Psyllid ID: psy7436


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKIRK
cHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccEEEHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHcc
cHHHHHHHcccccEEEHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHH
mieeygslldgdgtitTKELGTVMRslgqnpteaELQDMINEvdadenvesNLQYAELFVYhgngtidfPEFLTMMARKMKDTDSEEEIREAFRVFdkdgngfiSAAELRHVMTNLGEKLTDEEVDEMIREadidgdgqvnyegngtidfPEFLTMMARKMKDTDSEEEIREAFRVFdkdgngfiSAAELRHVMTNLGEKLTDEEVDEMIREadidgdgqvnYEVYTIYCVHIMgntylkirk
mieeygslldgdgtiTTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAdidgdgqvnyegnGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREadidgdgqvnYEVYTIYCVHIMGNTYLKIRK
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKIRK
************************************************VESNLQYAELFVYHGNGTIDFPEFLTMMA************REAFRVFDKDGNGFISAAELRHVMTNLGEKLT******MIREADIDGDGQVNYEGNGTIDFPEFLTMM**************EAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKI**
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMAR********EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKM******EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIM*********
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARK********EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARK********EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKIRK
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKI**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEEYGSLLDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMGNTYLKIRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q8STF0156 Calmodulin OS=Strongyloce N/A N/A 0.522 0.814 0.821 6e-61
P62154149 Calmodulin OS=Locusta mig N/A N/A 0.522 0.852 0.821 9e-61
P62152149 Calmodulin OS=Drosophila yes N/A 0.522 0.852 0.821 9e-61
P62145149 Calmodulin OS=Aplysia cal N/A N/A 0.522 0.852 0.821 9e-61
P62153149 Calmodulin-A OS=Halocynth N/A N/A 0.522 0.852 0.821 9e-61
P62148149 Calmodulin-1 OS=Branchios N/A N/A 0.522 0.852 0.821 9e-61
P62147149 Calmodulin-1 OS=Branchios no N/A 0.522 0.852 0.821 9e-61
O16305149 Calmodulin OS=Caenorhabdi yes N/A 0.522 0.852 0.821 1e-60
Q9GRJ1149 Calmodulin OS=Lumbricus r N/A N/A 0.522 0.852 0.821 1e-60
P21251149 Calmodulin OS=Stichopus j N/A N/A 0.522 0.852 0.814 2e-60
>sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 Back     alignment and function desciption
 Score =  234 bits (596), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 125/151 (82%), Gaps = 24/151 (15%)

Query: 10  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69
           DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD                GNGTIDF
Sbjct: 30  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 73

Query: 70  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129
           PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct: 74  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 133

Query: 130 READIDGDGQVNYEGNGTIDFPEFLTMMARK 160
           READIDGDGQVNYE        EF+TMM  K
Sbjct: 134 READIDGDGQVNYE--------EFVTMMTSK 156




Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.
Strongylocentrotus intermedius (taxid: 7667)
>sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 Back     alignment and function description
>sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 Back     alignment and function description
>sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 Back     alignment and function description
>sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 Back     alignment and function description
>sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 Back     alignment and function description
>sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 Back     alignment and function description
>sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 Back     alignment and function description
>sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
405952420 713 Calmodulin [Crassostrea gigas] 0.839 0.286 0.691 1e-94
260796519 518 hypothetical protein BRAFLDRAFT_124868 [ 0.827 0.388 0.626 3e-82
405958080 513 Calmodulin [Crassostrea gigas] 0.843 0.399 0.591 5e-80
2959326225 calmodulin-like protein [Branchiostoma l 0.814 0.88 0.681 2e-74
390352639332 PREDICTED: calmodulin-like protein 12-li 0.818 0.599 0.577 1e-72
405958084 480 Calmodulin [Crassostrea gigas] 0.818 0.414 0.537 2e-65
47206393165 unnamed protein product [Tetraodon nigro 0.588 0.866 0.835 1e-60
324535412169 Calmodulin, partial [Ascaris suum] 0.555 0.798 0.773 3e-60
444730770 468 Calmodulin [Tupaia chinensis] 0.522 0.271 0.807 3e-60
344269363 451 PREDICTED: hypothetical protein LOC10065 0.522 0.281 0.807 6e-60
>gi|405952420|gb|EKC20234.1| Calmodulin [Crassostrea gigas] Back     alignment and taxonomy information
 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 202/272 (74%), Gaps = 68/272 (25%)

Query: 10  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69
           DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD                GNGTIDF
Sbjct: 236 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 279

Query: 70  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129
           PEFLTMMA+KMKD+DSEEE+REAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct: 280 PEFLTMMAKKMKDSDSEEELREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 339

Query: 130 READIDGDGQVNYE---------------------------------------------- 143
           READ+DGDGQVNYE                                              
Sbjct: 340 READLDGDGQVNYEEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEID 399

Query: 144 --GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKL 201
             GNGTIDFPEF+TMMA++ K+ DSEEE+REAFRVFDKDGNGFISAAELRHVMTNLGEKL
Sbjct: 400 ADGNGTIDFPEFITMMAKQTKECDSEEELREAFRVFDKDGNGFISAAELRHVMTNLGEKL 459

Query: 202 TDEEVDEMIREADIDGDGQVNY----EVYTIY 229
           TDEEV+EMIREADIDGDGQVNY    EV++++
Sbjct: 460 TDEEVNEMIREADIDGDGQVNYDEFKEVFSLF 491




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|260796519|ref|XP_002593252.1| hypothetical protein BRAFLDRAFT_124868 [Branchiostoma floridae] gi|229278476|gb|EEN49263.1| hypothetical protein BRAFLDRAFT_124868 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|405958080|gb|EKC24243.1| Calmodulin [Crassostrea gigas] Back     alignment and taxonomy information
>gi|2959326|emb|CAA04528.1| calmodulin-like protein [Branchiostoma lanceolatum] Back     alignment and taxonomy information
>gi|390352639|ref|XP_790786.3| PREDICTED: calmodulin-like protein 12-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|405958084|gb|EKC24247.1| Calmodulin [Crassostrea gigas] Back     alignment and taxonomy information
>gi|47206393|emb|CAF91408.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|324535412|gb|ADY49415.1| Calmodulin, partial [Ascaris suum] Back     alignment and taxonomy information
>gi|444730770|gb|ELW71144.1| Calmodulin [Tupaia chinensis] Back     alignment and taxonomy information
>gi|344269363|ref|XP_003406522.1| PREDICTED: hypothetical protein LOC100657612 [Loxodonta africana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
UNIPROTKB|F1NSP2131 CALM1 "Uncharacterized protein 0.493 0.916 0.875 6.8e-56
FB|FBgn0000253149 Cam "Calmodulin" [Drosophila m 0.522 0.852 0.821 8.6e-56
WB|WBGene00000552149 cmd-1 [Caenorhabditis elegans 0.522 0.852 0.821 8.6e-56
UNIPROTKB|E2R8S4156 CALM2 "Uncharacterized protein 0.514 0.801 0.845 2.3e-55
UNIPROTKB|F1NZQ5131 CALM "Calmodulin" [Gallus gall 0.489 0.908 0.874 2.9e-55
UNIPROTKB|E7ETZ0150 CALM1 "Calmodulin" [Homo sapie 0.522 0.846 0.807 7.8e-55
UNIPROTKB|F2Z4K8148 CALM "Uncharacterized protein" 0.522 0.858 0.807 7.8e-55
UNIPROTKB|H0Y7A7187 CALM2 "Calmodulin" [Homo sapie 0.522 0.679 0.807 7.8e-55
UNIPROTKB|E7EMB3196 CALM2 "Calmodulin" [Homo sapie 0.522 0.647 0.807 7.8e-55
UNIPROTKB|P62149149 CALM "Calmodulin" [Gallus gall 0.522 0.852 0.807 7.8e-55
UNIPROTKB|F1NSP2 CALM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 576 (207.8 bits), Expect = 6.8e-56, P = 6.8e-56
 Identities = 119/136 (87%), Positives = 120/136 (88%)

Query:    10 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69
             DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD                GNGTIDF
Sbjct:    12 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 55

Query:    70 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129
             PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNG+ISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct:    56 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMI 115

Query:   130 READIDGDGQVNYEGN 145
             READIDGDGQVNYEGN
Sbjct:   116 READIDGDGQVNYEGN 131


GO:0005509 "calcium ion binding" evidence=IEA
FB|FBgn0000253 Cam "Calmodulin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00000552 cmd-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8S4 CALM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZQ5 CALM "Calmodulin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETZ0 CALM1 "Calmodulin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4K8 CALM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y7A7 CALM2 "Calmodulin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EMB3 CALM2 "Calmodulin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62149 CALM "Calmodulin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O02367CALM_CIOINNo assigned EC number0.80790.52260.8523yesN/A
O16305CALM_CAEELNo assigned EC number0.82110.52260.8523yesN/A
P62204CALM_MOUSENo assigned EC number0.80790.52260.8523yesN/A
P62149CALM_CHICKNo assigned EC number0.80790.52260.8523yesN/A
Q6PI52CALM_DANRENo assigned EC number0.80790.52260.8523yesN/A
P62161CALM_RATNo assigned EC number0.80790.52260.8523yesN/A
Q5RAD2CALM_PONABNo assigned EC number0.80790.52260.8523yesN/A
P62157CALM_BOVINNo assigned EC number0.80790.52260.8523yesN/A
P62152CALM_DROMENo assigned EC number0.82110.52260.8523yesN/A
P62158CALM_HUMANNo assigned EC number0.80790.52260.8523yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 9e-72
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 8e-62
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 4e-42
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 7e-42
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 4e-34
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 1e-29
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-19
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-18
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 7e-11
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 4e-10
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 5e-10
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-09
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 3e-09
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 9e-09
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 6e-07
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 1e-06
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 1e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-06
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 1e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 1e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 1e-05
pfam0003629 pfam00036, efhand, EF hand 2e-05
pfam0003629 pfam00036, efhand, EF hand 2e-05
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 6e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 1e-04
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 2e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 3e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.001
smart0002796 smart00027, EH, Eps15 homology domain 0.001
PLN02964 644 PLN02964, PLN02964, phosphatidylserine decarboxyla 0.001
PLN02964 644 PLN02964, PLN02964, phosphatidylserine decarboxyla 0.001
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.002
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 0.003
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
 Score =  215 bits (550), Expect = 9e-72
 Identities = 117/151 (77%), Positives = 124/151 (82%), Gaps = 24/151 (15%)

Query: 10  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69
           DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD                GNGTIDF
Sbjct: 23  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 66

Query: 70  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129
           PEFLT+MARKMKDTDSEEEI+EAF+VFD+DGNGFISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct: 67  PEFLTLMARKMKDTDSEEEIKEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 126

Query: 130 READIDGDGQVNYEGNGTIDFPEFLTMMARK 160
           READ+DGDGQ+NYE        EF+ MM  K
Sbjct: 127 READVDGDGQINYE--------EFVKMMMSK 149


Length = 149

>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase Back     alignment and domain information
>gnl|CDD|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.93
KOG0027|consensus151 99.89
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.87
KOG0027|consensus151 99.87
PTZ00183158 centrin; Provisional 99.85
PTZ00184149 calmodulin; Provisional 99.85
KOG0028|consensus172 99.82
KOG0031|consensus171 99.82
KOG0028|consensus172 99.82
KOG0037|consensus221 99.8
KOG0037|consensus221 99.79
PTZ00183158 centrin; Provisional 99.78
PTZ00184149 calmodulin; Provisional 99.77
KOG0030|consensus152 99.76
KOG4223|consensus325 99.72
KOG0031|consensus171 99.72
KOG0034|consensus187 99.69
KOG0036|consensus 463 99.67
KOG2643|consensus489 99.63
KOG0044|consensus193 99.61
KOG0044|consensus193 99.59
KOG0030|consensus152 99.58
KOG0036|consensus 463 99.49
KOG0034|consensus187 99.44
KOG2562|consensus493 99.43
KOG4251|consensus362 99.41
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.37
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.35
KOG4223|consensus325 99.28
KOG0377|consensus631 99.28
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.25
PLN02964 644 phosphatidylserine decarboxylase 99.22
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.19
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 99.17
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.13
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.11
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.1
cd0005267 EH Eps15 homology domain; found in proteins implic 99.09
PLN02964 644 phosphatidylserine decarboxylase 99.05
KOG0751|consensus 694 99.04
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.04
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.01
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 99.0
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.99
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.98
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.97
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.96
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.91
KOG0038|consensus189 98.89
KOG2643|consensus489 98.88
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.87
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.84
PF1465866 EF-hand_9: EF-hand domain 98.82
KOG0038|consensus189 98.78
KOG4251|consensus362 98.78
cd0005267 EH Eps15 homology domain; found in proteins implic 98.7
KOG0377|consensus631 98.7
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.68
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.68
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.66
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.65
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.63
KOG0751|consensus 694 98.57
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.57
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.56
KOG0040|consensus2399 98.56
KOG0040|consensus2399 98.51
KOG2562|consensus 493 98.5
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.47
KOG0041|consensus244 98.45
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.45
PF1465866 EF-hand_9: EF-hand domain 98.43
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.39
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.33
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.29
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 98.27
KOG0041|consensus244 98.26
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.25
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.22
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.18
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.08
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.99
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.95
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.89
KOG4666|consensus412 97.83
KOG0169|consensus 746 97.78
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.73
KOG1029|consensus 1118 97.72
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.68
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.66
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.55
KOG0046|consensus 627 97.32
KOG0169|consensus 746 97.3
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.3
KOG4065|consensus144 97.3
KOG1707|consensus 625 97.28
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 97.15
KOG4666|consensus412 96.86
KOG1029|consensus 1118 96.71
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.59
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.55
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 96.28
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 96.16
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.13
KOG4065|consensus144 95.96
KOG0046|consensus 627 95.85
KOG0998|consensus 847 95.65
KOG1707|consensus 625 95.58
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 94.51
KOG4578|consensus421 94.44
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 94.27
KOG1955|consensus 737 94.06
KOG1265|consensus 1189 94.03
KOG2243|consensus 5019 93.9
PLN02952 599 phosphoinositide phospholipase C 93.77
KOG3555|consensus 434 93.67
KOG1265|consensus 1189 93.66
KOG4347|consensus671 93.54
KOG0035|consensus890 93.54
KOG0035|consensus890 93.07
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 93.02
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 93.02
PF14513138 DAG_kinase_N: Diacylglycerol kinase N-terminus; PD 92.49
KOG0042|consensus680 91.64
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 91.33
KOG4347|consensus671 91.27
KOG3866|consensus 442 91.11
KOG1955|consensus 737 90.16
KOG3555|consensus434 89.71
PF14513138 DAG_kinase_N: Diacylglycerol kinase N-terminus; PD 89.63
cd07313104 terB_like_2 tellurium resistance terB-like protein 89.4
PLN02952 599 phosphoinositide phospholipase C 89.19
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 89.06
COG4103148 Uncharacterized protein conserved in bacteria [Fun 89.04
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 87.57
KOG2243|consensus 5019 87.51
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 86.61
PF1111685 DUF2624: Protein of unknown function (DUF2624); In 82.68
PF1217470 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: I 81.64
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 81.52
PF1217470 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: I 81.52
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
Probab=99.93  E-value=4.3e-24  Score=149.24  Aligned_cols=140  Identities=44%  Similarity=0.851  Sum_probs=131.6

Q ss_pred             ccHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHHhCcCCCCccccCCCCCCChHHHHHHHHhhcCC
Q psy7436          84 DSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMARKMKD  163 (243)
Q Consensus        84 ~~~~~l~~~f~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~~i~~~ef~~~~~~~~~~  163 (243)
                      ....+++.+|..+|++++|.|+..+|..+++.+|..++.+++..++..++. +.+.        |+|.+|+.++......
T Consensus        17 ~qi~~lkeaF~l~D~d~~G~I~~~el~~ilr~lg~~~s~~ei~~l~~~~d~-~~~~--------idf~~Fl~~ms~~~~~   87 (160)
T COG5126          17 EQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDA-GNET--------VDFPEFLTVMSVKLKR   87 (160)
T ss_pred             HHHHHHHHHHHHhCcCCCCCCcHHHHHHHHHHcCCCCcHHHHHHHHHhccC-CCCc--------cCHHHHHHHHHHHhcc
Confidence            456789999999999999999999999999999999999999999999998 5454        7999999999999988


Q ss_pred             CCcHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHhcCCCCCCcccHHHHHHHHHH
Q psy7436         164 TDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEVYTIYCVH  232 (243)
Q Consensus       164 ~~~~~~~~~~f~~~D~~~~G~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~eF~~~~~~  232 (243)
                      ....+.+..+|+.||.+++|+|+..+++++|+.+|..+++++++.+++.+|++++|+|+|++|++.+..
T Consensus        88 ~~~~Eel~~aF~~fD~d~dG~Is~~eL~~vl~~lge~~~deev~~ll~~~d~d~dG~i~~~eF~~~~~~  156 (160)
T COG5126          88 GDKEEELREAFKLFDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGEIDYEEFKKLIKD  156 (160)
T ss_pred             CCcHHHHHHHHHHhCCCCCceecHHHHHHHHHhhcccCCHHHHHHHHHhcCCCCCceEeHHHHHHHHhc
Confidence            888999999999999999999999999999999999999999999999999999999999999987653



>KOG0027|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A Back     alignment and domain information
>cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>COG4103 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>PF11116 DUF2624: Protein of unknown function (DUF2624); InterPro: IPR020277 This entry contains proteins with no known function Back     alignment and domain information
>PF12174 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: IPR022003 This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>PF12174 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: IPR022003 This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 6e-62
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 5e-53
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 4e-09
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 7e-62
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 4e-53
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 2e-09
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 8e-62
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 6e-53
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 4e-09
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 1e-61
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 5e-53
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 3e-09
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-61
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 9e-53
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-09
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 5e-61
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 1e-52
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 3e-09
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 6e-61
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 1e-52
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 3e-09
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 8e-61
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 8e-53
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 2e-09
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 8e-61
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 1e-53
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 2e-10
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 8e-61
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 9e-53
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-09
2ygg_B150 Complex Of Cambr And Cam Length = 150 9e-61
2ygg_B150 Complex Of Cambr And Cam Length = 150 1e-52
2ygg_B150 Complex Of Cambr And Cam Length = 150 3e-09
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 9e-61
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 1e-52
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 3e-09
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 9e-61
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 2e-52
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 4e-09
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 1e-60
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 2e-52
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 4e-09
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 1e-60
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 1e-53
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 3e-10
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 1e-60
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 1e-52
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 2e-09
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 1e-60
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 2e-52
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 4e-09
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 1e-60
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 2e-53
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 3e-10
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 1e-60
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 2e-52
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 4e-09
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 1e-60
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 1e-52
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 2e-09
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 1e-60
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 2e-52
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 4e-09
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 2e-60
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 2e-52
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 2e-09
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 3e-60
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 4e-52
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 4e-09
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 3e-60
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 2e-52
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 4e-09
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 3e-60
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 2e-53
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 3e-10
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 3e-60
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 2e-52
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 4e-09
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 3e-60
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 2e-52
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 5e-09
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 4e-60
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 2e-53
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 9e-11
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 4e-60
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 2e-52
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 4e-09
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 4e-60
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 2e-52
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 1e-09
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 5e-60
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 7e-53
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 2e-10
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 5e-60
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 8e-52
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 4e-09
1up5_B148 Chicken Calmodulin Length = 148 5e-60
1up5_B148 Chicken Calmodulin Length = 148 8e-52
1up5_B148 Chicken Calmodulin Length = 148 4e-09
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 8e-60
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 1e-52
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 9e-60
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 6e-54
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 4e-11
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 2e-59
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 2e-50
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 2e-09
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 3e-59
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 2e-52
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 4e-59
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 3e-52
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 4e-59
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 2e-52
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-58
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 4e-51
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-58
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 5e-51
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 3e-58
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 1e-50
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 8e-58
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 4e-50
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 4e-09
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 4e-57
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-50
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 9e-57
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 1e-50
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 3e-09
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 1e-56
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 1e-49
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 2e-55
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 5e-47
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 2e-55
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 5e-47
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 6e-55
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 2e-47
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 1e-54
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 4e-47
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 3e-53
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 5e-48
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 1e-52
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 2e-45
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 1e-47
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 1e-43
2lmt_A148 Nmr Structure Of Androcam Length = 148 6e-41
2lmt_A148 Nmr Structure Of Androcam Length = 148 1e-36
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 2e-35
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 2e-35
4ds7_A147 Crystal Structure Of Yeast Calmodulin Bound To The 7e-35
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 2e-31
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 8e-31
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 3e-31
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 1e-23
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 2e-09
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 6e-31
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 3e-30
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 2e-30
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 2e-08
2hf5_A68 The Structure And Function Of A Novel Two-Site Calc 3e-30
2hf5_A68 The Structure And Function Of A Novel Two-Site Calc 4e-27
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 4e-30
2kz2_A94 Calmodulin, C-Terminal Domain, F92e Mutant Length = 7e-30
2kz2_A94 Calmodulin, C-Terminal Domain, F92e Mutant Length = 4e-29
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 1e-29
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 6e-29
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 8e-29
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 2e-28
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 1e-28
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 2e-28
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 1e-28
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 3e-28
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 3e-28
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 2e-27
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 9e-24
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 6e-08
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 2e-27
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 1e-23
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 6e-08
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 2e-27
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 1e-26
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 4e-27
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 2e-23
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 6e-08
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 4e-27
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 1e-24
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 7e-08
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 4e-27
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 2e-23
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 6e-08
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 6e-27
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 1e-20
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 8e-05
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 8e-27
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 3e-24
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 6e-08
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 9e-27
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 1e-20
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 8e-05
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 1e-26
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 2e-20
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 9e-05
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 2e-26
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 8e-23
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 6e-08
2ro9_A69 Solution Structure Of Calcium Bound Soybean Calmodu 2e-26
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 2e-26
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 3e-20
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 8e-05
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 2e-26
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 4e-20
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 8e-05
2obh_A143 Centrin-Xpc Peptide Length = 143 3e-26
2kxw_A73 Structure Of The C-Domain Fragment Of Apo Calmoduli 3e-26
2kxw_A73 Structure Of The C-Domain Fragment Of Apo Calmoduli 1e-25
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 4e-26
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 3e-20
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 4e-05
2jtz_A161 Solution Structure And Chemical Shift Assignments O 7e-26
2jtz_A161 Solution Structure And Chemical Shift Assignments O 2e-19
2jtz_A161 Solution Structure And Chemical Shift Assignments O 9e-05
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 2e-25
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 4e-18
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 2e-09
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 7e-25
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 1e-17
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 2e-09
2kn2_A92 Solution Structure Of The C-Terminal Domain Of Soyb 7e-25
2kn2_A92 Solution Structure Of The C-Terminal Domain Of Soyb 1e-24
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 3e-24
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 2e-17
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 5e-10
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 9e-24
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 2e-16
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 5e-09
2rob_A70 Solution Structure Of Calcium Bound Soybean Calmodu 1e-23
2rob_A70 Solution Structure Of Calcium Bound Soybean Calmodu 2e-23
3j04_B143 Em Structure Of The Heavy Meromyosin Subfragment Of 2e-23
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 2e-23
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 1e-16
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 4e-09
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 3e-23
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 7e-16
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 5e-09
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 4e-23
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 8e-16
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 6e-09
2bl0_C142 Physarum Polycephalum Myosin Ii Regulatory Domain L 1e-22
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 1e-22
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 3e-15
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 7e-09
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 1e-22
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 3e-15
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 7e-09
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 7e-22
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 1e-14
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 1e-08
2bl0_B145 Physarum Polycephalum Myosin Ii Regulatory Domain L 8e-22
1br1_B150 Smooth Muscle Myosin Motor Domain-Essential Light C 1e-20
1br1_B150 Smooth Muscle Myosin Motor Domain-Essential Light C 4e-19
3j04_C148 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-20
3j04_C148 Em Structure Of The Heavy Meromyosin Subfragment Of 4e-19
3fwb_A161 Sac3:sus1:cdc31 Complex Length = 161 4e-20
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 9e-20
1oe9_B151 Crystal Structure Of Myosin V Motor With Essential 1e-19
1oe9_B151 Crystal Structure Of Myosin V Motor With Essential 2e-19
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 3e-19
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 3e-19
3ox6_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 5e-19
3dtp_E196 Tarantula Heavy Meromyosin Obtained By Flexible Doc 6e-18
2gv5_A161 Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 1e-17
2jnf_A158 Solution Structure Of Fly Troponin C, Isoform F1 Le 2e-17
2jnf_A158 Solution Structure Of Fly Troponin C, Isoform F1 Le 2e-15
3i5g_B153 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 3e-17
1m8q_C147 Molecular Models Of Averaged Rigor Crossbridges Fro 3e-17
1m8q_C147 Molecular Models Of Averaged Rigor Crossbridges Fro 4e-17
2mys_C149 Myosin Subfragment-1, Alpha Carbon Coordinates Only 3e-17
2mys_C149 Myosin Subfragment-1, Alpha Carbon Coordinates Only 5e-17
2w4a_C145 Isometrically Contracting Insect Asynchronous Fligh 7e-17
2w4a_C145 Isometrically Contracting Insect Asynchronous Fligh 5e-16
2roa_A79 Solution Structure Of Calcium Bound Soybean Calmodu 7e-17
2roa_A79 Solution Structure Of Calcium Bound Soybean Calmodu 2e-13
2roa_A79 Solution Structure Of Calcium Bound Soybean Calmodu 8e-08
1m8q_B145 Molecular Models Of Averaged Rigor Crossbridges Fro 7e-16
1ggw_A140 Cdc4p From Schizosaccharomyces Pombe Length = 140 8e-16
1ggw_A140 Cdc4p From Schizosaccharomyces Pombe Length = 140 4e-14
2mys_B166 Myosin Subfragment-1, Alpha Carbon Coordinates Only 8e-16
1m46_A148 Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A 9e-16
1m46_A148 Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A 1e-13
1s6i_A188 Ca2+-Regulatory Region (Cld) From Soybean Calcium-D 1e-15
1m39_A89 Solution Structure Of The C-Terminal Fragment (F86- 1e-15
2ksz_A76 The Solution Structure Of The Magnesium Bound Soybe 3e-15
2ksz_A76 The Solution Structure Of The Magnesium Bound Soybe 1e-11
2ksz_A76 The Solution Structure Of The Magnesium Bound Soybe 9e-08
2w4a_B150 Isometrically Contracting Insect Asynchronous Fligh 4e-15
2ctn_A89 Structure Of Calcium-Saturated Cardiac Troponin C, 2e-14
2ctn_A89 Structure Of Calcium-Saturated Cardiac Troponin C, 2e-08
2ctn_A89 Structure Of Calcium-Saturated Cardiac Troponin C, 7e-05
2kfx_T89 Structure Of The N-Terminal Domain Of Human Cardiac 2e-14
2kfx_T89 Structure Of The N-Terminal Domain Of Human Cardiac 3e-08
2kfx_T89 Structure Of The N-Terminal Domain Of Human Cardiac 7e-05
1wrk_A88 Crystal Structure Of The N-Terminal Domain Of Human 2e-14
1wrk_A88 Crystal Structure Of The N-Terminal Domain Of Human 3e-08
1wrk_A88 Crystal Structure Of The N-Terminal Domain Of Human 7e-05
2jxl_A89 Solution Structure Of Cardiac N-Domain Troponin C M 3e-14
2jxl_A89 Solution Structure Of Cardiac N-Domain Troponin C M 2e-08
2jxl_A89 Solution Structure Of Cardiac N-Domain Troponin C M 8e-05
3jtd_C156 Calcium-Free Scallop Myosin Regulatory Domain With 3e-14
3jtd_C156 Calcium-Free Scallop Myosin Regulatory Domain With 3e-13
4gjf_A89 Crystal Structure Of The Amino-terminal Domain Of H 4e-14
4gjf_A89 Crystal Structure Of The Amino-terminal Domain Of H 9e-09
4gjf_A89 Crystal Structure Of The Amino-terminal Domain Of H 1e-05
4gjg_A89 Crystal Structure Of The Amino-terminal Domain Of H 4e-14
4gjg_A89 Crystal Structure Of The Amino-terminal Domain Of H 1e-09
4gjg_A89 Crystal Structure Of The Amino-terminal Domain Of H 2e-06
1mxl_C89 Structure Of Cardiac Troponin C-troponin I Complex 4e-14
1mxl_C89 Structure Of Cardiac Troponin C-troponin I Complex 3e-08
1mxl_C89 Structure Of Cardiac Troponin C-troponin I Complex 3e-05
1wdc_C156 Scallop Myosin Regulatory Domain Length = 156 5e-14
1r2u_A89 Nmr Structure Of The N Domain Of Trout Cardiac Trop 5e-14
1r2u_A89 Nmr Structure Of The N Domain Of Trout Cardiac Trop 1e-09
1r2u_A89 Nmr Structure Of The N Domain Of Trout Cardiac Trop 2e-06
1dfk_Z152 Nucleotide-Free Scallop Myosin S1-Near Rigor State 5e-14
1dfk_Z152 Nucleotide-Free Scallop Myosin S1-Near Rigor State 5e-14
1kk8_C154 Scallop Myosin (S1-Adp-Befx) In The Actin-Detached 5e-14
2w4t_Z151 Isometrically Contracting Insect Asynchronous Fligh 6e-14
2w4t_Z151 Isometrically Contracting Insect Asynchronous Fligh 6e-14
2os8_C157 Rigor-Like Structures Of Muscle Myosins Reveal Key 6e-14
1scm_C149 Structure Of The Regulatory Domain Of Scallop Myosi 6e-14
1scm_C149 Structure Of The Regulatory Domain Of Scallop Myosi 7e-14
3pn7_C156 Visualizing New Hinges And A Potential Major Source 6e-14
2ec6_C156 Placopecten Striated Muscle Myosin Ii Length = 156 8e-14
2kgb_C89 Nmr Solution Of The Regulatory Domain Cardiac F77w- 1e-13
2kgb_C89 Nmr Solution Of The Regulatory Domain Cardiac F77w- 6e-08
2kgb_C89 Nmr Solution Of The Regulatory Domain Cardiac F77w- 3e-05
1npq_A90 Structure Of A Rhodamine-Labeled N-Domain Troponin 1e-13
1npq_A90 Structure Of A Rhodamine-Labeled N-Domain Troponin 3e-10
1npq_A90 Structure Of A Rhodamine-Labeled N-Domain Troponin 5e-07
2b1u_A71 Solution Structure Of Calmodulin-Like Skin Protein 1e-13
2b1u_A71 Solution Structure Of Calmodulin-Like Skin Protein 2e-13
1avs_A90 X-Ray Crystallographic Study Of Calcium-Saturated N 3e-13
1avs_A90 X-Ray Crystallographic Study Of Calcium-Saturated N 4e-11
1avs_A90 X-Ray Crystallographic Study Of Calcium-Saturated N 3e-08
2aao_A166 Regulatory Apparatus Of Calcium Dependent Protein K 3e-13
2aao_A166 Regulatory Apparatus Of Calcium Dependent Protein K 2e-04
2ec6_B133 Placopecten Striated Muscle Myosin Ii Length = 133 3e-13
1dfk_Y139 Nucleotide-Free Scallop Myosin S1-Near Rigor State 3e-13
1kk8_B139 Scallop Myosin (S1-Adp-Befx) In The Actin-Detached 3e-13
2w4t_Y136 Isometrically Contracting Insect Asynchronous Fligh 4e-13
1trf_A76 Solution Structure Of The Tr1c Fragment Of Skeletal 4e-13
1trf_A76 Solution Structure Of The Tr1c Fragment Of Skeletal 6e-11
1trf_A76 Solution Structure Of The Tr1c Fragment Of Skeletal 4e-08
1scm_B145 Structure Of The Regulatory Domain Of Scallop Myosi 4e-13
1wdc_B156 Scallop Myosin Regulatory Domain Length = 156 4e-13
1smg_A90 Calcium-Bound E41a Mutant Of The N-Domain Of Chicke 1e-12
1smg_A90 Calcium-Bound E41a Mutant Of The N-Domain Of Chicke 2e-10
1smg_A90 Calcium-Bound E41a Mutant Of The N-Domain Of Chicke 1e-07
3k21_A191 Crystal Structure Of Carboxy-Terminus Of Pfc0420w L 1e-12
2a4j_A79 Solution Structure Of The C-Terminal Domain (T94-Y1 2e-12
2os8_B157 Rigor-Like Structures Of Muscle Myosins Reveal Key 2e-12
3tuy_B161 Phosphorylated Light Chain Domain Of Scallop Smooth 3e-12
3pn7_B161 Visualizing New Hinges And A Potential Major Source 3e-12
2ami_A96 Solution Structure Of The Calcium-Loaded N-Terminal 4e-12
2ami_A96 Solution Structure Of The Calcium-Loaded N-Terminal 1e-08
2lv7_A100 Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D 6e-12
2lv7_A100 Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D 1e-11
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 9e-12
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 1e-08
3o4y_A196 Crystal Structure Of Cad Domain Of The Plasmodium V 1e-11
3pm8_A197 Cad Domain Of Pff0520w, Calcium Dependent Protein K 2e-11
2k2a_A70 Solution Structure Of The Apo C Terminal Domain Of 3e-11
2k2a_A70 Solution Structure Of The Apo C Terminal Domain Of 2e-10
3l19_A214 Crystal Structure Of Calcium Binding Domain Of Cpcd 4e-11
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 5e-11
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 5e-11
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 5e-11
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 5e-11
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 6e-11
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 6e-11
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 8e-11
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 6e-11
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 8e-11
3i5g_C159 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 1e-10
3rv5_A89 Crystal Structure Of Human Cardiac Troponin C Regul 1e-10
3rv5_A89 Crystal Structure Of Human Cardiac Troponin C Regul 1e-04
2fce_A70 Solution Structure Of C-Lobe Myosin Light Chain Fro 2e-10
1c7v_A81 Nmr Solution Structure Of The Calcium-Bound C-Termi 2e-10
1c7v_A81 Nmr Solution Structure Of The Calcium-Bound C-Termi 7e-08
3tz1_A74 Crystal Structure Of The Ca2+-saturated C-terminal 4e-10
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-10
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 7e-10
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 7e-10
1oqp_A77 Structure Of The Ca2+C-Terminal Domain Of Caltracti 8e-10
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 1e-09
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-09
2k7c_A72 Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 2e-09
2k7c_A72 Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 4e-08
3khe_A191 Crystal Structure Of The Calcium-Loaded Calmodulin- 2e-09
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 5e-09
1zmz_A98 Solution Structure Of The N-Terminal Domain (M1-S98 6e-09
1zmz_A98 Solution Structure Of The N-Terminal Domain (M1-S98 2e-07
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-08
1jc2_A76 Complex Of The C-Domain Of Troponin C With Residues 3e-08
1jc2_A76 Complex Of The C-Domain Of Troponin C With Residues 7e-07
1fi5_A81 Nmr Structure Of The C Terminal Domain Of Cardiac T 5e-08
1fi5_A81 Nmr Structure Of The C Terminal Domain Of Cardiac T 6e-08
2be4_A272 X-ray Structure An Ef-hand Protein From Danio Rerio 6e-08
2zn9_A172 Crystal Structure Of Ca2+-bound Form Of Des3-20alg- 1e-07
2zrs_A168 Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- 2e-07
2zne_A169 Crystal Structure Of Zn2+-Bound Form Of Des3-23alg- 2e-07
1ozs_A73 C-Domain Of Human Cardiac Troponin C In Complex Wit 2e-07
1ozs_A73 C-Domain Of Human Cardiac Troponin C In Complex Wit 2e-07
2zn8_A190 Crystal Structure Of Zn2+-Bound Form Of Alg-2 Lengt 2e-07
1ih0_A71 Structure Of The C-Domain Of Human Cardiac Troponin 2e-07
1ih0_A71 Structure Of The C-Domain Of Human Cardiac Troponin 2e-07
2kdh_A72 The Solution Structure Of Human Cardiac Troponin C 2e-07
2kdh_A72 The Solution Structure Of Human Cardiac Troponin C 2e-07
1hqv_A191 Structure Of Apoptosis-Linked Protein Alg-2 Length 3e-07
3aak_A172 Crystal Structure Of Zn2+-Bound Form Of Des3-20alg- 3e-07
3ctn_A76 Structure Of Calcium-Saturated Cardiac Troponin C, 5e-07
3ctn_A76 Structure Of Calcium-Saturated Cardiac Troponin C, 5e-07
1bjf_A193 Crystal Structure Of Recombinant Bovine Neurocalcin 6e-07
1y1x_A191 Structural Analysis Of A Homolog Of Programmed Cell 6e-07
2bec_A202 Crystal Structure Of Chp2 In Complex With Its Bindi 1e-06
2g9b_A263 Nmr Solution Structure Of Ca2+-Loaded Calbindin D28 1e-06
2g9b_A263 Nmr Solution Structure Of Ca2+-Loaded Calbindin D28 8e-04
3e3r_A204 Crystal Structure And Biochemical Characterization 2e-06
2k7b_A76 Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 3e-06
2k7b_A76 Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 4e-05
2lc5_A85 Calmodulin-Like Protein From Entamoeba Histolytica: 4e-06
2lc5_A85 Calmodulin-Like Protein From Entamoeba Histolytica: 6e-06
1qx2_A76 X-Ray Structure Of Calcium-Loaded Calbindomodulin ( 4e-06
1qx2_A76 X-Ray Structure Of Calcium-Loaded Calbindomodulin ( 2e-05
3aaj_A167 Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- 6e-06
2joj_A77 Nmr Solution Structure Of N-Terminal Domain Of Eupl 6e-06
2jnx_A134 Nmr Derived Solution Structure Of An Ef-Hand Calciu 7e-06
1h4b_A84 Solution Structure Of The Birch Pollen Allergen Bet 9e-06
5pal_A109 Crystal Structure Of The Unique Parvalbumin Compone 2e-05
5pal_A109 Crystal Structure Of The Unique Parvalbumin Compone 3e-05
3pat_A110 Comparison Between The Crystal And The Solution Str 2e-05
2auc_A126 Structure Of The Plasmodium Mtip-Myoa Complex, A Ke 2e-05
1k9u_A78 Crystal Structure Of The Calcium-Binding Pollen All 8e-05
1sjj_A863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 9e-05
1s6j_A87 N-Terminal Region Of The Ca2+-Saturated Calcium Reg 9e-05
2lvi_A77 Solution Structure Of Apo-phl P 7 Length = 77 9e-05
2opo_A86 Crystal Structure Of The Calcium-Binding Pollen All 9e-05
1b8r_A108 Parvalbumin Length = 108 1e-04
1fpw_A190 Structure Of Yeast Frequenin Length = 190 1e-04
1cdp_A109 Restrained Least Squares Refinement Of Native (Calc 1e-04
1jba_A204 Unmyristoylated Gcap-2 With Three Calcium Ions Boun 3e-04
3f45_A109 Structure Of The R75a Mutant Of Rat Alpha-Parvalbum 4e-04
1s3p_A109 Crystal Structure Of Rat Alpha-parvalbumin S55d/e59 4e-04
1rtp_1109 Refined X-ray Structure Of Rat Parvalbumin, A Mamma 4e-04
2qac_A146 The Closed Mtip-myosina-tail Complex From The Malar 5e-04
2qac_A146 The Closed Mtip-myosina-tail Complex From The Malar 5e-04
1bu3_A109 Refined Crystal Structure Of Calcium-Bound Silver H 6e-04
3fs7_A109 Crystal Structure Of Gallus Gallus Beta-Parvalbumin 6e-04
2kqy_A108 Solution Structure Of Avian Thymic Hormone Length = 7e-04
2kyc_A108 Solution Structure Of Ca-Free Chicken Parvalbumin 3 7e-04
1b9a_A108 Parvalbumin (Mutation;d51a, F102w) Length = 108 7e-04
1b8c_A108 Parvalbumin Length = 108 8e-04
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure

Iteration: 1

Score = 233 bits (595), Expect = 6e-62, Method: Compositional matrix adjust. Identities = 124/151 (82%), Positives = 125/151 (82%), Gaps = 24/151 (15%) Query: 10 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD GNGTIDF Sbjct: 22 DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 65 Query: 70 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI Sbjct: 66 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 125 Query: 130 READIDGDGQVNYEGNGTIDFPEFLTMMARK 160 READIDGDGQVNYE EF+TMM K Sbjct: 126 READIDGDGQVNYE--------EFVTMMTSK 148
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|2HF5|A Chain A, The Structure And Function Of A Novel Two-Site Calcium- Binding Fragment Of Calmodulin Length = 68 Back     alignment and structure
>pdb|2HF5|A Chain A, The Structure And Function Of A Novel Two-Site Calcium- Binding Fragment Of Calmodulin Length = 68 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 Back     alignment and structure
>pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 Back     alignment and structure
>pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 Back     alignment and structure
>pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 Back     alignment and structure
>pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 Back     alignment and structure
>pdb|3J04|B Chain B, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 143 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|2BL0|C Chain C, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 142 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 Back     alignment and structure
>pdb|1BR1|B Chain B, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 150 Back     alignment and structure
>pdb|1BR1|B Chain B, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 150 Back     alignment and structure
>pdb|3J04|C Chain C, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 148 Back     alignment and structure
>pdb|3J04|C Chain C, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 148 Back     alignment and structure
>pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|1OE9|B Chain B, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 151 Back     alignment and structure
>pdb|1OE9|B Chain B, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 151 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3DTP|E Chain E, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 196 Back     alignment and structure
>pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 Back     alignment and structure
>pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 Back     alignment and structure
>pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 Back     alignment and structure
>pdb|3I5G|B Chain B, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 153 Back     alignment and structure
>pdb|1M8Q|C Chain C, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 147 Back     alignment and structure
>pdb|1M8Q|C Chain C, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 147 Back     alignment and structure
>pdb|2MYS|C Chain C, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 149 Back     alignment and structure
>pdb|2MYS|C Chain C, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 149 Back     alignment and structure
>pdb|2W4A|C Chain C, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 145 Back     alignment and structure
>pdb|2W4A|C Chain C, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 145 Back     alignment and structure
>pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|1M8Q|B Chain B, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 145 Back     alignment and structure
>pdb|1GGW|A Chain A, Cdc4p From Schizosaccharomyces Pombe Length = 140 Back     alignment and structure
>pdb|1GGW|A Chain A, Cdc4p From Schizosaccharomyces Pombe Length = 140 Back     alignment and structure
>pdb|2MYS|B Chain B, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 166 Back     alignment and structure
>pdb|1M46|A Chain A, Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A Class V Myosin Length = 148 Back     alignment and structure
>pdb|1M46|A Chain A, Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A Class V Myosin Length = 148 Back     alignment and structure
>pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 Back     alignment and structure
>pdb|1M39|A Chain A, Solution Structure Of The C-Terminal Fragment (F86-I165) Of The Human Centrin 2 In Calcium Saturated Form Length = 89 Back     alignment and structure
>pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 Back     alignment and structure
>pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 Back     alignment and structure
>pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 Back     alignment and structure
>pdb|2W4A|B Chain B, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 150 Back     alignment and structure
>pdb|2CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 89 Back     alignment and structure
>pdb|2CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 89 Back     alignment and structure
>pdb|2CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 89 Back     alignment and structure
>pdb|2KFX|T Chain T, Structure Of The N-Terminal Domain Of Human Cardiac Troponin C Bound To Calcium Ion And To The Inhibitor W7 Length = 89 Back     alignment and structure
>pdb|2KFX|T Chain T, Structure Of The N-Terminal Domain Of Human Cardiac Troponin C Bound To Calcium Ion And To The Inhibitor W7 Length = 89 Back     alignment and structure
>pdb|2KFX|T Chain T, Structure Of The N-Terminal Domain Of Human Cardiac Troponin C Bound To Calcium Ion And To The Inhibitor W7 Length = 89 Back     alignment and structure
>pdb|1WRK|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Cardiac Troponin C In Complex With Trifluoperazine (Orthrombic Crystal Form) Length = 88 Back     alignment and structure
>pdb|1WRK|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Cardiac Troponin C In Complex With Trifluoperazine (Orthrombic Crystal Form) Length = 88 Back     alignment and structure
>pdb|1WRK|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Cardiac Troponin C In Complex With Trifluoperazine (Orthrombic Crystal Form) Length = 88 Back     alignment and structure
>pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 Back     alignment and structure
>pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 Back     alignment and structure
>pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 Back     alignment and structure
>pdb|3JTD|C Chain C, Calcium-Free Scallop Myosin Regulatory Domain With Elc-D19a Point Mutation Length = 156 Back     alignment and structure
>pdb|3JTD|C Chain C, Calcium-Free Scallop Myosin Regulatory Domain With Elc-D19a Point Mutation Length = 156 Back     alignment and structure
>pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 Back     alignment and structure
>pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 Back     alignment and structure
>pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 Back     alignment and structure
>pdb|1WDC|C Chain C, Scallop Myosin Regulatory Domain Length = 156 Back     alignment and structure
>pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 Back     alignment and structure
>pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 Back     alignment and structure
>pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 Back     alignment and structure
>pdb|1DFK|Z Chain Z, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 152 Back     alignment and structure
>pdb|1DFK|Z Chain Z, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 152 Back     alignment and structure
>pdb|1KK8|C Chain C, Scallop Myosin (S1-Adp-Befx) In The Actin-Detached Conformation Length = 154 Back     alignment and structure
>pdb|2W4T|Z Chain Z, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 151 Back     alignment and structure
>pdb|2W4T|Z Chain Z, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 151 Back     alignment and structure
>pdb|2OS8|C Chain C, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 157 Back     alignment and structure
>pdb|1SCM|C Chain C, Structure Of The Regulatory Domain Of Scallop Myosin At 2.8 Angstroms Resolution Length = 149 Back     alignment and structure
>pdb|1SCM|C Chain C, Structure Of The Regulatory Domain Of Scallop Myosin At 2.8 Angstroms Resolution Length = 149 Back     alignment and structure
>pdb|3PN7|C Chain C, Visualizing New Hinges And A Potential Major Source Of Compliance In The Lever Arm Of Myosin Length = 156 Back     alignment and structure
>pdb|2EC6|C Chain C, Placopecten Striated Muscle Myosin Ii Length = 156 Back     alignment and structure
>pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 Back     alignment and structure
>pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 Back     alignment and structure
>pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 Back     alignment and structure
>pdb|1NPQ|A Chain A, Structure Of A Rhodamine-Labeled N-Domain Troponin C Mutant (Ca2+ Saturated) In Complex With Skeletal Troponin I 115- 131 Length = 90 Back     alignment and structure
>pdb|1NPQ|A Chain A, Structure Of A Rhodamine-Labeled N-Domain Troponin C Mutant (Ca2+ Saturated) In Complex With Skeletal Troponin I 115- 131 Length = 90 Back     alignment and structure
>pdb|1NPQ|A Chain A, Structure Of A Rhodamine-Labeled N-Domain Troponin C Mutant (Ca2+ Saturated) In Complex With Skeletal Troponin I 115- 131 Length = 90 Back     alignment and structure
>pdb|2B1U|A Chain A, Solution Structure Of Calmodulin-Like Skin Protein C Terminal Domain Length = 71 Back     alignment and structure
>pdb|2B1U|A Chain A, Solution Structure Of Calmodulin-Like Skin Protein C Terminal Domain Length = 71 Back     alignment and structure
>pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 Back     alignment and structure
>pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 Back     alignment and structure
>pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 Back     alignment and structure
>pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 Back     alignment and structure
>pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 Back     alignment and structure
>pdb|2EC6|B Chain B, Placopecten Striated Muscle Myosin Ii Length = 133 Back     alignment and structure
>pdb|1DFK|Y Chain Y, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 139 Back     alignment and structure
>pdb|1KK8|B Chain B, Scallop Myosin (S1-Adp-Befx) In The Actin-Detached Conformation Length = 139 Back     alignment and structure
>pdb|2W4T|Y Chain Y, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 136 Back     alignment and structure
>pdb|1TRF|A Chain A, Solution Structure Of The Tr1c Fragment Of Skeletal Muscle Troponin-C Length = 76 Back     alignment and structure
>pdb|1TRF|A Chain A, Solution Structure Of The Tr1c Fragment Of Skeletal Muscle Troponin-C Length = 76 Back     alignment and structure
>pdb|1TRF|A Chain A, Solution Structure Of The Tr1c Fragment Of Skeletal Muscle Troponin-C Length = 76 Back     alignment and structure
>pdb|1SCM|B Chain B, Structure Of The Regulatory Domain Of Scallop Myosin At 2.8 Angstroms Resolution Length = 145 Back     alignment and structure
>pdb|1WDC|B Chain B, Scallop Myosin Regulatory Domain Length = 156 Back     alignment and structure
>pdb|1SMG|A Chain A, Calcium-Bound E41a Mutant Of The N-Domain Of Chicken Troponin C, Nmr, 40 Structures Length = 90 Back     alignment and structure
>pdb|1SMG|A Chain A, Calcium-Bound E41a Mutant Of The N-Domain Of Chicken Troponin C, Nmr, 40 Structures Length = 90 Back     alignment and structure
>pdb|1SMG|A Chain A, Calcium-Bound E41a Mutant Of The N-Domain Of Chicken Troponin C, Nmr, 40 Structures Length = 90 Back     alignment and structure
>pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 Back     alignment and structure
>pdb|2A4J|A Chain A, Solution Structure Of The C-Terminal Domain (T94-Y172) Of The Human Centrin 2 In Complex With A 17 Residues Peptide (P1-Xpc) From Xeroderma Pigmentosum Group C Protein Length = 79 Back     alignment and structure
>pdb|2OS8|B Chain B, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 157 Back     alignment and structure
>pdb|3TUY|B Chain B, Phosphorylated Light Chain Domain Of Scallop Smooth Muscle Myosin Length = 161 Back     alignment and structure
>pdb|3PN7|B Chain B, Visualizing New Hinges And A Potential Major Source Of Compliance In The Lever Arm Of Myosin Length = 161 Back     alignment and structure
>pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 Back     alignment and structure
>pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 Back     alignment and structure
>pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 Back     alignment and structure
>pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 Back     alignment and structure
>pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 Back     alignment and structure
>pdb|2K2A|A Chain A, Solution Structure Of The Apo C Terminal Domain Of Lethoceru C Isoform F1 Length = 70 Back     alignment and structure
>pdb|2K2A|A Chain A, Solution Structure Of The Apo C Terminal Domain Of Lethoceru C Isoform F1 Length = 70 Back     alignment and structure
>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|3I5G|C Chain C, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 159 Back     alignment and structure
>pdb|3RV5|A Chain A, Crystal Structure Of Human Cardiac Troponin C Regulatory Domain In Complex With Cadmium And Deoxycholic Acid Length = 89 Back     alignment and structure
>pdb|3RV5|A Chain A, Crystal Structure Of Human Cardiac Troponin C Regulatory Domain In Complex With Cadmium And Deoxycholic Acid Length = 89 Back     alignment and structure
>pdb|2FCE|A Chain A, Solution Structure Of C-Lobe Myosin Light Chain From Saccharomices Cerevisiae Length = 70 Back     alignment and structure
>pdb|1C7V|A Chain A, Nmr Solution Structure Of The Calcium-Bound C-Terminal Domain (W81-S161) Of Calcium Vector Protein From Amphioxus Length = 81 Back     alignment and structure
>pdb|1C7V|A Chain A, Nmr Solution Structure Of The Calcium-Bound C-Terminal Domain (W81-S161) Of Calcium Vector Protein From Amphioxus Length = 81 Back     alignment and structure
>pdb|3TZ1|A Chain A, Crystal Structure Of The Ca2+-saturated C-terminal Domain Of Akazara Scallop Troponin C In Complex With A Troponin I Fragment Length = 74 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|1OQP|A Chain A, Structure Of The Ca2+C-Terminal Domain Of Caltractin In Complex With The Cdc31p-Binding Domain From Kar1p Length = 77 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2K7C|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 72 Back     alignment and structure
>pdb|2K7C|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 72 Back     alignment and structure
>pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 Back     alignment and structure
>pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|1JC2|A Chain A, Complex Of The C-Domain Of Troponin C With Residues 1-40 Of Troponin I Length = 76 Back     alignment and structure
>pdb|1JC2|A Chain A, Complex Of The C-Domain Of Troponin C With Residues 1-40 Of Troponin I Length = 76 Back     alignment and structure
>pdb|1FI5|A Chain A, Nmr Structure Of The C Terminal Domain Of Cardiac Troponin C Bound To The N Terminal Domain Of Cardiac Troponin I. Length = 81 Back     alignment and structure
>pdb|1FI5|A Chain A, Nmr Structure Of The C Terminal Domain Of Cardiac Troponin C Bound To The N Terminal Domain Of Cardiac Troponin I. Length = 81 Back     alignment and structure
>pdb|2BE4|A Chain A, X-ray Structure An Ef-hand Protein From Danio Rerio Dr.36843 Length = 272 Back     alignment and structure
>pdb|2ZN9|A Chain A, Crystal Structure Of Ca2+-bound Form Of Des3-20alg-2 Length = 172 Back     alignment and structure
>pdb|2ZRS|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2 Length = 168 Back     alignment and structure
>pdb|2ZNE|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-23alg-2 Complexed With Alix Abs Peptide Length = 169 Back     alignment and structure
>pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 Back     alignment and structure
>pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 Back     alignment and structure
>pdb|2ZN8|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Alg-2 Length = 190 Back     alignment and structure
>pdb|1IH0|A Chain A, Structure Of The C-Domain Of Human Cardiac Troponin C In Complex With Ca2+ Sensitizer Emd 57033 Length = 71 Back     alignment and structure
>pdb|1IH0|A Chain A, Structure Of The C-Domain Of Human Cardiac Troponin C In Complex With Ca2+ Sensitizer Emd 57033 Length = 71 Back     alignment and structure
>pdb|2KDH|A Chain A, The Solution Structure Of Human Cardiac Troponin C In Complex With The Green Tea Polyphenol; (-)- Epigallocatechin-3-Gallate Length = 72 Back     alignment and structure
>pdb|2KDH|A Chain A, The Solution Structure Of Human Cardiac Troponin C In Complex With The Green Tea Polyphenol; (-)- Epigallocatechin-3-Gallate Length = 72 Back     alignment and structure
>pdb|1HQV|A Chain A, Structure Of Apoptosis-Linked Protein Alg-2 Length = 191 Back     alignment and structure
>pdb|3AAK|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-20alg-2f122a Length = 172 Back     alignment and structure
>pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 Back     alignment and structure
>pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 Back     alignment and structure
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure
>pdb|1Y1X|A Chain A, Structural Analysis Of A Homolog Of Programmed Cell Death 6 Protein From Leishmania Major Friedlin Length = 191 Back     alignment and structure
>pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 Back     alignment and structure
>pdb|2G9B|A Chain A, Nmr Solution Structure Of Ca2+-Loaded Calbindin D28k Length = 263 Back     alignment and structure
>pdb|2G9B|A Chain A, Nmr Solution Structure Of Ca2+-Loaded Calbindin D28k Length = 263 Back     alignment and structure
>pdb|3E3R|A Chain A, Crystal Structure And Biochemical Characterization Of Recombinant Human Calcyphosine Delineates A Novel Ef-hand-containing Protein Family Length = 204 Back     alignment and structure
>pdb|2K7B|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 76 Back     alignment and structure
>pdb|2K7B|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 76 Back     alignment and structure
>pdb|2LC5|A Chain A, Calmodulin-Like Protein From Entamoeba Histolytica: Solution Structure And Calcium-Binding Properties Of A Partially Folded Protein Length = 85 Back     alignment and structure
>pdb|2LC5|A Chain A, Calmodulin-Like Protein From Entamoeba Histolytica: Solution Structure And Calcium-Binding Properties Of A Partially Folded Protein Length = 85 Back     alignment and structure
>pdb|1QX2|A Chain A, X-Ray Structure Of Calcium-Loaded Calbindomodulin (A Calbindin D9k Re- Engineered To Undergo A Conformational Opening) At 1.44 A Resolution Length = 76 Back     alignment and structure
>pdb|1QX2|A Chain A, X-Ray Structure Of Calcium-Loaded Calbindomodulin (A Calbindin D9k Re- Engineered To Undergo A Conformational Opening) At 1.44 A Resolution Length = 76 Back     alignment and structure
>pdb|3AAJ|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2deltagf122 Length = 167 Back     alignment and structure
>pdb|2JOJ|A Chain A, Nmr Solution Structure Of N-Terminal Domain Of Euplotes Octocarinatus Centrin Length = 77 Back     alignment and structure
>pdb|2JNX|A Chain A, Nmr Derived Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 Back     alignment and structure
>pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet V 4 Length = 84 Back     alignment and structure
>pdb|5PAL|A Chain A, Crystal Structure Of The Unique Parvalbumin Component From Muscle Of The Leopard Shark (Triakis Semifasciata). The First X-Ray Study Of An Alpha-Parvalbumin Length = 109 Back     alignment and structure
>pdb|5PAL|A Chain A, Crystal Structure Of The Unique Parvalbumin Component From Muscle Of The Leopard Shark (Triakis Semifasciata). The First X-Ray Study Of An Alpha-Parvalbumin Length = 109 Back     alignment and structure
>pdb|3PAT|A Chain A, Comparison Between The Crystal And The Solution Structures Of The Ef Hand Parvalbumin Length = 110 Back     alignment and structure
>pdb|2AUC|A Chain A, Structure Of The Plasmodium Mtip-Myoa Complex, A Key Component Of The Parasite Invasion Motor Length = 126 Back     alignment and structure
>pdb|1K9U|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Phl P 7 (Polcalcin) At 1.75 Angstroem Length = 78 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|1S6J|A Chain A, N-Terminal Region Of The Ca2+-Saturated Calcium Regulatory Domain (Cld) From Soybean Calcium-Dependent Protein Kinase- Alpha (Cdpk) Length = 87 Back     alignment and structure
>pdb|2LVI|A Chain A, Solution Structure Of Apo-phl P 7 Length = 77 Back     alignment and structure
>pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Che A 3 Length = 86 Back     alignment and structure
>pdb|1B8R|A Chain A, Parvalbumin Length = 108 Back     alignment and structure
>pdb|1FPW|A Chain A, Structure Of Yeast Frequenin Length = 190 Back     alignment and structure
>pdb|1CDP|A Chain A, Restrained Least Squares Refinement Of Native (Calcium) And Cadmium-Substituted Carp Parvalbumin Using X-Ray Crystallographic Data At 1.6-Angstroms Resolution Length = 109 Back     alignment and structure
>pdb|1JBA|A Chain A, Unmyristoylated Gcap-2 With Three Calcium Ions Bound Length = 204 Back     alignment and structure
>pdb|3F45|A Chain A, Structure Of The R75a Mutant Of Rat Alpha-Parvalbumin Length = 109 Back     alignment and structure
>pdb|1S3P|A Chain A, Crystal Structure Of Rat Alpha-parvalbumin S55d/e59d Mutant Length = 109 Back     alignment and structure
>pdb|1RTP|1 Chain 1, Refined X-ray Structure Of Rat Parvalbumin, A Mammalian Alpha-lineage Parvalbumin, At 2.0 A Resolution Length = 109 Back     alignment and structure
>pdb|2QAC|A Chain A, The Closed Mtip-myosina-tail Complex From The Malaria Parasite Invasion Machinery Length = 146 Back     alignment and structure
>pdb|2QAC|A Chain A, The Closed Mtip-myosina-tail Complex From The Malaria Parasite Invasion Machinery Length = 146 Back     alignment and structure
>pdb|1BU3|A Chain A, Refined Crystal Structure Of Calcium-Bound Silver Hake (Pi 4.2) Parvalbumin At 1.65 A Length = 109 Back     alignment and structure
>pdb|3FS7|A Chain A, Crystal Structure Of Gallus Gallus Beta-Parvalbumin (Avian Thymic Hormone) Length = 109 Back     alignment and structure
>pdb|2KQY|A Chain A, Solution Structure Of Avian Thymic Hormone Length = 108 Back     alignment and structure
>pdb|2KYC|A Chain A, Solution Structure Of Ca-Free Chicken Parvalbumin 3 (Cpv3) Length = 108 Back     alignment and structure
>pdb|1B9A|A Chain A, Parvalbumin (Mutation;d51a, F102w) Length = 108 Back     alignment and structure
>pdb|1B8C|A Chain A, Parvalbumin Length = 108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-89
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 6e-71
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-08
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-87
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 5e-72
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 5e-32
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-78
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-61
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-76
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-48
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 5e-35
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-73
1exr_A148 Calmodulin; high resolution, disorder, metal trans 5e-70
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-73
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-69
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-71
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 6e-69
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-71
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-49
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 9e-39
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-23
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-71
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 5e-69
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 3e-70
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 8e-66
3fwb_A161 Cell division control protein 31; gene gating, com 7e-70
3fwb_A161 Cell division control protein 31; gene gating, com 2e-68
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 1e-68
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 5e-67
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-68
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-67
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 5e-68
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-67
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-67
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 3e-67
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-67
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 7e-64
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 7e-67
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 7e-62
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 1e-66
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 9e-64
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-66
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-62
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 2e-66
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 7e-64
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-66
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 9e-64
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-66
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-66
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-66
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-62
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-65
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-64
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 1e-65
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-63
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-65
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-59
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 9e-64
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-63
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-14
1y1x_A191 Leishmania major homolog of programmed cell death 5e-63
1y1x_A191 Leishmania major homolog of programmed cell death 8e-61
1y1x_A191 Leishmania major homolog of programmed cell death 1e-17
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 9e-63
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-62
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 3e-62
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-59
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 1e-61
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 6e-59
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 7e-61
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 5e-58
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 7e-61
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-58
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-59
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 6e-57
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 6e-59
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-55
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-58
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-37
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 7e-26
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 5e-57
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-50
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-54
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-52
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-52
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 4e-52
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 6e-52
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 5e-51
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-51
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-51
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 6e-07
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-48
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-41
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 5e-12
3akb_A166 Putative calcium binding protein; EF-hand, metal b 6e-48
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-44
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-12
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 5e-46
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-44
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-45
2hps_A186 Coelenterazine-binding protein with bound coelent; 6e-44
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-45
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 1e-36
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-44
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-40
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-05
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 1e-44
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 6e-32
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 1e-44
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 2e-41
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 6e-15
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-43
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-41
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-42
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 8e-42
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-08
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-42
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 1e-40
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 5e-10
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 4e-42
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 4e-33
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-21
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-41
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 7e-37
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-09
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 2e-41
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-40
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-09
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-39
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-34
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 1e-39
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 6e-30
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 7e-39
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-38
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-09
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 1e-38
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 5e-37
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 5e-09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 6e-37
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 6e-34
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-35
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-35
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 6e-09
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 2e-35
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 1e-33
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 2e-11
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-35
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 6e-32
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 7e-17
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 1e-34
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 4e-29
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 1e-18
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-34
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 2e-34
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 3e-05
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 4e-34
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 6e-34
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 4e-34
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 4e-27
1avs_A90 Troponin C; muscle contraction, calcium-activated, 9e-34
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-26
1avs_A90 Troponin C; muscle contraction, calcium-activated, 2e-25
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-33
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-26
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-33
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-27
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-33
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-28
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 5e-33
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-32
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 4e-09
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 6e-33
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 9e-33
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 1e-11
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-32
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-25
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-32
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-28
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-21
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 3e-32
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 4e-32
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 4e-32
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-28
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 5e-32
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 7e-27
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 5e-22
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-31
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 8e-28
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 9e-14
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-31
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 7e-25
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 4e-20
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 6e-31
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 1e-26
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-20
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-30
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 9e-30
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 6e-12
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 4e-30
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-27
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 3e-20
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 5e-30
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 4e-26
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-21
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-29
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 6e-23
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 4e-22
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-28
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 8e-27
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 3e-28
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 3e-23
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 5e-22
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 3e-27
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 3e-26
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-26
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 6e-26
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-26
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 6e-23
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 7e-13
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 8e-26
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 3e-23
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 9e-11
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-25
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-22
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-25
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-21
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 5e-18
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-22
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 8e-18
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 4e-22
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-20
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 6e-12
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-21
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-16
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-19
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-14
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-19
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 3e-18
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 9e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-18
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 8e-17
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-18
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 4e-18
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-10
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 8e-17
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 5e-14
3li6_A66 Calcium-binding protein; calcium signaling protein 9e-17
3li6_A66 Calcium-binding protein; calcium signaling protein 5e-15
3li6_A66 Calcium-binding protein; calcium signaling protein 5e-14
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 1e-10
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-16
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-14
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-15
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-05
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 2e-15
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 1e-11
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 2e-13
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 3e-07
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 2e-06
3a4u_B143 Multiple coagulation factor deficiency protein 2; 3e-13
3a4u_B143 Multiple coagulation factor deficiency protein 2; 2e-12
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-13
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-12
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 5e-12
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 7e-11
1c07_A95 Protein (epidermal growth factor receptor pathway 5e-11
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-09
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 5e-11
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 3e-09
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 7e-11
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 8e-09
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 1e-10
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 6e-09
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 2e-10
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-08
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 1e-08
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 2e-06
1qjt_A99 EH1, epidermal growth factor receptor substrate su 1e-08
1qjt_A99 EH1, epidermal growth factor receptor substrate su 2e-07
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 4e-08
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 3e-06
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 6e-08
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 6e-06
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 9e-08
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 2e-06
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 1e-07
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 6e-06
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 2e-07
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 6e-07
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 7e-07
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 1e-04
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 1e-06
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 4e-05
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-06
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 2e-04
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 3e-06
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 1e-04
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 3e-06
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 6e-06
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 7e-04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 6e-06
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 3e-04
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 8e-06
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 2e-04
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 2e-05
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 3e-05
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 4e-05
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 4e-05
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 7e-05
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 1e-04
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 1e-04
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 2e-04
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 2e-04
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 8e-04
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 2e-04
2jq6_A139 EH domain-containing protein 1; metal binding prot 2e-04
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 3e-04
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
 Score =  261 bits (669), Expect = 1e-89
 Identities = 128/180 (71%), Positives = 132/180 (73%), Gaps = 27/180 (15%)

Query: 10  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDF 69
           DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD                GNGTIDF
Sbjct: 23  DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD----------------GNGTIDF 66

Query: 70  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 129
           PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNG+ISAAELRHVMTNLGEKLTDEEVDEMI
Sbjct: 67  PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMI 126

Query: 130 READIDGDGQVNYEGNGTIDFPEFLTMMARKMKDTDS---EEEIREAFRVFDKDGNGFIS 186
           READIDGDGQVNYE        EF+ MM  K     +   +E IR   R   K    F  
Sbjct: 127 READIDGDGQVNYE--------EFVQMMTAKGGGGGAAARKEVIRNKIRAIGKMARVFSV 178


>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Length = 99 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Length = 95 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Length = 100 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.97
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.97
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.96
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.93
1y1x_A191 Leishmania major homolog of programmed cell death 99.93
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.92
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.92
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.92
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.92
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.92
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.92
3fwb_A161 Cell division control protein 31; gene gating, com 99.91
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.91
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.91
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.91
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.91
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.91
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.91
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.91
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.9
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.9
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.9
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.9
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.9
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.9
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.9
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.9
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.9
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.9
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.9
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.89
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.89
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.89
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.89
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.89
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.89
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.89
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.89
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.88
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.88
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.88
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.88
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.88
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.88
1y1x_A191 Leishmania major homolog of programmed cell death 99.88
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.88
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.88
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.88
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.88
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.88
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.87
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.87
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.87
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.87
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.87
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.87
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.87
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.87
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.87
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.87
3fwb_A161 Cell division control protein 31; gene gating, com 99.87
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.87
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.87
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.86
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.86
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.86
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.86
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.86
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.86
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.86
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.86
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.86
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.86
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.85
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.85
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.85
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.85
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.85
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.85
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.85
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.85
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.85
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.85
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.85
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.84
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.84
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.84
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.84
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.84
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.84
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.84
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.83
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.83
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.83
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.83
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.83
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.83
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.82
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.82
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.82
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.82
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.82
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.82
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.82
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.81
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.81
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.81
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.81
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.81
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.81
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.8
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.8
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.8
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.8
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.8
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.8
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.8
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.8
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.8
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.8
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.79
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.79
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.79
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.79
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.79
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.79
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.79
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.79
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.79
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.79
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.79
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.79
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.79
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.79
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.78
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.78
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.78
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.78
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.78
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.78
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.77
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.77
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.77
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.77
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.77
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.77
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.77
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.77
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.76
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.76
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.75
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.74
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.74
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.73
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.73
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.72
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.72
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.71
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.71
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.71
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.7
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.7
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.7
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.7
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.69
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.69
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.69
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.69
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.69
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.69
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.68
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.67
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.67
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.67
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.67
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.67
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.65
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.65
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.65
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.6
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.59
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.58
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.58
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.57
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.56
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.56
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.55
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.54
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.51
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.51
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.49
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.48
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.45
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.43
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.42
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.41
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.41
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.4
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.39
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.39
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.38
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.38
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.37
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.37
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.36
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.35
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.35
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.35
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.34
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.33
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.33
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.33
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.31
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.3
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.3
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.3
3li6_A66 Calcium-binding protein; calcium signaling protein 99.3
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.29
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.29
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.29
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.29
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.28
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.28
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.28
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.28
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.27
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.26
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.26
1c07_A95 Protein (epidermal growth factor receptor pathway 99.25
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.25
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.25
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.24
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.23
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.23
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.23
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.22
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.22
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.21
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.21
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.2
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.2
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.19
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.19
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.18
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.18
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.18
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.16
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.16
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.15
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.15
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.15
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.14
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.13
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.12
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.1
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.1
3li6_A66 Calcium-binding protein; calcium signaling protein 99.07
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.07
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.06
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.05
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.05
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.04
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.04
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.03
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.02
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.02
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.02
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.01
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.97
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.97
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.96
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.96
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.95
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.94
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.94
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.93
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.93
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.92
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.92
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.92
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.91
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.89
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.89
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.88
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.88
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.88
1c07_A95 Protein (epidermal growth factor receptor pathway 98.86
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.85
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.84
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.82
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.8
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.8
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.77
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.77
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.74
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.74
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.73
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.72
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.71
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.7
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.69
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.65
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.6
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.59
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.59
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.48
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 98.34
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.98
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.9
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.71
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 96.92
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.71
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 96.38
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 96.33
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 96.06
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 95.74
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 95.26
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 95.14
2jrf_A184 Tubulin polymerization-promoting protein family me 95.0
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 94.92
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 94.6
3kev_A 199 Galieria sulfuraria DCUN1 domain-containing prote; 94.49
4gba_A 221 DCN1-like protein 3; E3 ligase, ligase-peptide com 93.69
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 92.99
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 92.53
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 92.06
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 91.67
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 91.65
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 91.64
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 91.64
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 90.39
2jrf_A184 Tubulin polymerization-promoting protein family me 89.02
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 88.89
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 85.74
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 85.09
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 84.78
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 84.77
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 84.64
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 84.0
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 82.31
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
Probab=99.97  E-value=1e-30  Score=203.13  Aligned_cols=207  Identities=23%  Similarity=0.436  Sum_probs=177.1

Q ss_pred             hhhhhhhc--CCCCCcCHHHHHHHHHHcCCCCCH------HHHHHHHHhccccccchhhhhhhhhhhccCCCccchHHHH
Q psy7436           2 IEEYGSLL--DGDGTITTKELGTVMRSLGQNPTE------AELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFL   73 (243)
Q Consensus         2 ~~~~f~~f--d~~g~i~~~ef~~~l~~l~~~l~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~i~~~ef~   73 (243)
                      ++.+|..|  |++|.|+.+||..+|+.+|..++.      .++..++..++.+                ++|.|+++||.
T Consensus        18 l~~~F~~~D~d~~G~i~~~El~~~l~~l~~~~~~~~~~~~~~~~~l~~~~D~~----------------~~g~i~~~Ef~   81 (263)
T 2f33_A           18 FFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKTFVDQYGQR----------------DDGKIGIVELA   81 (263)
T ss_dssp             HHHHHHHHCTTCSSSBCSHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHTTG----------------GGCCBCHHHHH
T ss_pred             HHHHHHHhCCCCCCCcCHHHHHHHHHHHHhhcCCCccchHHHHHHHHHHhCCC----------------CCCcCcHHHHH
Confidence            56778888  799999999999999998766554      7778888888887                99999999999


Q ss_pred             HHHHhh--------cCCcccHHHHHHHHHhhcCCCCCcccHHHHHHHHHHh----CCCCCHHHHHH----HHHHhCcCCC
Q psy7436          74 TMMARK--------MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL----GEKLTDEEVDE----MIREADIDGD  137 (243)
Q Consensus        74 ~~~~~~--------~~~~~~~~~l~~~f~~~D~~~~g~i~~~e~~~~l~~~----~~~~~~~~~~~----l~~~~~~~~~  137 (243)
                      .++...        .........++.+|..+|.+++|.|+..||..++..+    |..+++.++..    ++..++.+++
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~i~~~el~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~d~~~d  161 (263)
T 2f33_A           82 HVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNND  161 (263)
T ss_dssp             HHTTSCTTHHHHHGGGTSSCHHHHHHHHTTSSTTTCSSBCHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTCSSSS
T ss_pred             HHHhhhhhHHHHHHHhhccHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHhcCCCCC
Confidence            987532        1334567789999999999999999999999999988    88899988877    9999999977


Q ss_pred             CccccCCCCCCChHHHHHHHHh-------hcCCCCcHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCC----CCCHHHH
Q psy7436         138 GQVNYEGNGTIDFPEFLTMMAR-------KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE----KLTDEEV  206 (243)
Q Consensus       138 ~~i~~~~~~~i~~~ef~~~~~~-------~~~~~~~~~~~~~~f~~~D~~~~G~i~~~e~~~~l~~~~~----~~~~~~~  206 (243)
                      |.        |++.+|+..+..       ..........+..+|+.+|.+++|.|+.+||+.+++.++.    .++++++
T Consensus       162 g~--------i~~~ef~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~d~~G~is~~El~~~l~~~~~~~~~~~~~~e~  233 (263)
T 2f33_A          162 GK--------LELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNI  233 (263)
T ss_dssp             SC--------BCHHHHHHHSCTTTCSHHHHHHTCCCHHHHHHHHHHHCCSSSSCEEHHHHHHHHHHHHHHCTTTCCTTTH
T ss_pred             Ce--------EcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHhCCCCCCcccHHHHHHHHHHHHHhcCCCCCHHHH
Confidence            76        788899988753       1123445688999999999999999999999999998876    7999999


Q ss_pred             HHHHHh-cCCCCCCcccHHHHHHHHHH
Q psy7436         207 DEMIRE-ADIDGDGQVNYEVYTIYCVH  232 (243)
Q Consensus       207 ~~~~~~-~d~~~~g~i~~~eF~~~~~~  232 (243)
                      ..+++. +|.|++|.|+|+||+.++..
T Consensus       234 ~~~~~~~~D~d~dG~i~~~EF~~~~~~  260 (263)
T 2f33_A          234 STYKKNIMALSDGGKLYRTDLALILSA  260 (263)
T ss_dssp             HHHHHHHHTTSBTTEECGGGTHHHHCC
T ss_pred             HHHHHHhhccCCCCeEcHHHHHHHHhc
Confidence            999987 79999999999999998754



>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 4e-30
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-26
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-07
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-29
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-24
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-29
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-21
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-08
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 3e-29
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-23
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-06
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 6e-28
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 4e-20
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 8e-07
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 3e-25
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 5e-21
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-25
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-24
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 4e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-24
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-24
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-24
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-18
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 6e-24
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 3e-17
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9e-08
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 4e-23
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-19
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-22
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 5e-20
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-22
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 9e-18
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-22
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-22
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-04
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-21
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-20
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 0.001
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-20
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-18
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-08
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 1e-20
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-20
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 2e-20
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 4e-17
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-20
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-14
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-10
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 7e-20
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-17
d1ij5a_ 321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-09
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 9e-20
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 8e-14
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-19
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 4e-13
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-07
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-19
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 1e-13
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 6e-07
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-19
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 9e-16
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 1e-10
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-09
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 5e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 2e-19
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-18
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 0.004
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 3e-19
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 6e-16
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 1e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 4e-19
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-17
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 1e-08
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 5e-06
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 4e-19
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 2e-13
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 4e-09
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 5e-19
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 4e-17
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 4e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.001
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 7e-19
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-17
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 8e-19
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-14
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-10
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 2e-18
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 4e-13
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 3e-06
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-18
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-13
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 4e-06
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9e-18
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-16
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9e-06
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 1e-17
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-15
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 6e-15
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-08
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-17
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-16
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-04
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 2e-17
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 3e-13
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 1e-05
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 3e-17
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 1e-12
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 5e-05
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 6e-17
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 3e-12
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-09
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 6e-17
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-13
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 4e-09
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 3e-16
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 8e-14
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 9e-08
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 0.004
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-16
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-13
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 9e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-04
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 4e-16
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 4e-16
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.002
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 5e-16
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-13
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-07
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 9e-16
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 9e-16
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 5e-04
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 9e-16
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-12
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 3e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-04
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 2e-15
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 8e-13
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 2e-08
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 4e-15
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 8e-13
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 1e-05
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 7e-15
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 3e-13
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 1e-07
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 1e-05
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.003
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-14
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 6e-11
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 8e-07
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-14
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-12
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-08
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 1e-14
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 1e-14
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 4e-04
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-14
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-11
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-07
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-14
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-14
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.001
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-14
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 4e-12
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-07
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-13
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 7e-10
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 8e-05
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 3e-13
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 2e-11
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 3e-05
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-13
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-11
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-05
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 7e-13
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 8e-12
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-12
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 4e-10
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-04
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 4e-12
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 1e-09
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 7e-05
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-11
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-09
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-07
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 1e-11
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 7e-09
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 1e-08
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 5e-11
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 2e-10
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 5e-11
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 8e-10
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 5e-05
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 7e-11
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 2e-07
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 2e-10
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 3e-10
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 4e-10
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 1e-04
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 1e-09
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 6e-08
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 5e-08
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-06
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 5e-08
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 1e-06
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 9e-08
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 7e-06
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 2e-07
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 1e-05
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-06
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-04
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 7e-06
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 2e-04
d1ctda_34 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1ctda_34 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1xk4c183 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa 8e-04
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  107 bits (268), Expect = 4e-30
 Identities = 71/138 (51%), Positives = 103/138 (74%), Gaps = 9/138 (6%)

Query: 87  EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNG 146
            E +EAF +FDKD NG IS++EL  VM +LG   ++ EV++++ E D+DG+ Q       
Sbjct: 10  AEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQ------- 62

Query: 147 TIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEV 206
            I+F EFL +M+R++K  DSE+E+ EAF+VFDK+G+G ISAAEL+HV+T++GEKLTD EV
Sbjct: 63  -IEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEV 121

Query: 207 DEMIREADIDGDGQVNYE 224
           D+M+RE   DG G++N +
Sbjct: 122 DDMLREVS-DGSGEINIQ 138


>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 34 Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 34 Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.93
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.92
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.91
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.91
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.9
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.9
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.9
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.89
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.88
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.88
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.88
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.87
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.87
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.87
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.87
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.87
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.87
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.87
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.86
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.86
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.85
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.85
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.85
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.85
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.84
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.84
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.83
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.81
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.81
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.81
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.8
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.8
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.8
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.8
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.79
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.79
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.79
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.79
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.79
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.77
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.77
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.76
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.75
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.74
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.74
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.74
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.73
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.73
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.73
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.73
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.71
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.71
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.69
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.68
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.67
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.66
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.66
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.64
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.63
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.62
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.62
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.61
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.61
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.6
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.59
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.59
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.59
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.58
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.58
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.57
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.56
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.54
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.53
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.51
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.51
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.5
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.49
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.48
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.47
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.47
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.47
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.46
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.45
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.39
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.36
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.36
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.35
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.34
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.34
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.33
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.32
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.31
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.29
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.29
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.28
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.24
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.24
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.23
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.23
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.2
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.18
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.15
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.14
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.13
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.12
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.11
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.07
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.0
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.99
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.94
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.89
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.88
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.75
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.71
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.7
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.7
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.68
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.66
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.63
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.6
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.51
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.49
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.45
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.42
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.41
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.41
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.39
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.28
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.27
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.26
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.14
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.06
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.88
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.8
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.76
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.57
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.4
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 96.85
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 95.85
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 95.72
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 95.36
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.55
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 94.48
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 94.27
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 92.69
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 90.93
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 89.75
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 89.17
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 89.02
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 88.62
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 87.59
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 87.41
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 83.59
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]
Probab=99.93  E-value=1.4e-25  Score=177.14  Aligned_cols=195  Identities=18%  Similarity=0.333  Sum_probs=170.7

Q ss_pred             hhhhhhhc--CCCCCcCHHHHHHHHHHcCCCCCHHHHHHHHHhccccccchhhhhhhhhhhccCCCccchHHHHHHHHhh
Q psy7436           2 IEEYGSLL--DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADENVESNLQYAELFVYHGNGTIDFPEFLTMMARK   79 (243)
Q Consensus         2 ~~~~f~~f--d~~g~i~~~ef~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~i~~~ef~~~~~~~   79 (243)
                      ++.+|..+  |++|.|+.+||+.+|+.+|..++..++..++..+|.+                ++|.|+|.+|+..+...
T Consensus       124 ~~~~F~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~----------------~~g~i~~~ef~~~~~~~  187 (321)
T d1ij5a_         124 LRQLFLSSAVSGSGKFSFQDLKQVLAKYADTIPEGPLKKLFVMVEND----------------TKGRMSYITLVAVANDL  187 (321)
T ss_dssp             HHHHHTSSSSTTSSCCCHHHHHHHHHHHHTTSCSSHHHHHHHHHHHC----------------CSSTHHHHHHTTSHHHH
T ss_pred             HHHHHHHHcCCCCCeEcHHHHHHHHHHcCCcccHHHHHHHHHHHhhc----------------CCccccchhhhhhhhhh
Confidence            45677777  8999999999999999999999999999999999998                99999999999877544


Q ss_pred             cCCcccHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHHhCcCCCCccccCCCCCCChHHHHHHHHh
Q psy7436          80 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGNGTIDFPEFLTMMAR  159 (243)
Q Consensus        80 ~~~~~~~~~l~~~f~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~~i~~~ef~~~~~~  159 (243)
                      ..       +...|..+|.+++|.++..++...+...+.. .......++..++.+.++.        +.+.+|......
T Consensus       188 ~~-------~~~~F~~~d~d~~~~i~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~--------i~~~ef~~~~~~  251 (321)
T d1ij5a_         188 AA-------LVADFRKIDTNSNGTLSRKEFREHFVRLGFD-KKSVQDALFRYADEDESDD--------VGFSEYVHLGLC  251 (321)
T ss_dssp             HT-------SCCCHHHHCTTCCSEECHHHHHHHHHHTTCC-CHHHHHHHHHHHCTTCSSC--------EEHHHHHHHHHH
T ss_pred             hh-------hhHHHHHHhhcccccchhHHHhhhhhccccc-chHHHHHHHHhhhcccccc--------cccccccchhhh
Confidence            32       4457899999999999999999999998765 5667788888999887776        567799888776


Q ss_pred             hcCCCCcHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCC-CCHHHHHHHHHhcCCCCCCcccHHHHHHHHHHhhc
Q psy7436         160 KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEK-LTDEEVDEMIREADIDGDGQVNYEVYTIYCVHIMG  235 (243)
Q Consensus       160 ~~~~~~~~~~~~~~f~~~D~~~~G~i~~~e~~~~l~~~~~~-~~~~~~~~~~~~~d~~~~g~i~~~eF~~~~~~~~~  235 (243)
                      .       ..+..+|..+|.+++|.|+..||+.+|..++.+ +++.++..+|..+|.|++|+|+|.||++++..+.|
T Consensus       252 ~-------~~~~~~F~~~D~d~~G~Is~~E~~~~l~~~~~~~~~~~~~~~l~~~~D~d~dG~Is~~EF~~~ml~~~~  321 (321)
T d1ij5a_         252 L-------LVLRILYAFADFDKSGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVDVDDSKSLSYQEFVMLVLLMFH  321 (321)
T ss_dssp             H-------HHHHHHHHHTCSSSCSSEEHHHHHHHHHHTTCCGGGCSTHHHHHHHHTTTTCSEECHHHHHHHHHHHC-
T ss_pred             h-------hHHHHHHHHHhcCCCCCCcHHHHHHHHHHcCCCcCcHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHhcC
Confidence            6       677889999999999999999999999999964 88899999999999999999999999999987643



>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure