Psyllid ID: psy7457

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------
MMKTGQSYENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
ccccccccccccccHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEcccccccccEEEEEcc
ccccccccccHHHHHHHHHHHHHHHHHHEccccccEEEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccccccccccEEEEEEcccccEEEccHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcEEEEEcccccEEEHHHHHHHHHHHHHHHHcccEEEEEEccccccEEccHHHccccEEEEEEEc
mmktgqsyenpqEYYSLLNLVLSQhsiqvinpdesryilsrvrtpkKIEHILIqrglskdtiLDNRARRLRLCDEIGLKNRGFVLAGYQRYlknitpdsdpqtiLDLSTRAAHVYHTARNFPQAASSLAIAFQYsahlirpehCNLYLEVLLELKRYETCVEVLRRFANIEITyfklfpqdstsgeesniqitnytvpsdpnlvpppeiLSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSekynqpgvWKQLAETYEKSECLSGVVVSTvdtgsgswwFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVlyktghiphaYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTfqskpnnlglnvmyanncnltsnvnvqgeevkklDVLSNELFVNMLTSSYSTCLLVSEENETALEIHhqeastgdpcvrldi
mmktgqsyenPQEYYSLLNLVLSQHSIQVINPDESRYILSRvrtpkkiehiliqrglskdtildnRARRLRLcdeiglknrgfVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLitlrssdiriVRNTLRtfqskpnnlgLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEihhqeastgdpcvrldi
MMKTGQSYENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLsgvvvstvdtgsgsWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
************EYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFP**********IQITNYTVP***NLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSE************************
***TGQSYENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLI************************PHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNC**************KLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
********ENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
*******YENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKTGQSYENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEESNIQITNYTVPSDPNLVPPPEILSKFVITLVHLRSETQFPTLLASLKFDVEMYGTITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEKSECLSGVVVSTVDTGSGSWWFQSMSSAMCSTVLIKDSTEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTGDPCVRLDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query497 2.2.26 [Sep-21-2011]
P70695 339 Fructose-1,6-bisphosphata yes N/A 0.193 0.283 0.425 1e-11
Q2KJJ9 339 Fructose-1,6-bisphosphata yes N/A 0.183 0.268 0.421 2e-11
Q9Z1N1 339 Fructose-1,6-bisphosphata yes N/A 0.183 0.268 0.421 3e-11
Q9N0J6 339 Fructose-1,6-bisphosphata yes N/A 0.183 0.268 0.421 3e-11
O00757 339 Fructose-1,6-bisphosphata yes N/A 0.183 0.268 0.411 4e-11
Q9QXD6 338 Fructose-1,6-bisphosphata no N/A 0.195 0.286 0.342 2e-09
P14766 341 Fructose-1,6-bisphosphata N/A N/A 0.122 0.178 0.555 4e-09
Q8RW99 341 Fructose-1,6-bisphosphata N/A N/A 0.122 0.178 0.555 4e-09
P46276 340 Fructose-1,6-bisphosphata N/A N/A 0.122 0.179 0.523 1e-08
P00637 338 Fructose-1,6-bisphosphata no N/A 0.104 0.153 0.5 2e-08
>sp|P70695|F16P2_MOUSE Fructose-1,6-bisphosphatase isozyme 2 OS=Mus musculus GN=Fbp2 PE=2 SV=2 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 63/108 (58%), Gaps = 12/108 (11%)

Query: 378 LFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTS 437
           L R +M K   +K    L  L+    + I+ + + +R         GL  +Y     ++ 
Sbjct: 14  LTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVR-------KAGLANLYG----ISG 62

Query: 438 NVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQE 485
           +VNV G+EVKKLDVLSN L +NML SSYSTC+LVSEEN+ A+ I  QE
Sbjct: 63  SVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKEAV-ITAQE 109
May be involved in early differentiation.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 1
>sp|Q2KJJ9|F16P2_BOVIN Fructose-1,6-bisphosphatase isozyme 2 OS=Bos taurus GN=FBP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1N1|F16P2_RAT Fructose-1,6-bisphosphatase isozyme 2 OS=Rattus norvegicus GN=Fbp2 PE=2 SV=1 Back     alignment and function description
>sp|Q9N0J6|F16P2_RABIT Fructose-1,6-bisphosphatase isozyme 2 OS=Oryctolagus cuniculus GN=FBP2 PE=2 SV=1 Back     alignment and function description
>sp|O00757|F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=Homo sapiens GN=FBP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXD6|F16P1_MOUSE Fructose-1,6-bisphosphatase 1 OS=Mus musculus GN=Fbp1 PE=2 SV=3 Back     alignment and function description
>sp|P14766|F16P2_SPIOL Fructose-1,6-bisphosphatase, cytosolic OS=Spinacia oleracea PE=1 SV=2 Back     alignment and function description
>sp|Q8RW99|F16P2_PEA Fructose-1,6-bisphosphatase, cytosolic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P46276|F16P2_SOLTU Fructose-1,6-bisphosphatase, cytosolic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P00637|F16P1_RABIT Fructose-1,6-bisphosphatase 1 OS=Oryctolagus cuniculus GN=FBP1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
307188494 1490 Septin-4 [Camponotus floridanus] 0.146 0.048 0.519 6e-13
307215196 717 Septin-4 [Harpegnathos saltator] 0.146 0.101 0.506 8e-13
310743900338 fructose 1,6-bisphosphatase [Marsupenaeu 0.144 0.213 0.486 8e-13
322791446154 hypothetical protein SINV_13514 [Solenop 0.108 0.350 0.648 2e-12
350423263339 PREDICTED: fructose-1,6-bisphosphatase 1 0.199 0.292 0.434 3e-12
332029671336 Fructose-1,6-bisphosphatase 1 [Acromyrme 0.150 0.223 0.443 3e-12
357621408336 fructose-1,6-bisphosphatase [Danaus plex 0.144 0.214 0.486 3e-12
156543358338 PREDICTED: fructose-1,6-bisphosphatase 1 0.144 0.213 0.5 4e-12
340727199339 PREDICTED: fructose-1,6-bisphosphatase 1 0.199 0.292 0.434 5e-12
358255175346 fructose-1,6-bisphosphatase I [Clonorchi 0.134 0.193 0.563 9e-12
>gi|307188494|gb|EFN73231.1| Septin-4 [Camponotus floridanus] Back     alignment and taxonomy information
 Score = 82.0 bits (201), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 54/77 (70%), Gaps = 4/77 (5%)

Query: 409 VRNTLRTFQSKPNNLGLNVMYANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTC 468
           V+  ++   S     G+  MY     +  N NVQGEEVKKLDVLSNELF+NMLTSS++TC
Sbjct: 33  VQTAVKAVSSAVRKAGIANMYG----IAGNTNVQGEEVKKLDVLSNELFINMLTSSFATC 88

Query: 469 LLVSEENETALEIHHQE 485
           +LVSEEN+ A+E+  ++
Sbjct: 89  VLVSEENQHAIEVETEK 105

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307215196|gb|EFN89968.1| Septin-4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|310743900|dbj|BAJ23881.1| fructose 1,6-bisphosphatase [Marsupenaeus japonicus] Back     alignment and taxonomy information
>gi|322791446|gb|EFZ15856.1| hypothetical protein SINV_13514 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350423263|ref|XP_003493424.1| PREDICTED: fructose-1,6-bisphosphatase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332029671|gb|EGI69560.1| Fructose-1,6-bisphosphatase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357621408|gb|EHJ73252.1| fructose-1,6-bisphosphatase [Danaus plexippus] Back     alignment and taxonomy information
>gi|156543358|ref|XP_001607969.1| PREDICTED: fructose-1,6-bisphosphatase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340727199|ref|XP_003401936.1| PREDICTED: fructose-1,6-bisphosphatase 1-like isoform 1 [Bombus terrestris] gi|340727201|ref|XP_003401937.1| PREDICTED: fructose-1,6-bisphosphatase 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|358255175|dbj|GAA56894.1| fructose-1,6-bisphosphatase I [Clonorchis sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
RGD|1309185 883 Gtf3c3 "general transcription 0.352 0.198 0.267 6.5e-16
UNIPROTKB|Q9Y5Q9 886 GTF3C3 "General transcription 0.352 0.197 0.267 2.6e-15
UNIPROTKB|E1BPR9 886 GTF3C3 "Uncharacterized protei 0.352 0.197 0.272 5e-15
UNIPROTKB|E2QYG3 883 GTF3C3 "Uncharacterized protei 0.350 0.197 0.288 1.2e-14
FB|FBgn0032820 343 fbp "fructose-1,6-bisphosphata 0.187 0.271 0.440 5.3e-12
WB|WBGene00001404 341 fbp-1 [Caenorhabditis elegans 0.136 0.199 0.527 4.3e-11
MGI|MGI:95491 339 Fbp2 "fructose bisphosphatase 0.193 0.283 0.435 1.6e-09
UNIPROTKB|F1S4J7 302 FBP2 "Uncharacterized protein" 0.100 0.165 0.66 2.5e-09
UNIPROTKB|Q2KJJ9 339 FBP2 "Fructose-1,6-bisphosphat 0.183 0.268 0.431 2.8e-09
RGD|620930 339 Fbp2 "fructose-1,6-bisphosphat 0.183 0.268 0.431 2.8e-09
RGD|1309185 Gtf3c3 "general transcription factor IIIC, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 151 (58.2 bits), Expect = 6.5e-16, Sum P(3) = 6.5e-16
 Identities = 50/187 (26%), Positives = 89/187 (47%)

Query:    69 RLRLCDEIGLKNRGFVLAGYQRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSL 128
             R  L +++G  +    + GY+R L  ++P SD +  + L+   A  Y+ A +   A + +
Sbjct:   254 RSSLYEQMG--DHKMAMDGYRRILNLLSP-SDGERFMQLARDMAKSYYEANDSTSAINII 310

Query:   129 AIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFANIEITYFKLFPQDSTSGEES 188
               AF     L+  E  N+  E+ +  K+Y+  +EV+  F+ I +    L  ++ TS E  
Sbjct:   311 EEAFSKHQGLVSMEDVNIAAELYISNKQYDKALEVITDFSGIILEKETL--EEGTSEENK 368

Query:   189 NIQITNYTVPSDPNLVPPPEILSKFVITLVHLRS-ETQFPTLLASLKFDVEMYGTITVYL 247
               +    ++P       P +I  K ++ LVHL   E   P L   ++ + E  G +  YL
Sbjct:   369 AAETVTCSIPDSV----PIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDMGDL--YL 422

Query:   248 DIAEALI 254
             D+AEA +
Sbjct:   423 DVAEAFL 429
GO:0000127 "transcription factor TFIIIC complex" evidence=IEA;ISO
UNIPROTKB|Q9Y5Q9 GTF3C3 "General transcription factor 3C polypeptide 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPR9 GTF3C3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYG3 GTF3C3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0032820 fbp "fructose-1,6-bisphosphatase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001404 fbp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:95491 Fbp2 "fructose bisphosphatase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4J7 FBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJJ9 FBP2 "Fructose-1,6-bisphosphatase isozyme 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620930 Fbp2 "fructose-1,6-bisphosphatase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
cd00354 315 cd00354, FBPase, Fructose-1,6-bisphosphatase, an e 1e-15
PLN02262 340 PLN02262, PLN02262, fructose-1,6-bisphosphatase 1e-13
PRK09293 327 PRK09293, PRK09293, fructose-1,6-bisphosphatase; P 1e-10
pfam00316 325 pfam00316, FBPase, Fructose-1-6-bisphosphatase 1e-10
COG0158 326 COG0158, Fbp, Fructose-1,6-bisphosphatase [Carbohy 5e-08
PLN02542 412 PLN02542, PLN02542, fructose-1,6-bisphosphatase 1e-07
>gnl|CDD|238214 cd00354, FBPase, Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information 
 Score = 77.2 bits (191), Expect = 1e-15
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 430 ANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQEASTG 489
           A    L  +VNVQG+E KKLDVL+N++F+  L SS    +L SEE E  + +  +E+  G
Sbjct: 38  AGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLASEEEEEPVPV--EESKDG 95

Query: 490 DPCVRLD 496
              V  D
Sbjct: 96  KYLVAFD 102

The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle). Length = 315
>gnl|CDD|215147 PLN02262, PLN02262, fructose-1,6-bisphosphatase Back     alignment and domain information
>gnl|CDD|236458 PRK09293, PRK09293, fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215854 pfam00316, FBPase, Fructose-1-6-bisphosphatase Back     alignment and domain information
>gnl|CDD|223236 COG0158, Fbp, Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215298 PLN02542, PLN02542, fructose-1,6-bisphosphatase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 497
KOG2076|consensus895 100.0
KOG1458|consensus 343 99.61
COG0158 326 Fbp Fructose-1,6-bisphosphatase [Carbohydrate tran 99.57
PF00316 324 FBPase: Fructose-1-6-bisphosphatase; InterPro: IPR 99.51
PLN02542 412 fructose-1,6-bisphosphatase 99.44
PLN02262 340 fructose-1,6-bisphosphatase 99.24
PLN02628 351 fructose-1,6-bisphosphatase family protein 99.23
PRK11788389 tetratricopeptide repeat protein; Provisional 99.2
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.2
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.01
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.98
PRK11788389 tetratricopeptide repeat protein; Provisional 98.96
PLN02462 304 sedoheptulose-1,7-bisphosphatase 98.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.94
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.9
PRK11189296 lipoprotein NlpI; Provisional 98.87
PRK12370553 invasion protein regulator; Provisional 98.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.85
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.81
PRK09293 327 fructose-1,6-bisphosphatase; Provisional 98.75
PRK12370553 invasion protein regulator; Provisional 98.65
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.65
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.54
cd00354 315 FBPase Fructose-1,6-bisphosphatase, an enzyme that 98.5
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.5
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.49
PRK15359144 type III secretion system chaperone protein SscB; 98.49
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.42
KOG4626|consensus 966 98.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.35
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.35
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.27
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.22
PRK15359144 type III secretion system chaperone protein SscB; 98.22
KOG4626|consensus 966 98.18
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.16
PRK11189296 lipoprotein NlpI; Provisional 98.15
PLN03218 1060 maturation of RBCL 1; Provisional 98.14
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.14
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.07
KOG1840|consensus508 98.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.02
PLN03218 1060 maturation of RBCL 1; Provisional 98.01
PRK10370198 formate-dependent nitrite reductase complex subuni 98.01
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.99
PRK14574 822 hmsH outer membrane protein; Provisional 97.97
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.92
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.9
PRK14574 822 hmsH outer membrane protein; Provisional 97.88
KOG1155|consensus559 97.87
PRK10370198 formate-dependent nitrite reductase complex subuni 97.84
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.75
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.72
KOG1840|consensus508 97.68
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.68
KOG2002|consensus 1018 97.66
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.57
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.56
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.56
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.56
KOG2002|consensus1018 97.52
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.51
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.47
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.45
PLN03077 857 Protein ECB2; Provisional 97.4
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.32
PLN03077857 Protein ECB2; Provisional 97.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.3
KOG1126|consensus638 97.29
PF12688120 TPR_5: Tetratrico peptide repeat 97.15
KOG2076|consensus 895 97.08
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.05
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.01
KOG0624|consensus504 97.01
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.0
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.96
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.94
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.92
PRK10803263 tol-pal system protein YbgF; Provisional 96.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.88
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.83
KOG3060|consensus289 96.83
PF1337173 TPR_9: Tetratricopeptide repeat 96.77
KOG0553|consensus304 96.75
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.75
KOG1129|consensus478 96.74
KOG0624|consensus504 96.73
KOG1125|consensus579 96.7
KOG0547|consensus606 96.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.61
KOG4162|consensus799 96.6
KOG2003|consensus840 96.59
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.57
KOG1155|consensus559 96.55
PRK10803263 tol-pal system protein YbgF; Provisional 96.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.35
KOG1915|consensus677 96.32
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.28
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.25
KOG1129|consensus478 96.23
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.09
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.08
PF12688120 TPR_5: Tetratrico peptide repeat 96.07
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.96
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.96
KOG1156|consensus 700 95.9
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.89
KOG2003|consensus840 95.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.85
PF1337173 TPR_9: Tetratricopeptide repeat 95.78
KOG1126|consensus638 95.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.77
KOG0543|consensus397 95.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.61
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.56
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.43
KOG3060|consensus289 95.4
KOG1173|consensus611 95.34
KOG1127|consensus 1238 95.2
KOG2376|consensus652 95.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 95.0
COG4700251 Uncharacterized protein conserved in bacteria cont 94.94
KOG1174|consensus564 94.93
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.88
KOG1156|consensus 700 94.81
KOG3785|consensus557 94.78
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.63
KOG0495|consensus913 94.61
PRK10153517 DNA-binding transcriptional activator CadC; Provis 94.6
KOG1174|consensus564 94.57
PF13512142 TPR_18: Tetratricopeptide repeat 94.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.52
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.28
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.21
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.11
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.1
PF1342844 TPR_14: Tetratricopeptide repeat 94.03
KOG0548|consensus539 93.85
PLN02789320 farnesyltranstransferase 93.62
PRK04841903 transcriptional regulator MalT; Provisional 93.56
PF1342844 TPR_14: Tetratricopeptide repeat 93.35
PF13512142 TPR_18: Tetratricopeptide repeat 93.31
KOG1070|consensus1710 93.26
PLN02789320 farnesyltranstransferase 92.89
PRK04841903 transcriptional regulator MalT; Provisional 92.85
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.81
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.8
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.73
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.64
KOG4162|consensus799 92.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.37
KOG1125|consensus579 92.14
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.77
PF1343134 TPR_17: Tetratricopeptide repeat 91.57
KOG1915|consensus677 91.44
KOG1127|consensus1238 91.38
KOG0543|consensus397 91.31
PF03704146 BTAD: Bacterial transcriptional activator domain; 91.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.18
KOG3785|consensus 557 91.0
KOG1173|consensus611 90.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.91
KOG0495|consensus913 90.69
KOG0553|consensus304 90.31
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.15
KOG1538|consensus1081 89.74
PRK15331165 chaperone protein SicA; Provisional 89.46
KOG4642|consensus284 89.15
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.15
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.84
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.51
KOG4234|consensus271 88.02
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.79
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 87.3
COG3118304 Thioredoxin domain-containing protein [Posttransla 87.0
PRK15331165 chaperone protein SicA; Provisional 86.94
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 86.92
KOG0547|consensus606 86.88
KOG0550|consensus486 86.74
COG1729262 Uncharacterized protein conserved in bacteria [Fun 86.73
KOG0548|consensus539 86.72
PF1343134 TPR_17: Tetratricopeptide repeat 86.7
KOG3617|consensus1416 85.66
KOG2047|consensus835 85.29
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 84.75
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.73
COG0457291 NrfG FOG: TPR repeat [General function prediction 84.63
KOG2376|consensus652 83.72
COG5159421 RPN6 26S proteasome regulatory complex component [ 83.53
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.46
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.46
KOG1128|consensus777 83.36
KOG1585|consensus308 82.99
COG4105254 ComL DNA uptake lipoprotein [General function pred 82.82
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.21
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 80.97
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.89
KOG1586|consensus288 80.6
>KOG2076|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.5e-50  Score=438.90  Aligned_cols=394  Identities=20%  Similarity=0.229  Sum_probs=341.6

Q ss_pred             ChHHHHHHHHHHHhhhcccccCCccceehhhcccCcchhhhHHHhhcCCCCccHHHHHHHHHHHHHhCCcchhHHHHHHH
Q psy7457          10 NPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGYQ   89 (497)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~r~~~~~~~~~~~~~~~~~~p~n~~~~~~RA~Ly~elG~~~~~~Al~~y~   89 (497)
                      ||+.|-.++     ..|-+..|-+||+|||+|||..             +|.||+++|+|+.||+++|+.+  +||+||+
T Consensus       206 d~e~W~~la-----dls~~~~~i~qA~~cy~rAI~~-------------~p~n~~~~~ers~L~~~~G~~~--~Am~~f~  265 (895)
T KOG2076|consen  206 DYELWKRLA-----DLSEQLGNINQARYCYSRAIQA-------------NPSNWELIYERSSLYQKTGDLK--RAMETFL  265 (895)
T ss_pred             ChHHHHHHH-----HHHHhcccHHHHHHHHHHHHhc-------------CCcchHHHHHHHHHHHHhChHH--HHHHHHH
Confidence            556776554     5567788999999999999996             8999999999999999999999  9999999


Q ss_pred             HHHhccCCCCChhhHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHccCCCChhHHHHHHHHHHhhccHHHHHHHHHHhch
Q psy7457          90 RYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFAN  169 (497)
Q Consensus        90 ~il~~~~P~d~~~~~~~~~k~LA~~Y~e~~~~~~Ai~~le~a~~~~~~~f~~~~vNiLaEL~i~~k~y~~al~~I~~~~~  169 (497)
                      ++++. .|+++++++.+.++.+|+.|++.++.+.|+++++.++..+.+.|+.+++|||+|||++.++|.++++.|...|+
T Consensus       266 ~l~~~-~p~~d~er~~d~i~~~~~~~~~~~~~e~a~~~le~~~s~~~~~~~~ed~ni~ael~l~~~q~d~~~~~i~~~~~  344 (895)
T KOG2076|consen  266 QLLQL-DPPVDIERIEDLIRRVAHYFITHNERERAAKALEGALSKEKDEASLEDLNILAELFLKNKQSDKALMKIVDDRN  344 (895)
T ss_pred             HHHhh-CCchhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhccccccccHHHHHHHHHHHhHHHHHhhHHHHHHhc
Confidence            99999 99999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             heeeeccCCCCCCCCCccc---cccccccccCCCCCCCCCcchhH-HHHHHHhhcCCCCchhHHhhcc-ccC--cccccc
Q psy7457         170 IEITYFKLFPQDSTSGEES---NIQITNYTVPSDPNLVPPPEILS-KFVITLVHLRSETQFPTLLASL-KFD--VEMYGT  242 (497)
Q Consensus       170 ~~l~~~~~~~~D~e~d~~~---~~~~~~~~~p~~l~l~lPiDLr~-KLgI~ll~Lg~~~~~~~l~~~l-~e~--~ee~~D  242 (497)
                      +..     ++||+|.|.+.   ..-...|++|+++    |++|++ |+.+|++||+..++.+.+++.+ .++  +++.+|
T Consensus       345 r~~-----e~d~~e~~~~~~~~~~~~~~~~~~~~~----s~~l~v~rl~icL~~L~~~e~~e~ll~~l~~~n~~~~d~~d  415 (895)
T KOG2076|consen  345 RES-----EKDDSEWDTDERRREEPNALCEVGKEL----SYDLRVIRLMICLVHLKERELLEALLHFLVEDNVWVSDDVD  415 (895)
T ss_pred             ccc-----CCChhhhhhhhhccccccccccCCCCC----CccchhHhHhhhhhcccccchHHHHHHHHHHhcCChhhhHH
Confidence            443     34555544321   2223348889998    999999 9999999999999999999999 666  888888


Q ss_pred             cchhhhhHHHHHHHHHHHHHHHhhhhhhHHHHHHHHhcccHHHHHHHHHHHhcCCCCChHHHHHHHHHHHHH--------
Q psy7457         243 ITVYLDIAEALIQEHYEAYAVQFKELVYLDIAEALIQEHYEAYAVQVLVLLVSSEKYNQPGVWKQLAETYEK--------  314 (497)
Q Consensus       243 ~~Ly~~~~~~~~~~~~~~~~~~~~~~~~ldvaeAl~e~g~y~~Al~~l~~L~~~~~y~~~~vwl~lAeCy~~--------  314 (497)
                        ||                        +|||+||++.|+|++|++||.+|++.+.++++.||+++|+||.+        
T Consensus       416 --L~------------------------~d~a~al~~~~~~~~Al~~l~~i~~~~~~~~~~vw~~~a~c~~~l~e~e~A~  469 (895)
T KOG2076|consen  416 --LY------------------------LDLADALTNIGKYKEALRLLSPITNREGYQNAFVWYKLARCYMELGEYEEAI  469 (895)
T ss_pred             --HH------------------------HHHHHHHHhcccHHHHHHHHHHHhcCccccchhhhHHHHHHHHHHhhHHHHH
Confidence              99                        99999999999999999999999999999999999999999766        


Q ss_pred             ---------------------------------hhhcc---Cccccc-----------------------------ccCC
Q psy7457         315 ---------------------------------SECLS---GVVVST-----------------------------VDTG  329 (497)
Q Consensus       315 ---------------------------------l~~l~---~~~~~~-----------------------------~d~~  329 (497)
                                                       ++.|+   +|...+                             +|++
T Consensus       470 e~y~kvl~~~p~~~D~Ri~Lasl~~~~g~~EkalEtL~~~~~~D~~~~e~~a~~~e~ri~~~r~d~l~~~gk~E~fi~t~  549 (895)
T KOG2076|consen  470 EFYEKVLILAPDNLDARITLASLYQQLGNHEKALETLEQIINPDGRNAEACAWEPERRILAHRCDILFQVGKREEFINTA  549 (895)
T ss_pred             HHHHHHHhcCCCchhhhhhHHHHHHhcCCHHHHHHHHhcccCCCccchhhccccHHHHHHHHHHHHHHHhhhHHHHHHHH
Confidence                                             22332   122111                             0000


Q ss_pred             ------------------------------------------------------------------------CchHHHHH
Q psy7457         330 ------------------------------------------------------------------------SGSWWFQS  337 (497)
Q Consensus       330 ------------------------------------------------------------------------~~~~w~~~  337 (497)
                                                                                              .++||.++
T Consensus       550 ~~Lv~~~~~~~~~f~~~~k~r~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~l~d~~~~~~~e~~~Lsiddwfel~  629 (895)
T KOG2076|consen  550 STLVDDFLKKRYIFPRNKKKRRRAIAGTTSKRYSELLKQIIRAREKATDDNVMEKALSDGTEFRAVELRGLSIDDWFELF  629 (895)
T ss_pred             HHHHHHHHHHHHhcchHHHHHHHhhccccccccchhHHHHHHHHhccCchHHhhhcccchhhhhhhhhccCcHHHHHHHH
Confidence                                                                                    67888655


Q ss_pred             HH-------------------hhhhhcccccc--cHHHHhhccccccccccccCCcchhHHHHHHHHHh-----cCCCcc
Q psy7457         338 MS-------------------SAMCSTVLIKD--STEHLDQLSLDATTVLYKTGHIPHAYQLFRVLMLK-----NLDSKV  391 (497)
Q Consensus       338 ~~-------------------~~~~~~~~~~~--~~~~l~~~~l~~~~~~~~~~~~~~ay~~~r~~~~~-----~~~~~~  391 (497)
                      ++                   ++++.+.|..+  ++++|+|+.+   .+|+.++|...||+++|.++..     ++...+
T Consensus       630 ~e~i~~L~k~~r~qeAl~vv~~a~~~~~f~~~~~~~k~l~~~~l---~~s~~~~d~~~a~~~lR~~i~~~~~~~~~~q~~  706 (895)
T KOG2076|consen  630 RELILSLAKLQRVQEALSVVFTALEAYIFFQDSEIRKELQFLGL---KASLYARDPGDAFSYLRSVITQFQFYLDVYQLN  706 (895)
T ss_pred             HHHHHHHHHHHhHHHHHHHHHHHHhhhhhhccHHHHHHHHHHHH---HHHHhcCCHHHHHHHHHHHHHHHhhhhhhHHHH
Confidence            54                   44488888877  7899999999   9999999999999999999999     999999


Q ss_pred             chh-hhhccccCCCccchhHHHHHhhhcCCCCccc-ccccccccccccCcCC-cchhhhhhhhhhhHHHHHHhc
Q psy7457         392 VLN-LMNLITLRSSDIRIVRNTLRTFQSKPNNLGL-NVMYANNCNLTSNVNV-QGEEVKKLDVLSNELFVNMLT  462 (497)
Q Consensus       392 ~wn-lfn~~~~~t~~iTL~rfLl~~~~~~p~~~~~-~LL~~~~~g~aGs~N~-~GE~QkkLDV~Anelf~~aL~  462 (497)
                      +|| .||.++...+.+.+.||+++...+++..++. .++.||++..+|+..+ .|++...+...|++.++..|-
T Consensus       707 l~n~~~s~~~~~~q~v~~~R~~~~~~~~~~~~~~~l~~i~gh~~~~~~s~~~Al~~y~ra~~~~pd~Pl~nl~l  780 (895)
T KOG2076|consen  707 LWNLDFSYFSKYGQRVCYLRLIMRLLVKNKDDTPPLALIYGHNLFVNASFKHALQEYMRAFRQNPDSPLINLCL  780 (895)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccCccCCcceeeeechhHhhccchHHHHHHHHHHHHhCCCCcHHHHHH
Confidence            999 9999999999999999999999888877544 8899999999999755 899999999999988887754

>KOG1458|consensus Back     alignment and domain information
>COG0158 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00316 FBPase: Fructose-1-6-bisphosphatase; InterPro: IPR000146 This entry represents the fructose-1,6-bisphosphatase (FBPase) class 1 family Back     alignment and domain information
>PLN02542 fructose-1,6-bisphosphatase Back     alignment and domain information
>PLN02262 fructose-1,6-bisphosphatase Back     alignment and domain information
>PLN02628 fructose-1,6-bisphosphatase family protein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN02462 sedoheptulose-1,7-bisphosphatase Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09293 fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
3ifa_A 338 Human Muscle Fructose-1,6-Bisphosphatase E69q Mutan 2e-12
1bk4_A 337 Crystal Structure Of Rabbit Liver Fructose-1,6-Bisp 1e-09
2fhy_A 374 Structure Of Human Liver Fpbase Complexed With A No 2e-09
1fta_A 337 Fructose-1,6-Bisphosphatase(D-Fructose-1,6-Bisphosp 2e-09
3a29_A 337 Crystal Structure Of Human Liver Fbpase In Complex 2e-09
2fie_A 338 Structure Of Human Liver Fbpase Complexed With Pote 2e-09
1fj6_A 337 Fructose-1,6-Bisphosphatase (Mutant Y57w) ProductZN 3e-09
1yxi_A 337 R-State Amp Complex Reveals Initial Steps Of The Qu 3e-09
1cnq_A 337 Fructose-1,6-Bisphosphatase Complexed With Fructose 3e-09
2f3b_A 338 Mechanism Of Displacement Of A Catalytically Essent 3e-09
1fsa_A 337 The T-State Structure Of Lys 42 To Ala Mutant Of Th 6e-09
1fbp_A 335 Crystal Structure Of Fructose-1,6-Bisphosphatase Co 6e-09
1rdx_A 337 R-State Structure Of The Arg 243 To Ala Mutant Of P 6e-09
1lev_A 337 Porcine Kidney Fructose-1,6-bisphosphatase Complexe 6e-09
1kz8_A 337 Crystal Structure Of Porcine Fructose-1,6-bisphosph 6e-09
1frp_A 335 Crystal Structure Of Fructose-1,6-Bisphosphatase Co 1e-08
1dbz_A 357 C153s Mutant Of Pea Fructose-1,6-Bisphosphatase Len 5e-07
1d9q_A 357 Oxidized Pea Fructose-1,6-Bisphosphatase Form 1 Len 6e-07
1spi_A 358 Crystal Structure Of Spinach Chloroplast Fructose-1 1e-05
>pdb|3IFA|A Chain A, Human Muscle Fructose-1,6-Bisphosphatase E69q Mutant In Complex With Amp Length = 338 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 11/102 (10%)
Query: 378 LFRVLMLKNLDSKVVLNLMNLITLRSSDIRIVRNTLRTFQSKPNNLGLNVMYANNCNLTS 437
           L R +M K   +K    L  L+    + I+ + + +R         GL  +Y     +  
Sbjct: 13  LTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVR-------KAGLAHLYG----IAG 61
Query: 438 NVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETAL 479
           +VNV G++VKKLDVLSN L +NML SSYSTC+LVSEEN+ A+
Sbjct: 62  SVNVTGDQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAI 103
>pdb|1BK4|A Chain A, Crystal Structure Of Rabbit Liver Fructose-1,6-Bisphosphatase At 2.3 Angstrom Resolution Length = 337 Back     alignment and structure
>pdb|2FHY|A Chain A, Structure Of Human Liver Fpbase Complexed With A Novel Benzoxazole As Allosteric Inhibitor Length = 374 Back     alignment and structure
>pdb|1FTA|A Chain A, Fructose-1,6-Bisphosphatase(D-Fructose-1,6-Bisphosphate, 1- Phosphohydrolase) (E.C.3.1.3.11) Complexed With The Allosteric Inhibitor Amp Length = 337 Back     alignment and structure
>pdb|3A29|A Chain A, Crystal Structure Of Human Liver Fbpase In Complex With Tricyclic Inhibitor Length = 337 Back     alignment and structure
>pdb|2FIE|A Chain A, Structure Of Human Liver Fbpase Complexed With Potent Benzoxazole Allosteric Inhibitors Length = 338 Back     alignment and structure
>pdb|1FJ6|A Chain A, Fructose-1,6-Bisphosphatase (Mutant Y57w) ProductZN COMPLEX (R-State) Length = 337 Back     alignment and structure
>pdb|1YXI|A Chain A, R-State Amp Complex Reveals Initial Steps Of The Quaternary Transition Of Fructose-1,6-Bisphosphatase Length = 337 Back     alignment and structure
>pdb|1CNQ|A Chain A, Fructose-1,6-Bisphosphatase Complexed With Fructose-6-Phosphate And Zinc Ions Length = 337 Back     alignment and structure
>pdb|2F3B|A Chain A, Mechanism Of Displacement Of A Catalytically Essential Loop From The Active Site Of Fructose-1,6-bisphosphatase Length = 338 Back     alignment and structure
>pdb|1FSA|A Chain A, The T-State Structure Of Lys 42 To Ala Mutant Of The Pig Kidney Fructose 1,6-Bisphosphatase Expressed In E. Coli Length = 337 Back     alignment and structure
>pdb|1FBP|A Chain A, Crystal Structure Of Fructose-1,6-Bisphosphatase Complexed With Fructose 6-Phosphate, Amp, And Magnesium Length = 335 Back     alignment and structure
>pdb|1RDX|A Chain A, R-State Structure Of The Arg 243 To Ala Mutant Of Pig Kidney Fructose 1,6-Bisphosphatase Expressed In E. Coli Length = 337 Back     alignment and structure
>pdb|1LEV|A Chain A, Porcine Kidney Fructose-1,6-bisphosphatase Complexed With An Amp-site Inhibitor Length = 337 Back     alignment and structure
>pdb|1KZ8|A Chain A, Crystal Structure Of Porcine Fructose-1,6-bisphosphatase Complexed With A Novel Allosteric-site Inhibitor Length = 337 Back     alignment and structure
>pdb|1FRP|A Chain A, Crystal Structure Of Fructose-1,6-Bisphosphatase Complexed With Fructose-2,6-Bisphosphate, Amp And Zn2+ At 2.0 Angstroms Resolution. Aspects Of Synergism Between Inhibitors Length = 335 Back     alignment and structure
>pdb|1DBZ|A Chain A, C153s Mutant Of Pea Fructose-1,6-Bisphosphatase Length = 357 Back     alignment and structure
>pdb|1D9Q|A Chain A, Oxidized Pea Fructose-1,6-Bisphosphatase Form 1 Length = 357 Back     alignment and structure
>pdb|1SPI|A Chain A, Crystal Structure Of Spinach Chloroplast Fructose-1,6- Bisphosphatase At 2.8 Angstroms Resolution Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
2gq1_A 332 Fructose-1,6-bisphosphatase; allosteric activator 2e-14
2fhy_A 374 Fructose-1,6-bisphosphatase 1; allosteric inhibito 6e-14
1nuw_A 337 Fructose-1,6-bisphosphatase; allosteric enzymes, g 6e-14
1dcu_A 357 Fructose-1,6-bisphosphatase; chloroplast, photosyn 9e-14
3uks_A 347 Sedoheptulose-1,7 bisphosphatase, putative; struct 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolas; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Length = 332 Back     alignment and structure
 Score = 73.5 bits (181), Expect = 2e-14
 Identities = 14/53 (26%), Positives = 23/53 (43%)

Query: 430 ANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIH 482
            +    +   NVQGE  +KLD+ +NE     L +      + SEE +  +   
Sbjct: 46  VDILGASGAENVQGEVQQKLDLFANEKLKAALKARDIVAGIASEEEDEIVVFE 98
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Length = 374 Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrola; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Length = 337 Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Length = 357 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.47
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.47
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.45
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.41
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.4
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.4
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.39
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.39
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.37
1dcu_A 357 Fructose-1,6-bisphosphatase; chloroplast, photosyn 99.36
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.35
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.34
2fhy_A 374 Fructose-1,6-bisphosphatase 1; allosteric inhibito 99.33
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.33
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.31
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.29
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.28
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.28
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.28
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.27
3uks_A 347 Sedoheptulose-1,7 bisphosphatase, putative; struct 99.26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
3u4t_A272 TPR repeat-containing protein; structural genomics 99.21
3u4t_A272 TPR repeat-containing protein; structural genomics 99.21
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.18
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.18
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.17
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.17
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.16
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.14
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.12
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.12
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.1
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.04
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.0
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.99
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.99
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.96
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.95
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.92
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.92
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.9
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.89
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.88
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.85
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.84
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.82
2gq1_A 332 Fructose-1,6-bisphosphatase; allosteric activator 98.82
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.8
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.78
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.77
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.74
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.72
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.71
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.71
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.69
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.67
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.66
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.66
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.66
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.64
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.63
1nuw_A 337 Fructose-1,6-bisphosphatase; allosteric enzymes, g 98.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.62
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.61
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.61
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.58
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.57
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.53
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.49
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.46
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.46
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.46
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.45
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.42
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.41
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.37
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.36
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.34
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.33
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.31
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.3
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.28
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.24
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.24
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.24
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.24
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.19
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.19
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.17
3k9i_A117 BH0479 protein; putative protein binding protein, 98.14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.03
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.02
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.01
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.98
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.93
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.93
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.91
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.9
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.88
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.88
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.88
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.82
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.79
3k9i_A117 BH0479 protein; putative protein binding protein, 97.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.65
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.61
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.28
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.27
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.26
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.22
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.21
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.17
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.13
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.12
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.94
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.93
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.88
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.88
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.68
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.62
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.38
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.14
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.1
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.05
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 95.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.79
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.62
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.5
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.36
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.3
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.29
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 94.68
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 94.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 94.37
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.9
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 93.61
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.14
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 93.1
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 92.09
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.08
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 91.94
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.14
1klx_A138 Cysteine rich protein B; structural genomics, heli 88.8
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.8
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.98
1pc2_A152 Mitochondria fission protein; unknown function; NM 86.16
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 85.8
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 85.73
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 84.73
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 84.68
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.44
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 82.45
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.82
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.71
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=99.47  E-value=7.1e-12  Score=123.96  Aligned_cols=132  Identities=17%  Similarity=0.093  Sum_probs=75.5

Q ss_pred             CChHHHHHHHHHHHhhhcccccCCccceehhhcccCcchhhhHHHhhcCCCCccHHHHHHHHHHHHHhCCcchhHHHHHH
Q psy7457           9 ENPQEYYSLLNLVLSQHSIQVINPDESRYILSRVRTPKKIEHILIQRGLSKDTILDNRARRLRLCDEIGLKNRGFVLAGY   88 (497)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~r~~~~~~~~~~~~~~~~~~p~n~~~~~~RA~Ly~elG~~~~~~Al~~y   88 (497)
                      .+|..|..++.+.+.+     ..+++|+-.+.+++..             +|.+...+..++.+|.+.|++.  +|++.|
T Consensus        31 ~~~~~~~~l~~~~~~~-----~~~~~a~~~~~~a~~~-------------~p~~~~~~~~lg~~~~~~g~~~--~A~~~~   90 (388)
T 1w3b_A           31 DNTGVLLLLSSIHFQC-----RRLDRSAHFSTLAIKQ-------------NPLLAEAYSNLGNVYKERGQLQ--EAIEHY   90 (388)
T ss_dssp             TCHHHHHHHHHHHHHT-----TCHHHHHHHHHHHHHH-------------CTTCHHHHHHHHHHHHHHTCHH--HHHHHH
T ss_pred             CCHHHHHHHHHHHHHc-----CCHHHHHHHHHHHHhc-------------CCCchHHHHHHHHHHHHCCCHH--HHHHHH
Confidence            4555665555544332     3445566666555542             5555666666666666666666  666666


Q ss_pred             HHHHhccCCCCChhhHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHccCCCChhHHHHHHHHHHhhccHHHHHHHHHHhc
Q psy7457          89 QRYLKNITPDSDPQTILDLSTRAAHVYHTARNFPQAASSLAIAFQYSAHLIRPEHCNLYLEVLLELKRYETCVEVLRRFA  168 (497)
Q Consensus        89 ~~il~~~~P~d~~~~~~~~~k~LA~~Y~e~~~~~~Ai~~le~a~~~~~~~f~~~~vNiLaEL~i~~k~y~~al~~I~~~~  168 (497)
                      +++++. .|.+.     +....+|..|...|+.++|++.|++++...|+.  ..-.+.++.++...|+|++|++.+++..
T Consensus        91 ~~al~~-~p~~~-----~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~--~~~~~~l~~~~~~~g~~~~A~~~~~~al  162 (388)
T 1w3b_A           91 RHALRL-KPDFI-----DGYINLAAALVAAGDMEGAVQAYVSALQYNPDL--YCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHH-CTTCH-----HHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC--THHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             HHHHHc-CcchH-----HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCc--HHHHHHHHHHHHHccCHHHHHHHHHHHH
Confidence            666666 55542     344556666666666666666666666666543  2334455566666666666666655543
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolas; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrola; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 497
d1nuwa_ 328 e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus 2e-10
d1d9qa_ 340 e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden p 3e-09
>d1nuwa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 328 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Fructose-1,6-bisphosphatase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 60.0 bits (145), Expect = 2e-10
 Identities = 25/51 (49%), Positives = 41/51 (80%)

Query: 435 LTSNVNVQGEEVKKLDVLSNELFVNMLTSSYSTCLLVSEENETALEIHHQE 485
           +  + NV G++VKKLDVLSN+L +N+L SS++TC+LVSEE++ A+ +  ++
Sbjct: 52  IAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEK 102
>d1d9qa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
d1nuwa_ 328 Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [Tax 99.49
d1d9qa_ 340 Fructose-1,6-bisphosphatase {Garden pea (Pisum sat 99.41
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.41
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.32
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.23
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.67
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.41
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.33
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.31
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.28
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.26
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.2
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.19
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.18
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.17
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.96
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.84
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.8
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.78
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.64
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.45
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.43
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.38
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.35
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.27
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.18
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.15
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.9
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.65
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.41
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.37
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.74
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.63
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.48
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 94.06
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.91
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.36
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 83.16
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 82.41
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 80.08
>d1nuwa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Fructose-1,6-bisphosphatase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.49  E-value=5.4e-15  Score=148.58  Aligned_cols=91  Identities=34%  Similarity=0.548  Sum_probs=77.3

Q ss_pred             CCccchhHHHHHhhhcCCCCccc--cccc------------------ccccccccCcCCcchhhhhhhhhhhHHHHHHhc
Q psy7457         403 SSDIRIVRNTLRTFQSKPNNLGL--NVMY------------------ANNCNLTSNVNVQGEEVKKLDVLSNELFVNMLT  462 (497)
Q Consensus       403 t~~iTL~rfLl~~~~~~p~~~~~--~LL~------------------~~~~g~aGs~N~~GE~QkkLDV~Anelf~~aL~  462 (497)
                      |+.+||++|+++++.+.+ .+++  .+|.                  .+..|.+|+.|++||.|++||+++|++|.++|+
T Consensus         1 t~~~TL~~fl~~~~~~~~-~~~dl~~ll~~I~~A~k~Ia~~Ir~a~l~~~~G~ag~~N~~Gd~q~~LDv~an~~~~~~l~   79 (328)
T d1nuwa_           1 TNIVTLTRFVMEEGRKAR-GTGEMTQLLNSLCTAVKAISTAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVINVLK   79 (328)
T ss_dssp             CCCCBHHHHHHHHHHHSC-SCTHHHHHHHHHHHHHHHHHHHHHTTTTTTCCSEEEEECTTSCEEEHHHHHHHHHHHHHHH
T ss_pred             CCeEeHHHHHHhhcccCC-CchHHHHHHHHHHHHHHHHHHHHhhccccccccccCcccCCccHHHHHHHHHHHHHHHHHh
Confidence            578999999999877644 4554  4444                  355778899999999999999999999999999


Q ss_pred             cccCeeEEecCCCCceeecCCCCCCCCCeEEEec
Q psy7457         463 SSYSTCLLVSEENETALEIHHQEASTGDPCVRLD  496 (497)
Q Consensus       463 ~s~~Va~~aSEE~e~~i~v~~~~~~~G~Y~V~fD  496 (497)
                      +++.|++++|||+|+++.+++  .++|+|+|+||
T Consensus        80 ~~~~v~~~~SEE~e~~~~~~~--~~~g~y~V~fD  111 (328)
T d1nuwa_          80 SSFATCVLVSEEDKNAIIVEP--EKRGKYVVCFD  111 (328)
T ss_dssp             HTTCEEEEEETTCSSCEECCG--GGEEEEEEEEE
T ss_pred             hCCceEEEeecccCcceeecC--CCCceEEEEEe
Confidence            999999999999999998863  23689999999
>d1d9qa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure