Psyllid ID: psy7460


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------
MLMEVEKDGPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEccEEEccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccEEEEEcccHHHHHHHHHHHHHHHEHHHccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccEEEEEccEEEccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEccEEEccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccEEccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEcccccEEccccccEEEEcc
cEEEccccccccccEEcccccccccccEccccccHHHHHHHHHHHHHHHHHccccccEcHHHHHHHcccccHHHcccHHHHHHHHHHHcEcEccccccccccccccccccccccccEcEEEEEEccccHHHHHHHHHHHccEEEEEcHHHcccccccEEcccccccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEcccccccccccEccccEcHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHcccccccEcHcccHHHHHHHHccccccHcccccEEccccccccccccccccEcEEEEEEccccHHHHHHHHHHHccEEEEEcHHHcccccccEEcccccccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEcccccccccccEccccccHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHcccccHHHcccHHHHHHHHHHHcEcEccccccccccccccccccccccccEcEEEEEEccccHHHHHHHHHHHccEEEEEcHHHcccccccEEcccccccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEEEcccccccccccccccEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEEEcc
mlmevekdgpvpdawdwrkknvtgpagdqadcgscwaFSIAGMLEGQYAIKTGKLVEFSKSQLVECAkqcsgcdgcffepsiEYTHqaglesekdypyknangekfkcaydkskvklftgkdflhfngsETMKKILYkygplsvllnsdlihdyngtpirkndetcspydlGHAVLLVGygkqdnipywlvrnswgpigpdegffkiergnnacgieqiagYATIDVVIQRLVLEKKAIMLIQAVFLLCGVAsclclpsltdritDQVVARVDTLAIegsltfdneNILETFKAFIVKRGRQYANDEEIKERFEYFKqdghkkherygtsefsdrspeeilCKTGFKWSERTYERIVADREKVEKMLMEVEkdgpvpdawdwrkknvtgpagdqaacgscWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAkqcsgcggcdgleqpieythqaglesekdypyrngngekfkcaydkskvklftgkdflyfngSETMKKILYkygplsvglnshlihfyngtpirkndetcspydlGHAVLLVGygkqddipywlarnswgpigpdegffkiergnnacgieqiagYATIDVVIQRLVLEKKAIMLIQAVFLLCGVAsclclpsltdritDQVVARVDTLAIegsltfdneNILETFKAFIVKRGRQYANDEEIKERFEYFKqdghkkherygtsefsdrspeeilCKTGFKWSERTYERIVADREKVEKMLMEVEkdgpvpdawdwrkknvtgpagdqaacgscWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAkqcsgcdgcffepsiEYTHqaglesekdypyknangekfkcaydkskvklftgkdflhfngsETMKKILYkygplsvllnsdlihdyngtpirkndetcspydlGHAVLLVGygkqdnipywlvrnswgpigpdegffkiergnnacgieqiagyatidvvkndetcspydlGHAVLLVGygkqddipywlvrnswgpigpdegffkiergnnacgieqiagyatidv
mlmevekdgpvpdawdWRKKNVTgpagdqadcGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIegsltfdneniLETFKAFIVKRGRQYANDEEIKERFEyfkqdghkkherygtsefsdrspeeilcktgfkwsertyeRIVADREKVEKMLMEVekdgpvpdawdWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIegsltfdneniLETFKAFIVKRGRQYANDEEIKERFEyfkqdghkkherygtsefsdrspeeilcktgfkwsertyeRIVADREKVEKMLMEVekdgpvpdawdWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIeqiagyatidv
MLMEVEKDGPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADRekvekmlmevekDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADRekvekmlmevekDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
*************AWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYF***********************ILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLE**KDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYF***********************ILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATI**
*******DGPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKW************************DGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQ****EKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKW************************DGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
********GPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHK**************PEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHK**************PEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
MLMEVEKDGPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKW********************E*EKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWS*******************E*EKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMEVEKDGPVPDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTxxxxxxxxxxxxxxxxxxxxxGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTxxxxxxxxxxxxxxxxxxxxxGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVVKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1026 2.2.26 [Sep-21-2011]
Q80LP4337 Viral cathepsin OS=Adoxop N/A N/A 0.307 0.934 0.332 4e-43
Q9VN93614 Putative cysteine protein yes N/A 0.315 0.527 0.320 5e-43
Q8V5U0367 Viral cathepsin OS=Heliot N/A N/A 0.278 0.779 0.304 7e-43
Q10716371 Cysteine proteinase 1 OS= N/A N/A 0.277 0.768 0.326 4e-40
Q9UBX1484 Cathepsin F OS=Homo sapie yes N/A 0.307 0.650 0.302 2e-39
O10364324 Viral cathepsin OS=Orgyia N/A N/A 0.274 0.870 0.310 8e-39
Q8QLK1337 Viral cathepsin OS=Mamest N/A N/A 0.305 0.928 0.326 4e-38
P43295361 Probable cysteine protein no N/A 0.306 0.869 0.297 1e-37
P43296368 Cysteine proteinase RD19a no N/A 0.276 0.771 0.327 1e-37
P05167362 Thiol protease aleurain O N/A N/A 0.301 0.853 0.300 1e-37
>sp|Q80LP4|CATV_NPVAH Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function desciption
 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 165/337 (48%), Gaps = 22/337 (6%)

Query: 634 VVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHER- 692
            +  V +  IEG L FD  +    F+ FI+   +QY + +    RF+ FKQ+    +E+ 
Sbjct: 8   TILLVASSQIEGHLKFDIHDAQHYFETFIINYNKQYPDTKTKNYRFKIFKQNLEDINEKN 67

Query: 693 -------YGTSEFSDRSPEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKD--GPVP 743
                  Y  ++FSD S  E+L K     S++    + +       + ++   D    +P
Sbjct: 68  KLNDSAIYNINKFSDLSKNELLTKYTGLTSKKPSNMVRSTSNFCNVIHLDAPPDVHDELP 127

Query: 744 DAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSG 803
             +DWR  N      DQ ACGSCWA +  G LE  YAIK   L+  S+ QL++C      
Sbjct: 128 QNFDWRVNNKMTSVKDQGACGSCWAHAAVGTLETLYAIKHNYLINLSEQQLIDCDSANMA 187

Query: 804 CDGCFFEPSIEYTHQA-GLESEKDYPYKNANGEKFKCAYDKSKVKLFTG--KDFLHFNGS 860
           CDG     + E    A GL  E DYPY+   G K  C  D  K  L     K ++ F   
Sbjct: 188 CDGGLMHTAFEQLMNAGGLMEEIDYPYQ---GTKGVCKIDNKKFALSVSSCKRYI-FQNE 243

Query: 861 ETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYW 920
           E +KK L   GP+++ +++  I  Y+   I      C    L HAVLLVGYG +  + YW
Sbjct: 244 ENLKKELITMGPIAMAIDAASISTYSKGIIH----FCENLGLNHAVLLVGYGTEGGVSYW 299

Query: 921 LVRNSWGPIGPDEGFFKIERGNNACGI-EQIAGYATI 956
            ++NSWG    ++G+F+++R  NACG+  Q+A  ATI
Sbjct: 300 TLKNSWGSDWGEDGYFRVKRNINACGLNNQLAASATI 336




Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system.
Adoxophyes honmai (taxid: 85585)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 5EC: 0
>sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2 Back     alignment and function description
>sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q10716|CYSP1_MAIZE Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBX1|CATF_HUMAN Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1 Back     alignment and function description
>sp|O10364|CATV_NPVOP Viral cathepsin OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q8QLK1|CATV_NPVMC Viral cathepsin OS=Mamestra configurata nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|P43295|A494_ARATH Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2 Back     alignment and function description
>sp|P43296|RD19A_ARATH Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1 Back     alignment and function description
>sp|P05167|ALEU_HORVU Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1026
358339354603 cathepsin F [Clonorchis sinensis] 0.526 0.895 0.312 3e-78
391333248642 PREDICTED: uncharacterized protein LOC10 0.601 0.961 0.272 9e-62
3576197261118 cathepsin [Danaus plexippus] 0.375 0.344 0.353 4e-54
358339355 1157 cathepsin F [Clonorchis sinensis] 0.473 0.420 0.289 6e-50
67773380322 cysteine protease 9 [Paragonimus westerm 0.276 0.881 0.380 2e-46
1565464661036 PREDICTED: hypothetical protein LOC10012 0.284 0.281 0.362 3e-46
244790097586 cathepsin F isoform 2 precursor [Acyrtho 0.295 0.517 0.353 6e-46
67773374325 cysteine protease 6 [Paragonimus westerm 0.273 0.864 0.357 2e-45
67773370321 cysteine protease 3 [Paragonimus westerm 0.277 0.887 0.371 3e-45
242014216434 Cathepsin F precursor, putative [Pedicul 0.295 0.698 0.340 5e-45
>gi|358339354|dbj|GAA47434.1| cathepsin F [Clonorchis sinensis] Back     alignment and taxonomy information
 Score =  300 bits (767), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 188/601 (31%), Positives = 293/601 (48%), Gaps = 61/601 (10%)

Query: 13  DAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSG 72
           D +DWR+    GP  +Q  CGSCWAFS  G +EGQ+ +K+G+L+  S  Q+++C     G
Sbjct: 41  DNFDWRQHGAVGPVWNQGPCGSCWAFSAVGNIEGQWFLKSGELLHLSVQQVLDCDHVDHG 100

Query: 73  CDGCFFEPSI--EYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSE 130
           C+G +  P +  +     GL+ + DY YK A G   KC  D+SK + +     +     +
Sbjct: 101 CNGGY-PPQVYRQVNQMGGLQLDADYSYKAAVG---KCHTDRSKFRAYVNSSVILSQNEQ 156

Query: 131 TMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWL 190
                L   GPL+  LN+  +  Y    +      C+P  L HAVL VGYG +  +PYW+
Sbjct: 157 FQANKLKTIGPLASTLNARTLQFYRKGIMHPTPSACNPGQLNHAVLTVGYGTEQGMPYWI 216

Query: 191 VRNSWGPIGPDEGFFKIERG--NNACGIEQIAGYATIDVVIQRL----VLEKKAIMLIQA 244
           V+NSW       GF +  R    +      I G++ + +   +L    +LE K++ L ++
Sbjct: 217 VKNSW-----SRGFGEQVRAIWQHLRSRASIMGWSNLALKALQLQGDHLLENKSMKLFRS 271

Query: 245 VFLLCGVASC----LCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRG 300
            +L+  ++ C    L L  L  R T                T + EN  + ++ F  K  
Sbjct: 272 RYLMMRISICYLFTLELWCLCARTT----------------TPEPENARQLYEEFKQKYK 315

Query: 301 RQYANDEEIKERFEYFKQDGHKKHE---------RYGTSEFSDRSPEEILCK-TGFKWSE 350
           + Y ND++ + RF  FK++  + H+          YG ++F D + +E   +  GFK+ +
Sbjct: 316 KTYVNDDD-EYRFSVFKENLLRAHQLQTMEQGTAEYGVTQFFDLTSQEFQIQYLGFKYED 374

Query: 351 RTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLE 410
                 + D E++      V  +    D++DWR     GP  DQ  CGSCWAFS  G +E
Sbjct: 375 ------MQDTEEMSPSTRVVMDE----DSFDWRDHGAVGPVLDQGKCGSCWAFSTIGNIE 424

Query: 411 GQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGE 470
           GQ+ +KTG+L+  S+ QL++C     GC G    +         GLE   DYPY+     
Sbjct: 425 GQWFLKTGELLSLSEQQLIDCDNVDEGCNGGYPPKTYGAVIKMGGLELNSDYPYK---AL 481

Query: 471 KFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDE 530
             KC  D+ K+K++     ++        + L   GPLS  LN++ + FY    +     
Sbjct: 482 AEKCHMDRQKLKVYINDSVVFPRNEHLQAEALKLMGPLSSALNANPLKFYKTGIMHLPVA 541

Query: 531 TCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYAT 590
           +C P  L HAVL VGYG ++ +PYW  +NSWG    ++G+F+I RG   CGI ++   A 
Sbjct: 542 SCFPRALNHAVLTVGYGTENGLPYWTVKNSWGTAFGEDGYFRIYRGGGTCGINRLVSTAA 601

Query: 591 I 591
           I
Sbjct: 602 I 602




Source: Clonorchis sinensis

Species: Clonorchis sinensis

Genus: Clonorchis

Family: Opisthorchiidae

Order: Opisthorchiida

Class: Trematoda

Phylum: Platyhelminthes

Superkingdom: Eukaryota

>gi|391333248|ref|XP_003741031.1| PREDICTED: uncharacterized protein LOC100898636 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|357619726|gb|EHJ72185.1| cathepsin [Danaus plexippus] Back     alignment and taxonomy information
>gi|358339355|dbj|GAA47435.1| cathepsin F [Clonorchis sinensis] Back     alignment and taxonomy information
>gi|67773380|gb|AAY81947.1| cysteine protease 9 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|156546466|ref|XP_001607324.1| PREDICTED: hypothetical protein LOC100123649 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|244790097|ref|NP_001156454.1| cathepsin F isoform 2 precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|67773374|gb|AAY81944.1| cysteine protease 6 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|67773370|gb|AAY81942.1| cysteine protease 3 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|242014216|ref|XP_002427787.1| Cathepsin F precursor, putative [Pediculus humanus corporis] gi|212512256|gb|EEB15049.1| Cathepsin F precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1026
WB|WBGene00007055477 tag-196 [Caenorhabditis elegan 0.288 0.620 0.324 1.9e-42
FB|FBgn0260462614 CG12163 [Drosophila melanogast 0.285 0.477 0.337 8.5e-42
UNIPROTKB|F1MHV4375 CTSW "Uncharacterized protein" 0.241 0.661 0.325 1.7e-41
UNIPROTKB|E2RPX3374 CTSW "Uncharacterized protein" 0.251 0.689 0.301 6.4e-41
RGD|1309354371 Ctsw "cathepsin W" [Rattus nor 0.293 0.811 0.299 3.3e-33
ZFIN|ZDB-GENE-030131-9831473 ctsf "cathepsin F" [Danio reri 0.288 0.625 0.3 2.5e-39
UNIPROTKB|F1RU48460 CTSF "Uncharacterized protein" 0.277 0.619 0.324 1.1e-38
UNIPROTKB|E2RR02460 CTSF "Uncharacterized protein" 0.342 0.763 0.297 8.6e-39
UNIPROTKB|G1M0X4337 CTSH "Uncharacterized protein" 0.270 0.824 0.350 8.6e-39
UNIPROTKB|Q3T0I2335 CTSH "Pro-cathepsin H" [Bos ta 0.275 0.844 0.342 1e-37
WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 459 (166.6 bits), Expect = 1.9e-42, P = 1.9e-42
 Identities = 103/317 (32%), Positives = 160/317 (50%)

Query:   288 ILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH-----KKHER----YGTSEFSDRSPE 338
             I  +F  F+ +  ++Y N  E+ +RF  FK++       +K+E+    YG ++FSD +  
Sbjct:   170 IWNSFLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGTAVYGFTKFSDMTTM 229

Query:   339 EIL-CKTGFKWSERTYERIVADRXXXXXXXXXXXXDGPVPDAWDWRKKNVTGPAGDQAAC 397
             E       ++W +  Y    A+             +  +P+++DWR+K       +Q  C
Sbjct:   230 EFKKIMLPYQWEQPVYPMEQAN----FEKHDVTINEEDLPESFDWREKGAVTQVKNQGNC 285

Query:   398 GSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCGGCDGLEQPI--EYTHQAG 455
             GSCWAFS  G +EG + I   KLV  S+ +LV+C     GC G  GL      E     G
Sbjct:   286 GSCWAFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNG--GLPSNAYKEIIRMGG 343

Query:   456 LESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSETMKKILYKYGPLSVGLNSH 515
             LE E  YPY +G GE   C   +  + ++        +    M+K L   GP+S+GLN++
Sbjct:   344 LEPEDAYPY-DGRGET--CHLVRKDIAVYINGSVELPHDEVEMQKWLVTKGPISIGLNAN 400

Query:   516 LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIER 575
              + FY    +      C P+ L H VL+VGYGK    PYW+ +NSWGP   + G+FK+ R
Sbjct:   401 TLQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKDGRKPYWIVKNSWGPNWGEAGYFKLYR 460

Query:   576 GNNACGIEQIAGYATID 592
             G N CG++++A  A ++
Sbjct:   461 GKNVCGVQEMATSALVN 477


GO:0004869 "cysteine-type endopeptidase inhibitor activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHV4 CTSW "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPX3 CTSW "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1309354 Ctsw "cathepsin W" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9831 ctsf "cathepsin F" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G1M0X4 CTSH "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0I2 CTSH "Pro-cathepsin H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.22LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1026
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 6e-67
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-66
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 2e-66
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 4e-66
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 6e-66
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 2e-63
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 1e-48
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 2e-48
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 1e-45
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 7e-40
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 8e-40
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 1e-36
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 2e-36
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 1e-35
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 2e-35
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 2e-35
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 2e-35
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 3e-33
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 7e-33
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 2e-31
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 3e-30
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 5e-30
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 6e-30
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 4e-29
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 2e-28
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 2e-28
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 4e-28
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 7e-21
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 1e-19
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 5e-19
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 3e-18
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 4e-18
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 4e-17
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 4e-17
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 5e-17
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 1e-15
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 3e-12
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 4e-08
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 6e-08
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 6e-08
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 8e-08
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 2e-07
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 3e-07
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 6e-06
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 2e-05
PTZ004621004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 2e-05
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 2e-05
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 2e-05
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 5e-05
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 5e-05
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 5e-05
PTZ004621004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 1e-04
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 4e-04
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 4e-04
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 5e-04
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 0.003
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
 Score =  222 bits (569), Expect = 6e-67
 Identities = 95/215 (44%), Positives = 124/215 (57%), Gaps = 8/215 (3%)

Query: 12  PDAWDWRKKNVTGPAGDQADCGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS 71
           P++ DWR+K    P  DQ  CGSCWAFS  G LEG YAIKTGKLV  S+ QLV+C+   +
Sbjct: 1   PESVDWREKGAVTPVKDQGSCGSCWAFSTVGALEGAYAIKTGKLVSLSEQQLVDCSTSGN 60

Query: 72  -GCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLF-TGKDFLHFNGS 129
            GC+G   + + EY    GL SE DYPY   +G    C Y+ SKV    TG   +     
Sbjct: 61  NGCNGGNPDNAFEYVKNGGLASESDYPYTGKDG---TCKYNSSKVGAKITGYSNVPPGDE 117

Query: 130 ETMKKILYKYGPLSVLLN-SDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPY 188
           E +K  L  YGP+SV ++ S     Y G     +   CS  +L HAVLLVGYG ++ + Y
Sbjct: 118 EALKAALANYGPVSVAIDASSSFQFYKGGIY--SGPCCSNTNLNHAVLLVGYGTENGVDY 175

Query: 189 WLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYA 223
           W+V+NSWG    ++G+ +I RG+N CGI   A Y 
Sbjct: 176 WIVKNSWGTSWGEKGYIRIARGSNLCGIASYASYP 210


Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210

>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1026
KOG1542|consensus372 100.0
KOG1542|consensus372 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
KOG1543|consensus325 100.0
KOG1543|consensus325 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
PTZ004621004 Serine-repeat antigen protein; Provisional 100.0
PTZ00462 1004 Serine-repeat antigen protein; Provisional 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
KOG1544|consensus470 100.0
KOG1544|consensus470 100.0
COG4870372 Cysteine protease [Posttranslational modification, 99.95
COG4870372 Cysteine protease [Posttranslational modification, 99.88
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.76
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.76
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 99.31
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 99.22
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.09
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.05
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 98.71
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 98.68
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 98.25
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 97.7
KOG4128|consensus457 95.3
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 95.25
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 94.15
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 93.52
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 91.9
>KOG1542|consensus Back     alignment and domain information
Probab=100.00  E-value=2.8e-78  Score=638.65  Aligned_cols=291  Identities=41%  Similarity=0.796  Sum_probs=256.9

Q ss_pred             HHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc---------CCCcccccccCCCCCHHHHh-hhcCCCCCccchhhh
Q psy7460         287 NILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH---------KKHERYGTSEFSDRSPEEIL-CKTGFKWSERTYERI  356 (1026)
Q Consensus       287 ~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~---------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~~~~~~~  356 (1026)
                      ...++|..|+.+|+|+|.+.+|..+|+.||+.|+.         .+++.||+|+|||||+|||+ .+++.+........ 
T Consensus        66 ~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~-  144 (372)
T KOG1542|consen   66 GLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPG-  144 (372)
T ss_pred             chHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCcc-
Confidence            34899999999999999999999999999999952         34889999999999999999 66665542111100 


Q ss_pred             hhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCCCccCCHHHHHhhhcCCC
Q psy7460         357 VADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS  436 (1026)
Q Consensus       357 ~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~~~~lS~q~lvdC~~~~~  436 (1026)
                        +...     .+......||++||||++|+||||||||.||||||||+|+++|++++|++|++++|||||||||+..++
T Consensus       145 --~~~~-----~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d~  217 (372)
T KOG1542|consen  145 --DAAE-----APIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCDN  217 (372)
T ss_pred             --cccc-----CcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcCC
Confidence              0000     011345789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCc-hHHHH-HHhCCcCCCCCCcccCCCCCccccccCCCCceeeecceeEecC-CHHHHHHHHHcCCCEEEEEe
Q psy7460         437 GCGGCDGLE-QPIEY-THQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFN-GSETMKKILYKYGPLSVGLN  513 (1026)
Q Consensus       437 gC~G~~G~~-~a~~~-~~~~Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~gPv~v~i~  513 (1026)
                      ||+|  |++ +||+| ++.+||..|.+|||+++++.  .|.+++.+.++ .+.+|..++ +|++|.+.|.++|||+|+|+
T Consensus       218 gC~G--Gl~~nA~~~~~~~gGL~~E~dYPY~g~~~~--~C~~~~~~~~v-~I~~f~~l~~nE~~ia~wLv~~GPi~vgiN  292 (372)
T KOG1542|consen  218 GCNG--GLMDNAFKYIKKAGGLEKEKDYPYTGKKGN--QCHFDKSKIVV-SIKDFSMLSNNEDQIAAWLVTFGPLSVGIN  292 (372)
T ss_pred             cCCC--CChhHHHHHHHHhCCccccccCCccccCCC--ccccchhhceE-EEeccEecCCCHHHHHHHHHhcCCeEEEEc
Confidence            9999  999 99999 68899999999999998874  79999887776 556666655 99999999999999999999


Q ss_pred             cCccccccCCceeCCCCCCCCCCCCeEEEEEEeeecC-CccEEEEEcCCCCCCCCCcEEEEEecCCcccccceeeeeE
Q psy7460         514 SHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQD-DIPYWLARNSWGPIGPDEGFFKIERGNNACGIEQIAGYAT  590 (1026)
Q Consensus       514 ~~~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~~-g~~YWivkNSWG~~WGe~Gy~ri~r~~n~cgi~~~~~~~~  590 (1026)
                      +..+|+|++||+.|....|++..+||||||||||.+. .+||||||||||++|||+||+|+.||.|.|||+++++-+.
T Consensus       293 a~~mQ~YrgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~  370 (372)
T KOG1542|consen  293 AKPMQFYRGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAA  370 (372)
T ss_pred             hHHHHHhcccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhh
Confidence            9899999999998777799998899999999999988 8999999999999999999999999999999999987654



>KOG1542|consensus Back     alignment and domain information
>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4128|consensus Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1026
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 1e-34
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 8e-34
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 4e-13
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 1e-33
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 7e-12
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 1e-33
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 2e-33
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 8e-09
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 3e-33
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 4e-33
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 1e-08
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 6e-33
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 7e-33
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 6e-09
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 9e-33
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 1e-32
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 1e-08
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 1e-32
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 1e-32
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 1e-08
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 1e-32
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 2e-32
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 2e-09
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 3e-32
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 3e-32
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 8e-09
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 6e-32
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 7e-32
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 2e-08
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 7e-32
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 8e-32
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 9e-09
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 3e-31
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 4e-09
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 1e-30
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 1e-30
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 2e-08
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 2e-30
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 2e-30
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 1e-08
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 8e-30
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 9e-30
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 1e-07
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 8e-30
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 1e-29
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 4e-08
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 1e-29
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-29
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-08
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 1e-28
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 6e-28
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 4e-06
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 1e-28
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 6e-28
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 4e-06
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 1e-28
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 7e-28
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 4e-06
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 2e-28
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 6e-28
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 5e-06
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 2e-28
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 7e-28
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 4e-06
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 2e-28
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 7e-28
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 4e-06
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 2e-28
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 1e-27
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 1e-05
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 5e-28
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 3e-27
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 4e-06
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 7e-28
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 4e-27
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 3e-06
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 1e-27
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 4e-27
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 1e-05
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 2e-27
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 7e-27
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 4e-06
3hwn_A258 Cathepsin L With Az13010160 Length = 258 2e-27
3hwn_A258 Cathepsin L With Az13010160 Length = 258 2e-27
3hwn_A258 Cathepsin L With Az13010160 Length = 258 2e-06
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 2e-27
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 7e-27
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 4e-06
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 2e-27
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 7e-27
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 4e-06
3h89_A220 A Combined Crystallographic And Molecular Dynamics 2e-27
3h89_A220 A Combined Crystallographic And Molecular Dynamics 2e-27
3h89_A220 A Combined Crystallographic And Molecular Dynamics 2e-06
3of8_A221 Structural Basis For Reversible And Irreversible In 2e-27
3of8_A221 Structural Basis For Reversible And Irreversible In 3e-27
3of8_A221 Structural Basis For Reversible And Irreversible In 2e-06
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 3e-27
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 3e-27
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 2e-06
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 2e-26
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 2e-26
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 2e-06
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 2e-26
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 2e-26
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 2e-06
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 2e-26
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 2e-26
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 1e-06
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 3e-26
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 3e-26
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 2e-06
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 9e-26
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 1e-25
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 3e-04
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 1e-25
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 1e-25
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 3e-06
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 1e-25
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 1e-25
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 7e-07
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 1e-25
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 2e-25
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 1e-04
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 3e-25
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 4e-25
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 4e-08
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 5e-25
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 5e-25
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 6e-08
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 8e-25
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 9e-25
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 6e-07
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 1e-24
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 9e-09
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 1e-24
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 1e-24
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 7e-08
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 1e-24
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 1e-24
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 7e-08
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 1e-24
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 1e-08
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 1e-24
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 2e-24
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 3e-24
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 4e-05
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 3e-24
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 4e-24
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 2e-05
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 9e-24
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 1e-23
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 5e-07
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 2e-23
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 2e-23
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 3e-23
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 2e-05
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 3e-23
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 3e-23
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 7e-07
1pci_A322 Procaricain Length = 322 4e-23
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 1e-22
2vhs_A217 Cathsilicatein, A Chimera Length = 217 2e-22
2vhs_A217 Cathsilicatein, A Chimera Length = 217 3e-22
2vhs_A217 Cathsilicatein, A Chimera Length = 217 1e-04
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 4e-22
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 7e-22
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 1e-05
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 9e-22
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 7e-21
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 1e-21
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 6e-04
2act_A220 Crystallographic Refinement Of The Structure Of Act 2e-21
2act_A220 Crystallographic Refinement Of The Structure Of Act 5e-21
2act_A220 Crystallographic Refinement Of The Structure Of Act 1e-05
1ppo_A216 Determination Of The Structure Of Papaya Protease O 2e-20
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 2e-20
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 9e-20
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 2e-19
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 2e-19
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 3e-19
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 3e-19
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 3e-19
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 5e-05
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 9e-19
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 9e-19
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 2e-18
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 2e-18
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 3e-18
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 4e-18
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 4e-18
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 7e-18
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 3e-17
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 4e-17
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 4e-17
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 5e-17
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 6e-07
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 6e-17
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 6e-17
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 6e-07
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 6e-17
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 6e-07
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 5e-16
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 5e-16
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 1e-06
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 3e-15
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-09
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-15
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-09
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 5e-15
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 9e-15
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 1e-14
1mir_A322 Rat Procathepsin B Length = 322 4e-14
1mir_A322 Rat Procathepsin B Length = 322 4e-09
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 9e-14
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 1e-13
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 2e-08
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 1e-13
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 1e-13
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 2e-08
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 1e-13
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 2e-08
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 1e-13
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 2e-08
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 1e-12
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 1e-12
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 2e-08
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 2e-12
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 2e-12
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 8e-11
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 3e-08
1k3b_B164 Crystal Structure Of Human Dipeptidyl Peptidase I ( 5e-10
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 9e-10
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 5e-08
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 5e-09
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 5e-09
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 6e-09
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 2e-08
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 2e-08
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 2e-08
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 3e-08
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 3e-08
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 5e-08
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 2e-05
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 4e-05
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 1e-04
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 2e-05
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 4e-05
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 1e-04
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure

Iteration: 1

Score = 145 bits (367), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 77/217 (35%), Positives = 114/217 (52%), Gaps = 3/217 (1%) Query: 376 VPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQC 435 P WDWR K DQ CGSCWAFS+ G +EGQ+ + G L+ S+ +L++C K Sbjct: 1 APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMD 60 Query: 436 SGCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGS 495 C G + GLE+E DY Y+ G C + K K++ Sbjct: 61 KACMGGLPSNAYSAIKNLGGLETEDDYSYQ---GHMQSCQFSAEKAKVYIQDSVELSQNE 117 Query: 496 ETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYW 555 + + L K GP+SV +N+ + FY R CSP+ + HAVLLVGYG++ D+P+W Sbjct: 118 QKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFW 177 Query: 556 LARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATID 592 +NSWG ++G++ + RG+ ACG+ +A A +D Sbjct: 178 AIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD 214
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1026
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 1e-68
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 2e-67
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 3e-59
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 2e-19
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 1e-68
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 5e-68
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 9e-60
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 1e-17
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-68
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-67
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 4e-59
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-18
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 2e-67
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 3e-67
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 4e-67
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 2e-22
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 2e-66
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 5e-66
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 4e-59
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 9e-18
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 2e-66
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 8e-66
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 6e-58
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 2e-17
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 3e-64
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 3e-64
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 1e-63
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 6e-21
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 6e-64
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 2e-62
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 2e-54
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 7e-16
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 5e-63
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 2e-62
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 7e-54
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 1e-14
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 5e-63
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 2e-62
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 9e-55
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 6e-16
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 2e-61
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 3e-61
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 8e-60
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 3e-20
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 8e-60
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 5e-59
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 2e-55
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 2e-19
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 1e-58
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 4e-58
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 6e-58
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 3e-17
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 2e-58
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 3e-58
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 1e-57
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 3e-18
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 1e-57
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 2e-57
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 4e-57
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 1e-18
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 1e-56
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 2e-55
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 5e-55
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 7e-21
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 3e-56
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 1e-54
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 2e-54
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 2e-16
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 6e-56
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 7e-56
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 7e-55
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 5e-16
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 6e-55
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 3e-54
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 4e-54
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 1e-16
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 1e-54
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 3e-54
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 4e-54
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 1e-14
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 2e-54
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 1e-53
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 1e-53
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 5e-14
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 2e-54
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 3e-54
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 3e-53
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 8e-15
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 6e-54
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 7e-54
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 4e-53
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 5e-14
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 2e-53
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 5e-53
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 2e-52
1cqd_A221 Protein (protease II); cysteine protease, glycopro 2e-53
1cqd_A221 Protein (protease II); cysteine protease, glycopro 3e-53
1cqd_A221 Protein (protease II); cysteine protease, glycopro 2e-52
1cqd_A221 Protein (protease II); cysteine protease, glycopro 2e-15
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-53
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-53
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 1e-52
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 7e-15
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 4e-53
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 4e-53
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 3e-52
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 2e-13
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 1e-52
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 1e-52
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 9e-52
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 6e-14
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 4e-52
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 1e-51
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 1e-51
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 3e-14
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 4e-51
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 4e-51
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 5e-51
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 4e-15
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 5e-51
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 6e-51
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 1e-50
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 2e-18
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 1e-50
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 1e-50
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 3e-49
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 4e-10
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 2e-49
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 2e-49
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 8e-49
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 3e-21
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 2e-49
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 2e-49
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 2e-49
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 3e-13
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-49
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 6e-49
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-48
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-20
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 2e-49
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 3e-49
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 4e-49
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 5e-22
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 3e-49
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 4e-49
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 5e-49
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 1e-13
3u8e_A222 Papain-like cysteine protease; papain-like cystein 3e-48
3u8e_A222 Papain-like cysteine protease; papain-like cystein 3e-48
3u8e_A222 Papain-like cysteine protease; papain-like cystein 6e-47
3u8e_A222 Papain-like cysteine protease; papain-like cystein 2e-10
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 2e-46
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 3e-45
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 6e-45
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 3e-12
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 1e-07
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 2e-07
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 4e-06
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 1e-05
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 1e-05
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
 Score =  231 bits (591), Expect = 1e-68
 Identities = 63/320 (19%), Positives = 116/320 (36%), Gaps = 27/320 (8%)

Query: 653 NILETFKAFIVKRGRQYANDEEIKERFEYFKQ-----DGHKKHERYGTSEFSDRSPEEIL 707
           + ++TF+ +     + YA  E+ +   + F +       +        +  SD S +E  
Sbjct: 3   SSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG----AINHLSDLSLDEFK 58

Query: 708 CK-TGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSC 766
            +      +    +     +  +         +G  P   D R+     P   Q  CGS 
Sbjct: 59  NRFLMSAEAFEHLKT----QFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSA 114

Query: 767 WAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKD 826
           WAFS     E  Y     + ++ ++ +LV+CA Q  GC G      IEY    G+  E  
Sbjct: 115 WAFSGVAATESAYLAYRDQSLDLAEQELVDCASQ-HGCHGDTIPRGIEYIQHNGVVQESY 173

Query: 827 YPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYK-YGPLSVLLNSDLIHD- 884
           Y Y         C    ++    +    ++   +  +++ L + +  ++V++    +   
Sbjct: 174 YRYVAREQ---SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAF 230

Query: 885 --YNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGN 942
             Y+G  I             HAV +VGY     + YW+VRNSW     D G+       
Sbjct: 231 RHYDGRTI--IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANI 288

Query: 943 NACGIEQIAGYATIDVVKND 962
           +      I  Y  + ++   
Sbjct: 289 DLMM---IEEYPYVVILGQT 305


>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1026
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.97
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.96
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.29
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.24
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.14
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.1
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 96.98
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 96.73
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 96.66
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 95.68
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 95.41
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 95.14
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
Probab=100.00  E-value=3e-70  Score=612.74  Aligned_cols=297  Identities=30%  Similarity=0.595  Sum_probs=251.8

Q ss_pred             ChhHHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc------------CCCcccccccCCCCCHHHHh-hhcCCCCCc
Q psy7460         284 DNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH------------KKHERYGTSEFSDRSPEEIL-CKTGFKWSE  350 (1026)
Q Consensus       284 ~~~~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~------------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~  350 (1026)
                      .++.+..+|++||++|+|.|.+.+|+.+|++||++|++            ..++++|+|+|+|||.|||+ .+++.+.+.
T Consensus        14 ~~~~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~~~~~~~~   93 (331)
T 3qj3_A           14 PSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEMKAYTHGLIMPA   93 (331)
T ss_dssp             CHHHHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHHHHHHSCCCCCS
T ss_pred             CCHHHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHHHHHhccccccc
Confidence            34567889999999999999999999999999999953            24567899999999999999 677765432


Q ss_pred             cchhhhhhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCC--CccCCHHHH
Q psy7460         351 RTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGK--LVEFSKSQL  428 (1026)
Q Consensus       351 ~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~--~~~lS~q~l  428 (1026)
                      .....   ................+||++||||++|+||||||||.||||||||++++||++++|+++.  ++.||+|+|
T Consensus        94 ~~~~~---~~~~~~~~~~~~~~~~~lP~s~DwR~~g~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~~~LSeQ~L  170 (331)
T 3qj3_A           94 DLHKN---GIPIKTREDLGLNASVRYPASFDWRDQGMVSPVKNQGSCGSSWAFSSTGAIESQMKIANGAGYDSSVSEQQL  170 (331)
T ss_dssp             STTTT---CEEECSGGGGTCCSSCCCCSSEEGGGGTCSCCCCBCCSSCCHHHHHHHHHHHHHHHHHHCTTSCCCBCHHHH
T ss_pred             ccccc---CcccccccccccccccCCCcceecccCCccCCCccCcccchhhHHHHHHHHHHHHHHHhCCCcccCcCHHHH
Confidence            11100   0000000000001234799999999999999999999999999999999999999999999  999999999


Q ss_pred             HhhhcCCCCCCCCCCCc-hHHHHHHhC-CcCCCCCCcccCCCCCccccccCCCCceeeecceeEecC--CHHHHHHHHHc
Q psy7460         429 VECAKQCSGCGGCDGLE-QPIEYTHQA-GLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFN--GSETMKKILYK  504 (1026)
Q Consensus       429 vdC~~~~~gC~G~~G~~-~a~~~~~~~-Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~  504 (1026)
                      +||+..+.||+|  |.+ .|++|+.+. ||++|++|||.+.+.   .|........ +.+.+|..++  ++++||++|++
T Consensus       171 vdC~~~~~GC~G--G~~~~a~~yi~~~~Gi~~e~~yPY~~~~~---~C~~~~~~~~-~~i~~~~~v~~~~e~~lk~al~~  244 (331)
T 3qj3_A          171 VDCVPNALGCSG--GWMNDAFTYVAQNGGIDSEGAYPYEMADG---NCHYDPNQVA-ARLSGYVYLSGPDENMLADMVAT  244 (331)
T ss_dssp             HHHCTTSCGGGC--CCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCTTSEE-ECCSEEEEESSCCHHHHHHHHHH
T ss_pred             hhhccCCCCCCC--CCHHHHHHHHHHcCCcCcccccCccCCCC---CCCCCcccce-eEeeEEEEeCCCCHHHHHHHHHh
Confidence            999987889999  999 999998766 999999999999888   8987765543 4778888775  89999999999


Q ss_pred             CCCEEEEEecC-ccccccCCceeCCCCCCCCCCCCeEEEEEEeeecCCccEEEEEcCCCCCCCCCcEEEEEecC-Ccccc
Q psy7460         505 YGPLSVGLNSH-LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLARNSWGPIGPDEGFFKIERGN-NACGI  582 (1026)
Q Consensus       505 ~gPv~v~i~~~-~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~~g~~YWivkNSWG~~WGe~Gy~ri~r~~-n~cgi  582 (1026)
                      +|||+|+|++. .|++|++|||.  .+.|+...++|||+|||||+++|++|||||||||+.|||+|||||+|+. |.|||
T Consensus       245 ~GPV~v~i~a~~~f~~Y~~Gvy~--~~~c~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~GY~~i~r~~~n~CgI  322 (331)
T 3qj3_A          245 KGPVAVAFDADDPFGSYSGGVYY--NPTCETNKFTHAVLIVGYGNENGQDYWLVKNSWGDGWGLDGYFKIARNANNHCGI  322 (331)
T ss_dssp             HCCEEEEECCCTTGGGEEEEEEC--CTTCCSSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSSSGGGT
T ss_pred             CCCEEEEEEcccccccccCceEe--CCCCCCCcCCEEEEEEEEeccCCceEEEEEcCCCCCcCCCCEEEEEcCCCCccCc
Confidence            99999999995 49999999995  4568777899999999999999999999999999999999999999998 99999


Q ss_pred             cceeeeeEE
Q psy7460         583 EQIAGYATI  591 (1026)
Q Consensus       583 ~~~~~~~~~  591 (1026)
                      ++.++||++
T Consensus       323 ~~~~~~p~v  331 (331)
T 3qj3_A          323 AGVASVPTL  331 (331)
T ss_dssp             TTSCEEEEC
T ss_pred             CCceeeeeC
Confidence            999999974



>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1026
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 9e-49
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 1e-48
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 2e-48
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 9e-17
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 4e-47
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 5e-47
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 1e-46
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 3e-14
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1e-43
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 3e-43
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 6e-34
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 3e-18
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 2e-43
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 2e-43
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 3e-43
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 2e-15
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 6e-43
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 7e-42
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 9e-42
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 3e-14
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 7e-43
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 9e-43
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 6e-35
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 2e-17
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 2e-42
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 3e-42
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 3e-42
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 2e-15
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 1e-41
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 1e-41
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 5e-40
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 1e-11
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 3e-40
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 4e-40
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 8e-39
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 1e-12
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 7e-40
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 7e-40
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 9e-40
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 4e-15
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 1e-39
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 4e-39
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 6e-39
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 5e-11
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 1e-39
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 2e-39
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 5e-38
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 4e-12
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 4e-39
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 6e-39
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 2e-37
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 2e-10
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 5e-39
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 7e-39
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 1e-38
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 4e-12
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 2e-38
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 2e-38
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 1e-37
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 4e-11
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 6e-38
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 9e-38
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 8e-37
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 2e-37
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 2e-37
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-36
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 7e-11
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 7e-37
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 1e-36
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 2e-35
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 2e-09
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 1e-36
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 1e-36
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 4e-36
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 2e-11
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 4e-35
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 5e-34
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 5e-34
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 7e-13
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 7e-05
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 7e-05
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 1e-04
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 0.001
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 4e-04
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 7e-04
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 7e-04
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Cathepsin F
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  170 bits (431), Expect = 9e-49
 Identities = 77/216 (35%), Positives = 113/216 (52%), Gaps = 3/216 (1%)

Query: 377 PDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECAKQCS 436
           P  WDWR K       DQ  CGSCWAFS+ G +EGQ+ +  G L+  S+ +L++C K   
Sbjct: 2   PPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDK 61

Query: 437 GCGGCDGLEQPIEYTHQAGLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLYFNGSE 496
            C G           +  GLE+E DY Y    G    C +   K K++           +
Sbjct: 62  ACMGGLPSNAYSAIKNLGGLETEDDYSY---QGHMQSCQFSAEKAKVYIQDSVELSQNEQ 118

Query: 497 TMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWL 556
            +   L K GP+SV +N+  + FY     R     CSP+ + HAVLLVGYG++ D+P+W 
Sbjct: 119 KLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWA 178

Query: 557 ARNSWGPIGPDEGFFKIERGNNACGIEQIAGYATID 592
            +NSWG    ++G++ + RG+ ACG+  +A  A +D
Sbjct: 179 IKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD 214


>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1026
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.47
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.43
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.31
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.22
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 95.74
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 94.96
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 90.81
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 89.79
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.7e-65  Score=568.57  Aligned_cols=286  Identities=31%  Similarity=0.600  Sum_probs=237.0

Q ss_pred             hHHHHHHHHHHHHhCCCCCChHHHHHHHHHHHhccc------------CCCcccccccCCCCCHHHHh-hhcCCCCCccc
Q psy7460         286 ENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH------------KKHERYGTSEFSDRSPEEIL-CKTGFKWSERT  352 (1026)
Q Consensus       286 ~~~~~~f~~f~~~~~k~Y~~~~E~~~R~~~F~~n~~------------~~~~~~g~n~fsD~t~eEf~-~~~~~~~~~~~  352 (1026)
                      +.++.+|++||++|+|.|.+ +|+.+|++||++|++            ..++++|+|+|||||.|||+ .+++.+.....
T Consensus         6 ~~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~   84 (316)
T d1cs8a_           6 HSLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPR   84 (316)
T ss_dssp             GGGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCS
T ss_pred             HHHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccccc
Confidence            45678899999999999977 467899999999953            23678899999999999999 55554332211


Q ss_pred             hhhhhhhhHHHHHhhhcccCCCCCCCceeccCCCCCCCCCCCCCCcchHHHHhHHHHHHHHHHHcCCCccCCHHHHHhhh
Q psy7460         353 YERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGMLEGQYAIKTGKLVEFSKSQLVECA  432 (1026)
Q Consensus       353 ~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~vt~vk~Qg~CgSCwAfa~~~~~e~~~~i~~~~~~~lS~q~lvdC~  432 (1026)
                      ...           ........+||++||||++|+|+||||||.||||||||+++++|++++|+++.++.||+|+|+||+
T Consensus        85 ~~~-----------~~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~  153 (316)
T d1cs8a_          85 KGK-----------VFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCS  153 (316)
T ss_dssp             CCE-----------ECCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHC
T ss_pred             cCc-----------cccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhcc
Confidence            110           011133568999999999999999999999999999999999999999999999999999999998


Q ss_pred             cC--CCCCCCCCCCc-hHHHHHHhC-CcCCCCCCcccCCCCCccccccCCCCceeeecceeEe-cCCHHHHHHHHHcCCC
Q psy7460         433 KQ--CSGCGGCDGLE-QPIEYTHQA-GLESEKDYPYRNGNGEKFKCAYDKSKVKLFTGKDFLY-FNGSETMKKILYKYGP  507 (1026)
Q Consensus       433 ~~--~~gC~G~~G~~-~a~~~~~~~-Gi~~e~~ypY~~~~~~~~~C~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~gP  507 (1026)
                      ..  +.||.|  |.+ .|++|+... +++.|.+|||.+...   .|......... .+..+.. ..+++.|+++|+++||
T Consensus       154 ~~~~~~~c~g--g~~~~a~~y~~~~g~~~~e~~~~~~~~~~---~~~~~~~~~~~-~~~~~~~~~~~~~~l~~~l~~~gp  227 (316)
T d1cs8a_         154 GPQGNEGCNG--GLMDYAFQYVQDNGGLDSEESYPYEATEE---SCKYNPKYSVA-NDAGFVDIPKQEKALMKAVATVGP  227 (316)
T ss_dssp             GGGTCCGGGC--BCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCGGGEEE-CCCCEEECCSCHHHHHHHHHHHCC
T ss_pred             ccccCCCCCC--CchHHHHHHHHhcCccccccccccccccc---ccccccccccc-cccccccccCcHHHHHHHHHHhCC
Confidence            64  567777  888 999998665 478899999998777   66655444333 4444444 4589999999999999


Q ss_pred             EEEEEecC--ccccccCCceeCCCCCCCCCCCCeEEEEEEeeec----CCccEEEEEcCCCCCCCCCcEEEEEecC-Ccc
Q psy7460         508 LSVGLNSH--LIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQ----DDIPYWLARNSWGPIGPDEGFFKIERGN-NAC  580 (1026)
Q Consensus       508 v~v~i~~~--~~~~y~~Gi~~~~~~~c~~~~~~HaV~iVGyG~~----~g~~YWivkNSWG~~WGe~Gy~ri~r~~-n~c  580 (1026)
                      |+|+|++.  .|++|++|||.  .+.|+...+||||+|||||.+    ++++|||||||||++|||+|||||+|+. |.|
T Consensus       228 v~v~i~~~~~~f~~y~~Gi~~--~~~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~C  305 (316)
T d1cs8a_         228 ISVAIDAGHESFLFYKEGIYF--EPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHC  305 (316)
T ss_dssp             EEEEECCCSHHHHTEEEEEEC--CTTCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGG
T ss_pred             eEEEEEeccchhccccCCccc--CCCCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcC
Confidence            99999984  58999999995  567887788999999999965    6899999999999999999999999985 899


Q ss_pred             cccceeeeeEE
Q psy7460         581 GIEQIAGYATI  591 (1026)
Q Consensus       581 gi~~~~~~~~~  591 (1026)
                      ||++.++||++
T Consensus       306 GI~~~~~yP~v  316 (316)
T d1cs8a_         306 GIASAASYPTV  316 (316)
T ss_dssp             GTTTSCEEECC
T ss_pred             ccCCeeeeeeC
Confidence            99999999974



>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure