Psyllid ID: psy7460
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1026 | ||||||
| 358339354 | 603 | cathepsin F [Clonorchis sinensis] | 0.526 | 0.895 | 0.312 | 3e-78 | |
| 391333248 | 642 | PREDICTED: uncharacterized protein LOC10 | 0.601 | 0.961 | 0.272 | 9e-62 | |
| 357619726 | 1118 | cathepsin [Danaus plexippus] | 0.375 | 0.344 | 0.353 | 4e-54 | |
| 358339355 | 1157 | cathepsin F [Clonorchis sinensis] | 0.473 | 0.420 | 0.289 | 6e-50 | |
| 67773380 | 322 | cysteine protease 9 [Paragonimus westerm | 0.276 | 0.881 | 0.380 | 2e-46 | |
| 156546466 | 1036 | PREDICTED: hypothetical protein LOC10012 | 0.284 | 0.281 | 0.362 | 3e-46 | |
| 244790097 | 586 | cathepsin F isoform 2 precursor [Acyrtho | 0.295 | 0.517 | 0.353 | 6e-46 | |
| 67773374 | 325 | cysteine protease 6 [Paragonimus westerm | 0.273 | 0.864 | 0.357 | 2e-45 | |
| 67773370 | 321 | cysteine protease 3 [Paragonimus westerm | 0.277 | 0.887 | 0.371 | 3e-45 | |
| 242014216 | 434 | Cathepsin F precursor, putative [Pedicul | 0.295 | 0.698 | 0.340 | 5e-45 |
| >gi|358339354|dbj|GAA47434.1| cathepsin F [Clonorchis sinensis] | Back alignment and taxonomy information |
|---|
Score = 300 bits (767), Expect = 3e-78, Method: Compositional matrix adjust.
Identities = 188/601 (31%), Positives = 293/601 (48%), Gaps = 61/601 (10%)
Query: 13 DAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSG 72
D +DWR+ GP +Q CGSCWAFS G +EGQ+ +K+G+L+ S Q+++C G
Sbjct: 41 DNFDWRQHGAVGPVWNQGPCGSCWAFSAVGNIEGQWFLKSGELLHLSVQQVLDCDHVDHG 100
Query: 73 CDGCFFEPSI--EYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSE 130
C+G + P + + GL+ + DY YK A G KC D+SK + + + +
Sbjct: 101 CNGGY-PPQVYRQVNQMGGLQLDADYSYKAAVG---KCHTDRSKFRAYVNSSVILSQNEQ 156
Query: 131 TMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWL 190
L GPL+ LN+ + Y + C+P L HAVL VGYG + +PYW+
Sbjct: 157 FQANKLKTIGPLASTLNARTLQFYRKGIMHPTPSACNPGQLNHAVLTVGYGTEQGMPYWI 216
Query: 191 VRNSWGPIGPDEGFFKIERG--NNACGIEQIAGYATIDVVIQRL----VLEKKAIMLIQA 244
V+NSW GF + R + I G++ + + +L +LE K++ L ++
Sbjct: 217 VKNSW-----SRGFGEQVRAIWQHLRSRASIMGWSNLALKALQLQGDHLLENKSMKLFRS 271
Query: 245 VFLLCGVASC----LCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRG 300
+L+ ++ C L L L R T T + EN + ++ F K
Sbjct: 272 RYLMMRISICYLFTLELWCLCARTT----------------TPEPENARQLYEEFKQKYK 315
Query: 301 RQYANDEEIKERFEYFKQDGHKKHE---------RYGTSEFSDRSPEEILCK-TGFKWSE 350
+ Y ND++ + RF FK++ + H+ YG ++F D + +E + GFK+ +
Sbjct: 316 KTYVNDDD-EYRFSVFKENLLRAHQLQTMEQGTAEYGVTQFFDLTSQEFQIQYLGFKYED 374
Query: 351 RTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLE 410
+ D E++ V + D++DWR GP DQ CGSCWAFS G +E
Sbjct: 375 ------MQDTEEMSPSTRVVMDE----DSFDWRDHGAVGPVLDQGKCGSCWAFSTIGNIE 424
Query: 411 GQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGE 470
GQ+ +KTG+L+ S+ QL++C GC G + GLE DYPY+
Sbjct: 425 GQWFLKTGELLSLSEQQLIDCDNVDEGCNGGYPPKTYGAVIKMGGLELNSDYPYK---AL 481
Query: 471 KFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDE 530
KC D+ K+K++ ++ + L GPLS LN++ + FY +
Sbjct: 482 AEKCHMDRQKLKVYINDSVVFPRNEHLQAEALKLMGPLSSALNANPLKFYKTGIMHLPVA 541
Query: 531 TCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYAT 590
+C P L HAVL VGYG ++ +PYW +NSWG ++G+F+I RG CGI ++ A
Sbjct: 542 SCFPRALNHAVLTVGYGTENGLPYWTVKNSWGTAFGEDGYFRIYRGGGTCGINRLVSTAA 601
Query: 591 I 591
I
Sbjct: 602 I 602
|
Source: Clonorchis sinensis Species: Clonorchis sinensis Genus: Clonorchis Family: Opisthorchiidae Order: Opisthorchiida Class: Trematoda Phylum: Platyhelminthes Superkingdom: Eukaryota |
| >gi|391333248|ref|XP_003741031.1| PREDICTED: uncharacterized protein LOC100898636 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|357619726|gb|EHJ72185.1| cathepsin [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|358339355|dbj|GAA47435.1| cathepsin F [Clonorchis sinensis] | Back alignment and taxonomy information |
|---|
| >gi|67773380|gb|AAY81947.1| cysteine protease 9 [Paragonimus westermani] | Back alignment and taxonomy information |
|---|
| >gi|156546466|ref|XP_001607324.1| PREDICTED: hypothetical protein LOC100123649 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|244790097|ref|NP_001156454.1| cathepsin F isoform 2 precursor [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|67773374|gb|AAY81944.1| cysteine protease 6 [Paragonimus westermani] | Back alignment and taxonomy information |
|---|
| >gi|67773370|gb|AAY81942.1| cysteine protease 3 [Paragonimus westermani] | Back alignment and taxonomy information |
|---|
| >gi|242014216|ref|XP_002427787.1| Cathepsin F precursor, putative [Pediculus humanus corporis] gi|212512256|gb|EEB15049.1| Cathepsin F precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1026 | ||||||
| WB|WBGene00007055 | 477 | tag-196 [Caenorhabditis elegan | 0.288 | 0.620 | 0.324 | 1.9e-42 | |
| FB|FBgn0260462 | 614 | CG12163 [Drosophila melanogast | 0.285 | 0.477 | 0.337 | 8.5e-42 | |
| UNIPROTKB|F1MHV4 | 375 | CTSW "Uncharacterized protein" | 0.241 | 0.661 | 0.325 | 1.7e-41 | |
| UNIPROTKB|E2RPX3 | 374 | CTSW "Uncharacterized protein" | 0.251 | 0.689 | 0.301 | 6.4e-41 | |
| RGD|1309354 | 371 | Ctsw "cathepsin W" [Rattus nor | 0.293 | 0.811 | 0.299 | 3.3e-33 | |
| ZFIN|ZDB-GENE-030131-9831 | 473 | ctsf "cathepsin F" [Danio reri | 0.288 | 0.625 | 0.3 | 2.5e-39 | |
| UNIPROTKB|F1RU48 | 460 | CTSF "Uncharacterized protein" | 0.277 | 0.619 | 0.324 | 1.1e-38 | |
| UNIPROTKB|E2RR02 | 460 | CTSF "Uncharacterized protein" | 0.342 | 0.763 | 0.297 | 8.6e-39 | |
| UNIPROTKB|G1M0X4 | 337 | CTSH "Uncharacterized protein" | 0.270 | 0.824 | 0.350 | 8.6e-39 | |
| UNIPROTKB|Q3T0I2 | 335 | CTSH "Pro-cathepsin H" [Bos ta | 0.275 | 0.844 | 0.342 | 1e-37 |
| WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 459 (166.6 bits), Expect = 1.9e-42, P = 1.9e-42
Identities = 103/317 (32%), Positives = 160/317 (50%)
Query: 288 ILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH-----KKHER----YGTSEFSDRSPE 338
I +F F+ + ++Y N E+ +RF FK++ +K+E+ YG ++FSD +
Sbjct: 170 IWNSFLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGTAVYGFTKFSDMTTM 229
Query: 339 EIL-CKTGFKWSERTYERIVADRXXXXXXXXXXXXDGPVPDAWDWRKKNVTGPAGDQAAC 397
E ++W + Y A+ + +P+++DWR+K +Q C
Sbjct: 230 EFKKIMLPYQWEQPVYPMEQAN----FEKHDVTINEEDLPESFDWREKGAVTQVKNQGNC 285
Query: 398 GSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPI--EYTHQAG 455
GSCWAFS G +EG + I KLV S+ +LV+C GC G GL E G
Sbjct: 286 GSCWAFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNG--GLPSNAYKEIIRMGG 343
Query: 456 LESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSH 515
LE E YPY +G GE C + + ++ + M+K L GP+S+GLN++
Sbjct: 344 LEPEDAYPY-DGRGET--CHLVRKDIAVYINGSVELPHDEVEMQKWLVTKGPISIGLNAN 400
Query: 516 LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIER 575
+ FY + C P+ L H VL+VGYGK PYW+ +NSWGP + G+FK+ R
Sbjct: 401 TLQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKDGRKPYWIVKNSWGPNWGEAGYFKLYR 460
Query: 576 GNNACGIEQIAGYATID 592
G N CG++++A A ++
Sbjct: 461 GKNVCGVQEMATSALVN 477
|
|
| FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MHV4 CTSW "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RPX3 CTSW "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1309354 Ctsw "cathepsin W" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9831 ctsf "cathepsin F" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G1M0X4 CTSH "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0I2 CTSH "Pro-cathepsin H" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1026 | |||
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 6e-67 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-66 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 2e-66 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 4e-66 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 6e-66 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 2e-63 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 1e-48 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-48 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 1e-45 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 7e-40 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 8e-40 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 1e-36 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-36 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 1e-35 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-35 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 2e-35 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 2e-35 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 3e-33 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 7e-33 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-31 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 3e-30 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 5e-30 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 6e-30 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 4e-29 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 2e-28 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 2e-28 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 4e-28 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 7e-21 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-19 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 5e-19 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 3e-18 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 4e-18 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 4e-17 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 4e-17 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 5e-17 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 1e-15 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 3e-12 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 4e-08 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 6e-08 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 6e-08 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 8e-08 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-07 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 3e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 6e-06 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 2e-05 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 2e-05 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 2e-05 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 2e-05 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 5e-05 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 5e-05 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 5e-05 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 1e-04 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 4e-04 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 4e-04 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 5e-04 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 0.003 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
Score = 222 bits (569), Expect = 6e-67
Identities = 95/215 (44%), Positives = 124/215 (57%), Gaps = 8/215 (3%)
Query: 12 PDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS 71
P++ DWR+K P DQ CGSCWAFS G LEG YAIKTGKLV S+ QLV+C+ +
Sbjct: 1 PESVDWREKGAVTPVKDQGSCGSCWAFSTVGALEGAYAIKTGKLVSLSEQQLVDCSTSGN 60
Query: 72 -GCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLF-TGKDFLHFNGS 129
GC+G + + EY GL SE DYPY +G C Y+ SKV TG +
Sbjct: 61 NGCNGGNPDNAFEYVKNGGLASESDYPYTGKDG---TCKYNSSKVGAKITGYSNVPPGDE 117
Query: 130 ETMKKILYKYGPLSVLLN-SDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPY 188
E +K L YGP+SV ++ S Y G + CS +L HAVLLVGYG ++ + Y
Sbjct: 118 EALKAALANYGPVSVAIDASSSFQFYKGGIY--SGPCCSNTNLNHAVLLVGYGTENGVDY 175
Query: 189 WLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYA 223
W+V+NSWG ++G+ +I RG+N CGI A Y
Sbjct: 176 WIVKNSWGTSWGEKGYIRIARGSNLCGIASYASYP 210
|
Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1026 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| KOG1542|consensus | 372 | 100.0 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| KOG1543|consensus | 325 | 100.0 | ||
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| KOG1544|consensus | 470 | 100.0 | ||
| KOG1544|consensus | 470 | 100.0 | ||
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.95 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.88 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.76 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.76 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.31 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.22 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 99.09 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 99.05 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 98.71 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 98.68 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 98.25 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 97.7 | |
| KOG4128|consensus | 457 | 95.3 | ||
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 95.25 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 94.15 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 93.52 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 91.9 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-78 Score=638.65 Aligned_cols=291 Identities=41% Similarity=0.796 Sum_probs=256.9
Q ss_pred HHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc---------CCCcccccccCCCCCHHHHh-hhcCCCCCccchhhh
Q psy7460 287 NILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH---------KKHERYGTSEFSDRSPEEIL-CKTGFKWSERTYERI 356 (1026)
Q Consensus 287 ~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~---------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~~~~~~~ 356 (1026)
...++|..|+.+|+|+|.+.+|..+|+.||+.|+. .+++.||+|+|||||+|||+ .+++.+........
T Consensus 66 ~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~- 144 (372)
T KOG1542|consen 66 GLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPG- 144 (372)
T ss_pred chHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCcc-
Confidence 34899999999999999999999999999999952 34889999999999999999 66665542111100
Q ss_pred hhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCCCccCCHHHHHhhhcCCC
Q psy7460 357 VADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS 436 (1026)
Q Consensus 357 ~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~~~~lS~q~lvdC~~~~~ 436 (1026)
+... .+......||++||||++|+||||||||.||||||||+|+++|++++|++|++++|||||||||+..++
T Consensus 145 --~~~~-----~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d~ 217 (372)
T KOG1542|consen 145 --DAAE-----APIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCDN 217 (372)
T ss_pred --cccc-----CcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcCC
Confidence 0000 011345789999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCc-hHHHH-HHhCCcCCCCCCcccCCCCCccccccCCCCceeeecceeEecC-CHHHHHHHHHcCCCEEEEEe
Q psy7460 437 GCGGCDGLE-QPIEY-THQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFN-GSETMKKILYKYGPLSVGLN 513 (1026)
Q Consensus 437 gC~G~~G~~-~a~~~-~~~~Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~gPv~v~i~ 513 (1026)
||+| |++ +||+| ++.+||..|.+|||+++++. .|.+++.+.++ .+.+|..++ +|++|.+.|.++|||+|+|+
T Consensus 218 gC~G--Gl~~nA~~~~~~~gGL~~E~dYPY~g~~~~--~C~~~~~~~~v-~I~~f~~l~~nE~~ia~wLv~~GPi~vgiN 292 (372)
T KOG1542|consen 218 GCNG--GLMDNAFKYIKKAGGLEKEKDYPYTGKKGN--QCHFDKSKIVV-SIKDFSMLSNNEDQIAAWLVTFGPLSVGIN 292 (372)
T ss_pred cCCC--CChhHHHHHHHHhCCccccccCCccccCCC--ccccchhhceE-EEeccEecCCCHHHHHHHHHhcCCeEEEEc
Confidence 9999 999 99999 68899999999999998874 79999887776 556666655 99999999999999999999
Q ss_pred cCccccccCCceeCCCCCCCCCCCCeEEEEEEeeecC-CccEEEEEcCCCCCCCCCcEEEEEecCCcccccceeeeeE
Q psy7460 514 SHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQD-DIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYAT 590 (1026)
Q Consensus 514 ~~~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~~-g~~YWivkNSWG~~WGe~Gy~ri~r~~n~cgi~~~~~~~~ 590 (1026)
+..+|+|++||+.|....|++..+||||||||||.+. .+||||||||||++|||+||+|+.||.|.|||+++++-+.
T Consensus 293 a~~mQ~YrgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~ 370 (372)
T KOG1542|consen 293 AKPMQFYRGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAA 370 (372)
T ss_pred hHHHHHhcccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhh
Confidence 9899999999998777799998899999999999988 8999999999999999999999999999999999987654
|
|
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1026 | ||||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 1e-34 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 8e-34 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 4e-13 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 1e-33 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 7e-12 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 1e-33 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 2e-33 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 8e-09 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 3e-33 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 4e-33 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 1e-08 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 6e-33 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 7e-33 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 6e-09 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 9e-33 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 1e-32 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 1e-08 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 1e-32 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 1e-32 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 1e-08 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 1e-32 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 2e-32 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 2e-09 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 3e-32 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 3e-32 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 8e-09 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 6e-32 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 7e-32 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-08 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 7e-32 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 8e-32 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 9e-09 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 3e-31 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 4e-09 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 1e-30 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 1e-30 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 2e-08 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-30 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-30 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 1e-08 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 8e-30 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 9e-30 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 1e-07 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 8e-30 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 1e-29 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 4e-08 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 1e-29 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-29 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-08 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 1e-28 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 6e-28 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 4e-06 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 1e-28 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 6e-28 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 4e-06 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 1e-28 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 7e-28 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 4e-06 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 2e-28 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 6e-28 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 5e-06 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 2e-28 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 7e-28 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 4e-06 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 2e-28 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 7e-28 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 4e-06 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 2e-28 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-27 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-05 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 5e-28 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 3e-27 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 4e-06 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 7e-28 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 4e-27 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 3e-06 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 1e-27 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 4e-27 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 1e-05 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 2e-27 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 7e-27 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 4e-06 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-27 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-27 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-06 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 2e-27 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 7e-27 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 4e-06 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 2e-27 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 7e-27 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 4e-06 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 2e-27 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 2e-27 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 2e-06 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 2e-27 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 3e-27 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 2e-06 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 3e-27 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 3e-27 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 2e-06 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-26 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-26 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-06 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-26 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-26 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-06 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-26 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-26 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 1e-06 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 3e-26 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 3e-26 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 2e-06 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 9e-26 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 1e-25 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 3e-04 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 1e-25 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 1e-25 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 3e-06 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-25 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-25 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 7e-07 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 1e-25 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-25 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 1e-04 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 3e-25 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 4e-25 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 4e-08 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 5e-25 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 5e-25 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 6e-08 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 8e-25 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 9e-25 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 6e-07 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 1e-24 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 9e-09 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 1e-24 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 1e-24 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 7e-08 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 1e-24 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 1e-24 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 7e-08 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 1e-24 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 1e-08 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 1e-24 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 2e-24 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 3e-24 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 4e-05 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 3e-24 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 4e-24 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-05 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 9e-24 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-23 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 5e-07 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 2e-23 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-23 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 3e-23 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-05 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 3e-23 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 3e-23 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 7e-07 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 4e-23 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 1e-22 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 2e-22 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 3e-22 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 1e-04 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 4e-22 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 7e-22 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 1e-05 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 9e-22 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 7e-21 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 1e-21 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 6e-04 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 2e-21 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 5e-21 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-05 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-20 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 2e-20 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 9e-20 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 2e-19 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 2e-19 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 3e-19 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 3e-19 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 3e-19 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 5e-05 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 9e-19 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 9e-19 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 2e-18 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 2e-18 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 3e-18 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 4e-18 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 4e-18 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 7e-18 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 3e-17 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 4e-17 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 4e-17 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 5e-17 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 6e-07 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 6e-17 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 6e-17 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 6e-07 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 6e-17 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 6e-07 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 5e-16 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 5e-16 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 1e-06 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-15 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-09 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-15 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-09 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 5e-15 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 9e-15 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 1e-14 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 4e-14 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 4e-09 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 9e-14 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 1e-13 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 2e-08 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 1e-13 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 1e-13 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 2e-08 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 1e-13 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 2e-08 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 1e-13 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 2e-08 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 1e-12 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 1e-12 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 2e-08 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 2e-12 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 2e-12 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 8e-11 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 3e-08 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 5e-10 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 9e-10 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 5e-08 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 5e-09 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 5e-09 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 6e-09 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-08 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-08 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-08 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 3e-08 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 3e-08 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 5e-08 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 4e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 1e-04 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 4e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 1e-04 |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
|
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1026 | |||
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 1e-68 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 2e-67 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 3e-59 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 2e-19 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-68 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 5e-68 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 9e-60 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-17 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-68 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-67 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 4e-59 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-18 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 2e-67 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 3e-67 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 4e-67 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 2e-22 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 2e-66 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 5e-66 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 4e-59 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 9e-18 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 2e-66 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 8e-66 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 6e-58 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 2e-17 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 3e-64 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 3e-64 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 1e-63 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 6e-21 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 6e-64 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 2e-62 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 2e-54 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 7e-16 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 5e-63 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 2e-62 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 7e-54 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 1e-14 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 5e-63 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 2e-62 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 9e-55 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 6e-16 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 2e-61 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 3e-61 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 8e-60 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 3e-20 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 8e-60 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 5e-59 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 2e-55 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 2e-19 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 1e-58 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 4e-58 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 6e-58 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 3e-17 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 2e-58 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 3e-58 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 1e-57 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 3e-18 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 1e-57 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 2e-57 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 4e-57 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 1e-18 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 1e-56 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 2e-55 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 5e-55 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 7e-21 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 3e-56 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 1e-54 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 2e-54 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 2e-16 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 6e-56 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 7e-56 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 7e-55 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 5e-16 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 6e-55 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 3e-54 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 4e-54 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 1e-16 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 1e-54 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 3e-54 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 4e-54 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 1e-14 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 2e-54 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 1e-53 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 1e-53 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 5e-14 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 2e-54 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 3e-54 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 3e-53 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 8e-15 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 6e-54 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 7e-54 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 4e-53 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 5e-14 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 2e-53 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 5e-53 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 2e-52 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-53 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 3e-53 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-52 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-15 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 3e-53 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 3e-53 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 1e-52 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 7e-15 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 4e-53 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 4e-53 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 3e-52 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 2e-13 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 1e-52 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 1e-52 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 9e-52 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 6e-14 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 4e-52 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 1e-51 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 1e-51 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 3e-14 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 4e-51 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 4e-51 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 5e-51 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 4e-15 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 5e-51 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 6e-51 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 1e-50 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 2e-18 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 1e-50 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 1e-50 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 3e-49 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 4e-10 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 2e-49 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 2e-49 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 8e-49 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 3e-21 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 2e-49 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 2e-49 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 2e-49 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 3e-13 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-49 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 6e-49 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-48 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-20 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 2e-49 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 3e-49 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 4e-49 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 5e-22 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 3e-49 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 4e-49 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 5e-49 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 1e-13 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 3e-48 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 3e-48 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 6e-47 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 2e-10 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 2e-46 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 3e-45 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 6e-45 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 3e-12 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 1e-07 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 2e-07 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 4e-06 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 1e-05 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 1e-05 |
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
Score = 231 bits (591), Expect = 1e-68
Identities = 63/320 (19%), Positives = 116/320 (36%), Gaps = 27/320 (8%)
Query: 653 NILETFKAFIVKRGRQYANDEEIKERFEYFKQ-----DGHKKHERYGTSEFSDRSPEEIL 707
+ ++TF+ + + YA E+ + + F + + + SD S +E
Sbjct: 3 SSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG----AINHLSDLSLDEFK 58
Query: 708 CK-TGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSC 766
+ + + + + +G P D R+ P Q CGS
Sbjct: 59 NRFLMSAEAFEHLKT----QFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSA 114
Query: 767 WAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKD 826
WAFS E Y + ++ ++ +LV+CA Q GC G IEY G+ E
Sbjct: 115 WAFSGVAATESAYLAYRDQSLDLAEQELVDCASQ-HGCHGDTIPRGIEYIQHNGVVQESY 173
Query: 827 YPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYK-YGPLSVLLNSDLIHD- 884
Y Y C ++ + ++ + +++ L + + ++V++ +
Sbjct: 174 YRYVAREQ---SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAF 230
Query: 885 --YNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGN 942
Y+G I HAV +VGY + YW+VRNSW D G+
Sbjct: 231 RHYDGRTI--IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANI 288
Query: 943 NACGIEQIAGYATIDVVKND 962
+ I Y + ++
Sbjct: 289 DLMM---IEEYPYVVILGQT 305
|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1026 | |||
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 100.0 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.97 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.96 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 99.29 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 99.24 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 99.14 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 99.1 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 96.98 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 96.73 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 96.66 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 95.68 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 95.41 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 95.14 |
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=3e-70 Score=612.74 Aligned_cols=297 Identities=30% Similarity=0.595 Sum_probs=251.8
Q ss_pred ChhHHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc------------CCCcccccccCCCCCHHHHh-hhcCCCCCc
Q psy7460 284 DNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH------------KKHERYGTSEFSDRSPEEIL-CKTGFKWSE 350 (1026)
Q Consensus 284 ~~~~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~------------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~ 350 (1026)
.++.+..+|++||++|+|.|.+.+|+.+|++||++|++ ..++++|+|+|+|||.|||+ .+++.+.+.
T Consensus 14 ~~~~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~~~~~~~~ 93 (331)
T 3qj3_A 14 PSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEMKAYTHGLIMPA 93 (331)
T ss_dssp CHHHHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHHHHHHSCCCCCS
T ss_pred CCHHHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHHHHHhccccccc
Confidence 34567889999999999999999999999999999953 24567899999999999999 677765432
Q ss_pred cchhhhhhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCC--CccCCHHHH
Q psy7460 351 RTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGK--LVEFSKSQL 428 (1026)
Q Consensus 351 ~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~--~~~lS~q~l 428 (1026)
..... ................+||++||||++|+||||||||.||||||||++++||++++|+++. ++.||+|+|
T Consensus 94 ~~~~~---~~~~~~~~~~~~~~~~~lP~s~DwR~~g~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~~~LSeQ~L 170 (331)
T 3qj3_A 94 DLHKN---GIPIKTREDLGLNASVRYPASFDWRDQGMVSPVKNQGSCGSSWAFSSTGAIESQMKIANGAGYDSSVSEQQL 170 (331)
T ss_dssp STTTT---CEEECSGGGGTCCSSCCCCSSEEGGGGTCSCCCCBCCSSCCHHHHHHHHHHHHHHHHHHCTTSCCCBCHHHH
T ss_pred ccccc---CcccccccccccccccCCCcceecccCCccCCCccCcccchhhHHHHHHHHHHHHHHHhCCCcccCcCHHHH
Confidence 11100 0000000000001234799999999999999999999999999999999999999999999 999999999
Q ss_pred HhhhcCCCCCCCCCCCc-hHHHHHHhC-CcCCCCCCcccCCCCCccccccCCCCceeeecceeEecC--CHHHHHHHHHc
Q psy7460 429 VECAKQCSGCGGCDGLE-QPIEYTHQA-GLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFN--GSETMKKILYK 504 (1026)
Q Consensus 429 vdC~~~~~gC~G~~G~~-~a~~~~~~~-Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~ 504 (1026)
+||+..+.||+| |.+ .|++|+.+. ||++|++|||.+.+. .|........ +.+.+|..++ ++++||++|++
T Consensus 171 vdC~~~~~GC~G--G~~~~a~~yi~~~~Gi~~e~~yPY~~~~~---~C~~~~~~~~-~~i~~~~~v~~~~e~~lk~al~~ 244 (331)
T 3qj3_A 171 VDCVPNALGCSG--GWMNDAFTYVAQNGGIDSEGAYPYEMADG---NCHYDPNQVA-ARLSGYVYLSGPDENMLADMVAT 244 (331)
T ss_dssp HHHCTTSCGGGC--CCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCTTSEE-ECCSEEEEESSCCHHHHHHHHHH
T ss_pred hhhccCCCCCCC--CCHHHHHHHHHHcCCcCcccccCccCCCC---CCCCCcccce-eEeeEEEEeCCCCHHHHHHHHHh
Confidence 999987889999 999 999998766 999999999999888 8987765543 4778888775 89999999999
Q ss_pred CCCEEEEEecC-ccccccCCceeCCCCCCCCCCCCeEEEEEEeeecCCccEEEEEcCCCCCCCCCcEEEEEecC-Ccccc
Q psy7460 505 YGPLSVGLNSH-LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGN-NACGI 582 (1026)
Q Consensus 505 ~gPv~v~i~~~-~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~~g~~YWivkNSWG~~WGe~Gy~ri~r~~-n~cgi 582 (1026)
+|||+|+|++. .|++|++|||. .+.|+...++|||+|||||+++|++|||||||||+.|||+|||||+|+. |.|||
T Consensus 245 ~GPV~v~i~a~~~f~~Y~~Gvy~--~~~c~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~GY~~i~r~~~n~CgI 322 (331)
T 3qj3_A 245 KGPVAVAFDADDPFGSYSGGVYY--NPTCETNKFTHAVLIVGYGNENGQDYWLVKNSWGDGWGLDGYFKIARNANNHCGI 322 (331)
T ss_dssp HCCEEEEECCCTTGGGEEEEEEC--CTTCCSSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSSSGGGT
T ss_pred CCCEEEEEEcccccccccCceEe--CCCCCCCcCCEEEEEEEEeccCCceEEEEEcCCCCCcCCCCEEEEEcCCCCccCc
Confidence 99999999995 49999999995 4568777899999999999999999999999999999999999999998 99999
Q ss_pred cceeeeeEE
Q psy7460 583 EQIAGYATI 591 (1026)
Q Consensus 583 ~~~~~~~~~ 591 (1026)
++.++||++
T Consensus 323 ~~~~~~p~v 331 (331)
T 3qj3_A 323 AGVASVPTL 331 (331)
T ss_dssp TTSCEEEEC
T ss_pred CCceeeeeC
Confidence 999999974
|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1026 | ||||
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 9e-49 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-48 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 2e-48 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 9e-17 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 4e-47 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 5e-47 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 1e-46 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 3e-14 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 1e-43 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 3e-43 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 6e-34 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 3e-18 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 2e-43 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 2e-43 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-43 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 2e-15 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 6e-43 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 7e-42 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 9e-42 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 3e-14 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 7e-43 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 9e-43 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 6e-35 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 2e-17 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-42 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 3e-42 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 3e-42 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-15 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-41 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-41 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 5e-40 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-11 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 3e-40 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 4e-40 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 8e-39 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 1e-12 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 7e-40 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 7e-40 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 9e-40 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 4e-15 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-39 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 4e-39 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 6e-39 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 5e-11 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-39 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 2e-39 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 5e-38 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 4e-12 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 4e-39 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 6e-39 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 2e-37 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 2e-10 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 5e-39 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 7e-39 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 1e-38 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-12 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 2e-38 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 2e-38 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 1e-37 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 4e-11 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 6e-38 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 9e-38 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 8e-37 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 2e-37 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 2e-37 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-36 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 7e-11 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 7e-37 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 1e-36 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-35 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-09 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-36 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-36 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 4e-36 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 2e-11 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 4e-35 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 5e-34 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 5e-34 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 7e-13 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 7e-05 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 7e-05 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 1e-04 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 0.001 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 4e-04 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 7e-04 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 7e-04 |
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Cathepsin F species: Human (Homo sapiens) [TaxId: 9606]
Score = 170 bits (431), Expect = 9e-49
Identities = 77/216 (35%), Positives = 113/216 (52%), Gaps = 3/216 (1%)
Query: 377 PDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS 436
P WDWR K DQ CGSCWAFS+ G +EGQ+ + G L+ S+ +L++C K
Sbjct: 2 PPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDK 61
Query: 437 GCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSE 496
C G + GLE+E DY Y G C + K K++ +
Sbjct: 62 ACMGGLPSNAYSAIKNLGGLETEDDYSY---QGHMQSCQFSAEKAKVYIQDSVELSQNEQ 118
Query: 497 TMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWL 556
+ L K GP+SV +N+ + FY R CSP+ + HAVLLVGYG++ D+P+W
Sbjct: 119 KLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWA 178
Query: 557 ARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATID 592
+NSWG ++G++ + RG+ ACG+ +A A +D
Sbjct: 179 IKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD 214
|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1026 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.47 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.43 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.31 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.22 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 95.74 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 94.96 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 90.81 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 89.79 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.7e-65 Score=568.57 Aligned_cols=286 Identities=31% Similarity=0.600 Sum_probs=237.0
Q ss_pred hHHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc------------CCCcccccccCCCCCHHHHh-hhcCCCCCccc
Q psy7460 286 ENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH------------KKHERYGTSEFSDRSPEEIL-CKTGFKWSERT 352 (1026)
Q Consensus 286 ~~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~------------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~~~ 352 (1026)
+.++.+|++||++|+|.|.+ +|+.+|++||++|++ ..++++|+|+|||||.|||+ .+++.+.....
T Consensus 6 ~~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~ 84 (316)
T d1cs8a_ 6 HSLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPR 84 (316)
T ss_dssp GGGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCS
T ss_pred HHHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccccc
Confidence 45678899999999999977 467899999999953 23678899999999999999 55554332211
Q ss_pred hhhhhhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCCCccCCHHHHHhhh
Q psy7460 353 YERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECA 432 (1026)
Q Consensus 353 ~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~~~~lS~q~lvdC~ 432 (1026)
... ........+||++||||++|+|+||||||.||||||||+++++|++++|+++.++.||+|+|+||+
T Consensus 85 ~~~-----------~~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~ 153 (316)
T d1cs8a_ 85 KGK-----------VFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCS 153 (316)
T ss_dssp CCE-----------ECCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHC
T ss_pred cCc-----------cccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhcc
Confidence 110 011133568999999999999999999999999999999999999999999999999999999998
Q ss_pred cC--CCCCCCCCCCc-hHHHHHHhC-CcCCCCCCcccCCCCCccccccCCCCceeeecceeEe-cCCHHHHHHHHHcCCC
Q psy7460 433 KQ--CSGCGGCDGLE-QPIEYTHQA-GLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLY-FNGSETMKKILYKYGP 507 (1026)
Q Consensus 433 ~~--~~gC~G~~G~~-~a~~~~~~~-Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~gP 507 (1026)
.. +.||.| |.+ .|++|+... +++.|.+|||.+... .|......... .+..+.. ..+++.|+++|+++||
T Consensus 154 ~~~~~~~c~g--g~~~~a~~y~~~~g~~~~e~~~~~~~~~~---~~~~~~~~~~~-~~~~~~~~~~~~~~l~~~l~~~gp 227 (316)
T d1cs8a_ 154 GPQGNEGCNG--GLMDYAFQYVQDNGGLDSEESYPYEATEE---SCKYNPKYSVA-NDAGFVDIPKQEKALMKAVATVGP 227 (316)
T ss_dssp GGGTCCGGGC--BCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCGGGEEE-CCCCEEECCSCHHHHHHHHHHHCC
T ss_pred ccccCCCCCC--CchHHHHHHHHhcCccccccccccccccc---ccccccccccc-cccccccccCcHHHHHHHHHHhCC
Confidence 64 567777 888 999998665 478899999998777 66655444333 4444444 4589999999999999
Q ss_pred EEEEEecC--ccccccCCceeCCCCCCCCCCCCeEEEEEEeeec----CCccEEEEEcCCCCCCCCCcEEEEEecC-Ccc
Q psy7460 508 LSVGLNSH--LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQ----DDIPYWLARNSWGPIGPDEGFFKIERGN-NAC 580 (1026)
Q Consensus 508 v~v~i~~~--~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~----~g~~YWivkNSWG~~WGe~Gy~ri~r~~-n~c 580 (1026)
|+|+|++. .|++|++|||. .+.|+...+||||+|||||.+ ++++|||||||||++|||+|||||+|+. |.|
T Consensus 228 v~v~i~~~~~~f~~y~~Gi~~--~~~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~C 305 (316)
T d1cs8a_ 228 ISVAIDAGHESFLFYKEGIYF--EPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHC 305 (316)
T ss_dssp EEEEECCCSHHHHTEEEEEEC--CTTCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGG
T ss_pred eEEEEEeccchhccccCCccc--CCCCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcC
Confidence 99999984 58999999995 567887788999999999965 6899999999999999999999999985 899
Q ss_pred cccceeeeeEE
Q psy7460 581 GIEQIAGYATI 591 (1026)
Q Consensus 581 gi~~~~~~~~~ 591 (1026)
||++.++||++
T Consensus 306 GI~~~~~yP~v 316 (316)
T d1cs8a_ 306 GIASAASYPTV 316 (316)
T ss_dssp GTTTSCEEECC
T ss_pred ccCCeeeeeeC
Confidence 99999999974
|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|