous-oxide reductase; Validated 97.77
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.7
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.69
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.68
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.62
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.61
PRK13616591 lipoprotein LpqB; Provisional 97.61
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.58
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.56
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.52
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.52
KOG3617|consensus 1416 97.49
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.46
KOG4649|consensus 354 97.38
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.36
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.35
KOG2079|consensus 1206 97.32
COG3391381 Uncharacterized conserved protein [Function unknow 97.28
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.27
KOG2395|consensus 644 97.24
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.17
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.12
KOG2444|consensus238 97.05
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 97.05
KOG1916|consensus 1283 96.97
PHA02713557 hypothetical protein; Provisional 96.92
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.91
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.91
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.9
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.89
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.78
COG3391381 Uncharacterized conserved protein [Function unknow 96.74
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.7
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.69
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.68
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.61
KOG4441|consensus571 96.51
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.51
KOG2444|consensus238 96.5
KOG4460|consensus 741 96.46
KOG3630|consensus 1405 96.45
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.45
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.44
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.43
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.4
KOG2395|consensus644 96.39
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.39
KOG4499|consensus310 96.34
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 96.3
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.3
KOG4499|consensus310 96.29
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.28
KOG2377|consensus 657 96.2
KOG1897|consensus 1096 96.18
KOG4460|consensus 741 96.12
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.08
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.03
KOG2280|consensus 829 95.82
KOG3630|consensus 1405 95.82
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.63
KOG4441|consensus571 95.61
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 95.56
KOG2377|consensus 657 95.5
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.5
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.47
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.04
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.86
COG4590 733 ABC-type uncharacterized transport system, permeas 94.81
PRK10115 686 protease 2; Provisional 94.77
KOG2247|consensus 615 94.67
PHA03098534 kelch-like protein; Provisional 94.41
PLN00033398 photosystem II stability/assembly factor; Provisio 94.38
KOG2247|consensus 615 94.36
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.22
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.21
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 94.15
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 93.83
COG5167 776 VID27 Protein involved in vacuole import and degra 93.8
PHA02790480 Kelch-like protein; Provisional 93.5
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.47
COG4590 733 ABC-type uncharacterized transport system, permeas 93.42
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 93.28
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 93.16
PRK13684334 Ycf48-like protein; Provisional 93.12
COG5167776 VID27 Protein involved in vacuole import and degra 93.1
COG5276 370 Uncharacterized conserved protein [Function unknow 93.09
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.79
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.38
KOG1900|consensus 1311 92.36
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 92.16
KOG1900|consensus 1311 92.14
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 91.76
COG3823262 Glutamine cyclotransferase [Posttranslational modi 91.7
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.59
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 91.36
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.06
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.91
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 90.81
PHA02713 557 hypothetical protein; Provisional 90.24
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 90.22
PRK13684334 Ycf48-like protein; Provisional 90.0
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.69
PHA02790480 Kelch-like protein; Provisional 89.22
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.18
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 89.03
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.62
PF14779257 BBS1: Ciliary BBSome complex subunit 1 87.95
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 87.67
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 87.28
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 87.22
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 86.84
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.68
KOG1896|consensus1366 86.37
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 86.22
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 86.07
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 85.92
PF13449326 Phytase-like: Esterase-like activity of phytase 85.68
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 85.41
PHA03098534 kelch-like protein; Provisional 85.33
PLN00033398 photosystem II stability/assembly factor; Provisio 84.71
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 84.65
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 84.63
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 84.61
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 84.46
KOG1916|consensus 1283 84.15
PF12768 281 Rax2: Cortical protein marker for cell polarity 83.95
KOG1983|consensus 993 83.7
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 83.44
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 83.2
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 83.18
PF12768281 Rax2: Cortical protein marker for cell polarity 83.17
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 82.03
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 81.53
PF14727 418 PHTB1_N: PTHB1 N-terminus 80.23
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=6.7e-40  Score=232.36  Aligned_cols=190  Identities=21%  Similarity=0.333  Sum_probs=174.1

Q ss_pred             ccccccCceEEEEEeCCCCeEEEeeccCCCccEEEEeCCCcccccceeeeeeecCCceEEEEecCCCEEEEEcCCCcEEE
Q psy7433           2 TYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICV   81 (213)
Q Consensus         2 ~l~~h~~~v~~~~~~~~~~~l~~~g~~s~~~~i~iwd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~i   81 (213)
                      .+.||.++|.|+.|+|+|..||+|   +.|.++++||+   .+..+..+.++|...|.|++|+|||+.|++|+.||.|++
T Consensus       110 S~~GH~e~Vl~~~fsp~g~~l~tG---sGD~TvR~WD~---~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~l  183 (480)
T KOG0271|consen  110 SIAGHGEAVLSVQFSPTGSRLVTG---SGDTTVRLWDL---DTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRL  183 (480)
T ss_pred             ccCCCCCcEEEEEecCCCceEEec---CCCceEEeecc---CCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEE
Confidence            578999999999999999999999   79999999999   677888899999999999999999999999999999999


Q ss_pred             EeccCceE-EEecccCCCCeeEEEecC-----CCCEEEEecCCCcee---------------------------------
Q psy7433          82 IDLRQRVI-RSRFNAHESPVKCLAIDP-----HEEFFVTGAGDGDIK---------------------------------  122 (213)
Q Consensus        82 wd~~~~~~-~~~~~~~~~~i~~~~~~~-----~~~~l~~~~~~~~i~---------------------------------  122 (213)
                      ||..+++. ...+.+|...|++++|.|     ..+.|++++.||.++                                 
T Consensus       184 wdpktg~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~gliyS  263 (480)
T KOG0271|consen  184 WDPKTGQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGEGLIYS  263 (480)
T ss_pred             ecCCCCCcccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCCceEEe
Confidence            99998854 456788999999999976     566888899998875                                 


Q ss_pred             --------------------------------------------------------------------------------
Q psy7433         123 --------------------------------------------------------------------------------  122 (213)
Q Consensus       123 --------------------------------------------------------------------------------  122 (213)
                                                                                                      
T Consensus       264 gS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgs  343 (480)
T KOG0271|consen  264 GSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGS  343 (480)
T ss_pred             cCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEec
Confidence                                                                                            


Q ss_pred             ------------------------eceEEEEEccCCceEEEecCCCcEEEEEccCCeeeeeecCCCCceeEEEecCCCeE
Q psy7433         123 ------------------------SPVKCLAIDPHEEFFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVT  178 (213)
Q Consensus       123 ------------------------~~v~~~~~~~~~~~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~v~  178 (213)
                                              .-|+.+.|+||++++++++-|..|++||.++++-+.++++|.          ..|+
T Consensus       344 Dd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRGHv----------~~VY  413 (480)
T KOG0271|consen  344 DDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRGHV----------AAVY  413 (480)
T ss_pred             CCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhhcc----------ceeE
Confidence                                    678999999999999999999999999999999999999997          7899


Q ss_pred             EEEeCCCCe-EEEEecCCcEEEEeCCCCcc
Q psy7433         179 QLHVDGGSR-LFSCGADGSMKVRQLPDRDA  207 (213)
Q Consensus       179 ~~~~~~~~~-l~s~~~d~~i~iw~~~~~~~  207 (213)
                      .++|+.|.+ |++|+.|.++++|++++.+.
T Consensus       414 qvawsaDsRLlVS~SkDsTLKvw~V~tkKl  443 (480)
T KOG0271|consen  414 QVAWSADSRLLVSGSKDSTLKVWDVRTKKL  443 (480)
T ss_pred             EEEeccCccEEEEcCCCceEEEEEeeeeee
Confidence            999998765 88999999999999998743



>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14779 BBS1: Ciliary BBSome complex subunit 1 Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 7e-05
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 9e-05
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 4e-04
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 5e-04
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure

Iteration: 1

Score = 43.9 bits (102), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 9/112 (8%) Query: 28 SSESKNVCLWDSLLPQKKALVQAFVC--HDQGASSLVFAPQHQLLISAGKKGDICVIDLR 85 +S+S V LW+ +L ++ LV F HD +L +S GK + V DL Sbjct: 111 ASDSGAVELWE-ILEKESLLVNKFAKYEHDDIVKTLSVFSDGTQAVSGGKDFSVKVWDLS 169 Query: 86 QRVIRSRFNAHESPVKCLAIDP-HEEFFVTGAGDG-----DIKSPVKCLAID 131 Q+ + +NAH S V C+A P + F++ DG D + P ID Sbjct: 170 QKAVLKSYNAHSSEVNCVAACPGKDTIFLSCGEDGRILLWDTRKPKPATRID 221
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 100.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.98
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.98
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.98
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.98
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.98
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.98
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.98
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.98
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.98
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.98
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.97
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.94
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.94
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.88
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.86
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.86
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.86
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.85
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.85
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.84
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.83
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.82
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.82
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.82
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.82
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.82
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.8
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.8
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.79
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.78
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.77
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.76
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.75
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.73
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.73
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.73
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.71
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.71
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.7
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.7
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.69
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.68
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.68
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.66
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.65
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.64
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.64
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.64
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.63
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.61
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.61
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.6
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 99.59
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.59
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.58
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.56
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.55
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.54
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.53
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.5
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.5
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.49
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.48
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.45
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.44
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.43
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.41
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.4
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.39
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.39
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.37
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.37
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.37
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.36
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.34
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.32
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.31
2qe8_A343 Uncharacterized protein; structural genomics, join 99.3
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.28
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.27
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.27
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.25
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.24
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.24
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.23
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.21
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.2
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.14
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.09
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.08
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.03
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.99
2qe8_A343 Uncharacterized protein; structural genomics, join 98.95
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.94
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 98.93
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.93
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.92
2ece_A462 462AA long hypothetical selenium-binding protein; 98.91
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.84
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.79
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.78
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.76
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.74
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.74
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.7
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.67
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.64
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.63
3v65_B386 Low-density lipoprotein receptor-related protein; 98.6
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.59
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.57
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.57
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.57
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.53
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.52
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.49
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.49
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.44
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.44
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.41
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.36
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.33
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.32
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.32
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.31
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 98.23
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.21
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.2
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.18
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.17
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.13
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.12
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.12
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.11
3v65_B386 Low-density lipoprotein receptor-related protein; 98.11
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.09
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.09
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.09
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.08
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.06
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.05
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.02
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.02
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.99
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.93
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.91
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 97.91
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.89
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.88
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.86
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.8
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.8
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.79
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.74
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.67
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.62
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.55
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.5
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.43
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.4
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.37
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.37
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.29
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.25
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.24
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.21
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.17
3kya_A496 Putative phosphatase; structural genomics, joint c 97.08
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.07
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.06
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.05
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.89
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.75
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 96.66
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.59
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.46
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.32
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.01
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.99
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.93
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.88
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.87
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.85
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.8
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.69
3ott_A 758 Two-component system sensor histidine kinase; beta 95.63
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.48
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.42
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.39
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.35
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 95.34
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.97
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 93.93
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.66
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.35
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 93.27
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 92.69
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 92.15
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.96
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.29
2xzh_A 365 Clathrin heavy chain 1; endocytosis, endocytosis i 90.26
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 89.15
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 89.15
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 88.69
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 87.62
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 87.56
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 86.88
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 86.66
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 80.28
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=233.25  Aligned_cols=200  Identities=19%  Similarity=0.290  Sum_probs=168.3

Q ss_pred             ccccccCceEEEEEeCCCCeEEEeeccCCCccEEEEeCCCcccccceeeeeeecCCceEEEEecCCCEEEEEcCCCcEEE
Q psy7433           2 TYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICV   81 (213)
Q Consensus         2 ~l~~h~~~v~~~~~~~~~~~l~~~g~~s~~~~i~iwd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~i   81 (213)
                      +|++|.+.|++++|+|++++|+++   +.|+.|++||+   .+...+..+..|..+|.+++|+|++++|++|+.|+.|++
T Consensus         8 ~~~~h~~~V~~~~fsp~~~~l~s~---~~dg~v~lWd~---~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~v   81 (304)
T 2ynn_A            8 TFSNRSDRVKGIDFHPTEPWVLTT---LYSGRVELWNY---ETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRV   81 (304)
T ss_dssp             EEEEECSCEEEEEECSSSSEEEEE---ETTSEEEEEET---TTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEE
T ss_pred             eecCCCCceEEEEECCCCCEEEEE---cCCCcEEEEEC---CCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEE
Confidence            688999999999999999999999   68999999999   566778888899999999999999999999999999999


Q ss_pred             EeccCceEEEecccCCCCeeEEEecCCCCEEEEecCCCcee------------------eceEEEEEcc-CCceEEEecC
Q psy7433          82 IDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIK------------------SPVKCLAIDP-HEEFFVTGAG  142 (213)
Q Consensus        82 wd~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~i~------------------~~v~~~~~~~-~~~~l~~~~~  142 (213)
                      ||+++++.+..+.+|...|.+++|+|++++|++++.|+.++                  ..|.+++|+| ++.+|++|+.
T Consensus        82 wd~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~l~sgs~  161 (304)
T 2ynn_A           82 FNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCL  161 (304)
T ss_dssp             EETTTCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTEEEEEECCCCSCEEEEEECTTCTTEEEEEET
T ss_pred             EECCCCcEEEEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcchhhhhcccCCcEEEEEECCCCCCEEEEEeC
Confidence            99999999999999999999999999999999999999886                  5688889988 5678888888


Q ss_pred             CCcEEEEEccCCeeeeee-------------cC---------------------CC-CceeEEEecCCCeEEEEeCCCC-
Q psy7433         143 DGDIKVWSLSGNHLLYNF-------------PG---------------------EH-ARSSFFKHIGQGVTQLHVDGGS-  186 (213)
Q Consensus       143 dg~i~v~d~~~~~~~~~~-------------~~---------------------~~-~~~~~~~~~~~~v~~~~~~~~~-  186 (213)
                      |+.|++||+++......+             ..                     .. .....+..|...|.+++|+|++ 
T Consensus       162 D~~v~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~~~~~~~h~~~v~~~~~~p~~~  241 (304)
T 2ynn_A          162 DRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLP  241 (304)
T ss_dssp             TSEEEEEETTCSSCSEEEECCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSS
T ss_pred             CCeEEEEECCCCCccceeccCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCccceeeCCCCCCEEEEEECCCCC
Confidence            888888887543211110             00                     00 0111234466889999999965 


Q ss_pred             eEEEEecCCcEEEEeCCCCcc
Q psy7433         187 RLFSCGADGSMKVRQLPDRDA  207 (213)
Q Consensus       187 ~l~s~~~d~~i~iw~~~~~~~  207 (213)
                      .|++++.||.|++||+.+.+.
T Consensus       242 ~l~s~s~Dg~i~iWd~~~~~~  262 (304)
T 2ynn_A          242 IIISGSEDGTLKIWNSSTYKV  262 (304)
T ss_dssp             EEEEEETTSCEEEEETTTCCE
T ss_pred             EEEEEcCCCeEEEEECCCCce
Confidence            699999999999999988753



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-10
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 9e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-05
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-04
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 32/167 (19%), Positives = 53/167 (31%), Gaps = 30/167 (17%)

Query: 53  CHDQGASSLVFAPQHQLLISAGKKGDICVIDLRQRVIRSRFNAHESPVKCLAIDPHEEFF 112
            H     SL  AP  +L +S        + D+R+ + R  F  HES +  +   P+   F
Sbjct: 182 GHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAF 241

Query: 113 VTGAGDGDIK-------------------SPVKCLAIDPHEEFFVTGAGDGDIKVWSLSG 153
            TG+ D   +                     +  ++        + G  D +  VW    
Sbjct: 242 ATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALK 301

Query: 154 NHLLYNFPGEHARSSFFKHIGQGVTQLHV-DGGSRLFSCGADGSMKV 199
                   G   R          V+ L V D G  + +   D  +K+
Sbjct: 302 ADRAGVLAGHDNR----------VSCLGVTDDGMAVATGSWDSFLKI 338


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.93
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.88
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.78
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.75
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.74
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.74
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.66
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.65
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.53
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.44
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.37
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.36
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.34
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.33
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.23
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.2
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.18
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.17
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.15
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.09
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.08
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.07
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.04
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.0
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.92
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.88
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.87
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.79
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.74
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.71
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.48
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.48
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.45
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.98
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.98
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.94
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.74
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.5
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.33
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.9
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.74
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.31
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 96.29
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.27
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.23
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.19
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.14
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.04
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.98
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.31
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.31
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.22
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.03
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.47
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.37
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 92.29
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.02
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.38
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 89.26
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.23
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 89.09
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 85.87
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 80.33
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=3.4e-38  Score=231.47  Aligned_cols=184  Identities=19%  Similarity=0.306  Sum_probs=161.1

Q ss_pred             ccccccCceEEEEEeCCCCeEEEeeccCCCccEEEEeCCCcccccceeeeeeecCCceEEEEecCCCEEEEEcCCCcEEE
Q psy7433           2 TYQCHNKITSDFVFLGSCSLVATAGHSSESKNVCLWDSLLPQKKALVQAFVCHDQGASSLVFAPQHQLLISAGKKGDICV   81 (213)
Q Consensus         2 ~l~~h~~~v~~~~~~~~~~~l~~~g~~s~~~~i~iwd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~i   81 (213)
                      +|+||.++|++++|+|++++||++   +.||.|+|||+   .+.+.+..+..|...|.+++|+|+++++++++.|+.+.+
T Consensus        50 tL~GH~~~I~~l~~s~~~~~l~sg---s~Dg~v~iWd~---~~~~~~~~~~~~~~~v~~v~~~~~~~~l~~~~~d~~i~~  123 (340)
T d1tbga_          50 TLRGHLAKIYAMHWGTDSRLLVSA---SQDGKLIIWDS---YTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSI  123 (340)
T ss_dssp             EECCCSSCEEEEEECTTSSEEEEE---ETTTEEEEEET---TTTEEEEEEECSCSCEEEEEECTTSSEEEEEETTCCEEE
T ss_pred             EECCCCCCEEEEEECCCCCEEEEE---ECCCceeeeec---ccceeEEEEecccccEEeeEeeccceeeeeecccceeec
Confidence            689999999999999999999999   68999999999   566777788888888999999988887777766655544


Q ss_pred             --------------------------------------------------------------------------------
Q psy7433          82 --------------------------------------------------------------------------------   81 (213)
Q Consensus        82 --------------------------------------------------------------------------------   81 (213)
                                                                                                      
T Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  203 (340)
T d1tbga_         124 YNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGA  203 (340)
T ss_dssp             EESSSSCSCCCEEEEECCCSSCEEEEEEEETTEEEEEETTTEEEEEETTTTEEEEEEECCSSCEEEEEECTTSSEEEEEE
T ss_pred             ccccccccccccceecccccccccccccccccccccccccccccccccccccccccccccceeEeeeccccccceeEEee
Confidence                                                                                            


Q ss_pred             -------EeccCceEEEecccCCCCeeEEEecCCCCEEEEecCCCcee-------------------eceEEEEEccCCc
Q psy7433          82 -------IDLRQRVIRSRFNAHESPVKCLAIDPHEEFFVTGAGDGDIK-------------------SPVKCLAIDPHEE  135 (213)
Q Consensus        82 -------wd~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~i~-------------------~~v~~~~~~~~~~  135 (213)
                             ||+++++.+..+.+|...|.+++|+|++++|++++.|+.++                   ..+.+++|+|+++
T Consensus       204 ~d~~v~i~d~~~~~~~~~~~~h~~~i~~v~~~p~~~~l~s~s~d~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~s~~~~  283 (340)
T d1tbga_         204 CDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGR  283 (340)
T ss_dssp             TTTEEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCTTCCSCEEEEEECSSSC
T ss_pred             cCceEEEEECCCCcEEEEEeCCCCCeEEEEECCCCCEEEEEeCCCeEEEEeecccccccccccccccCceEEEEECCCCC
Confidence                   44444445556667888999999999999999999999886                   6689999999999


Q ss_pred             eEEEecCCCcEEEEEccCCeeeeeecCCCCceeEEEecCCCeEEEEeCCCC-eEEEEecCCcEEEEe
Q psy7433         136 FFVTGAGDGDIKVWSLSGNHLLYNFPGEHARSSFFKHIGQGVTQLHVDGGS-RLFSCGADGSMKVRQ  201 (213)
Q Consensus       136 ~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~-~l~s~~~d~~i~iw~  201 (213)
                      +|++|+.||.|++||+++++++..+.+|.          .+|++++|+|++ +|++++.||.|++||
T Consensus       284 ~l~~g~~dg~i~iwd~~~~~~~~~~~~H~----------~~V~~l~~s~d~~~l~s~s~Dg~v~iWd  340 (340)
T d1tbga_         284 LLLAGYDDFNCNVWDALKADRAGVLAGHD----------NRVSCLGVTDDGMAVATGSWDSFLKIWN  340 (340)
T ss_dssp             EEEEEETTSCEEEEETTTCCEEEEECCCS----------SCEEEEEECTTSSCEEEEETTSCEEEEC
T ss_pred             EEEEEECCCEEEEEECCCCcEEEEEcCCC----------CCEEEEEEeCCCCEEEEEccCCEEEEeC
Confidence            99999999999999999999999999886          789999999965 699999999999997



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure