Psyllid ID: psy7466


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MAFEHRCRSSRQISRSELICVRKEGEEKEEERVETQLFQRRTRQRGVTEPETITGKRKRSLDDSQEEVIVKKDGRGRPKGSLNKVKREVVESPSPKREIDAPIVKRKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKPNTNILTVTPNRRSARNDSTKATVKTETEVKVKIEPVADIPIKKENVVETVQ
cccccccccccccccHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccc
ccHHHcccccEEEcccEEEEEEcccccccHccccHHHHHHHHHHccccccHHHcccccccccccccEEEEEEccccccccccccccccccccccccccccccHHHccccccEEEEEccccccEccccHHHHHHHHccccccEEccccccEEccccHHHHHccccccccccccccccccHHHHHHHHHcccccccEccccccEcccccHHHHHHHHHHccccccccEcccccccEcccHHHHEEEcccccccEcccccccEcccHHHHHHHHHccccccccccccccccccEEEEcccccccccccEEEEEEEccEEEEcccccccccccccHHHHHcc
mafehrcrssrqiSRSELICVRKEGEEKEEERVETQLFQRrtrqrgvtepetitgkrkrslddsqeevivkkdgrgrpkgslnkvkrevvespspkreidapivkrkKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFtqsgrssfkcAICFEYFSLLESLETHITRrhigiceepyqcsqcslcfdqgsllkahvlekhevfqctqcekyyrsqstldvhvskkhpagtgkvkrdikpntniltvtpnrrsarndstkatvktETEVKvkiepvadipikkeNVVETVQ
mafehrcrssrqisrselicvrkegeekeeervetqlfqrrtrqrgvtepetitgkrkrslddsqeevivkkdgrgrpkgslnkvkrevvespspkreidapivkrkkkdEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYrsqstldvhvskkhpagtgkvkrdikpntniltvtpnrrsarndstkatvktetevkvkiepvadipikkenvvetvq
MAFEHRCRSSRQISRSELICvrkegeekeeerveTQLFQRRTRQRGVTEPETITGKRKRSLDDSQEEVIVKKDGRGRPKGSLNKVKREVVESPSPKREIDAPIVKRKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKPNTNILTVTPNRRSARNDStkatvktetevkvkiepvADIPIKKENVVETVQ
*****************************************************************************************************************************************QGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVH*********************************************************************
*********************************************************************************************************RKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKP***********************************VADIPIKKE*******
*************SRSELICVRK******************************************EEVIVKKDGRGRPKGSLNKV***********REIDAPIVKRKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKPNTNILTVTPN***************ETEVKVKIEPVADIPIKKENVVETVQ
**F*HRCRSSRQISRSELICVRKEGEEKEEERVETQLFQRRTRQR*******************QEEVIVKKDGR**********************EIDAPIVKRKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKV*R****NTNILTVTPNRRSARNDSTKATVKTETEVKVKIEPVADIPIKKENVV*TVQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFEHRCRSSRQISRSELICVRKEGEEKEEERVETQLFQRRTRQRGVTEPETITGKRKRSLDDSQEEVIVKKDGRGRPKGSLNKVKREVVESPSPKREIDAPIVKRKKKDEILLxxxxxxxxxxxxxxxxxxxxxISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKPNTNILTVTPNRRSARNDSTKATVKTETEVKVKIEPVADIPIKKENVVETVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
Q60636856 PR domain zinc finger pro yes N/A 0.505 0.199 0.282 2e-10
Q3ZCX4644 Zinc finger protein 568 O yes N/A 0.366 0.192 0.328 2e-10
O75626825 PR domain zinc finger pro no N/A 0.467 0.191 0.280 1e-09
Q1H9T6 681 Zinc finger and BTB domai no N/A 0.426 0.211 0.314 5e-09
Q80X44 710 Zinc finger and BTB domai no N/A 0.526 0.250 0.259 7e-09
Q9UL36 1845 Zinc finger protein 236 O no N/A 0.352 0.064 0.272 1e-08
P10074 688 Zinc finger and BTB domai no N/A 0.426 0.209 0.308 2e-08
Q96BR6464 Zinc finger protein 669 O no N/A 0.369 0.269 0.314 2e-08
Q5R633 688 Zinc finger and BTB domai no N/A 0.426 0.209 0.308 2e-08
Q5JNZ3666 Zinc finger protein 311 O no N/A 0.366 0.186 0.331 2e-08
>sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 92/209 (44%), Gaps = 38/209 (18%)

Query: 84  KVKREVVESPSPKREIDAPIVKRKKKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQ 143
           K    V+ +PS    ++  ++K K+      M       + + ++N K        ++Y+
Sbjct: 563 KATSSVMAAPSTDGAMN--LIKNKRN-----MTGYKTLPYPLKKQNGK--------IKYE 607

Query: 144 CSVCSQVFIEKKNLSKHF--------FKCLM---KFTQKKKNLSKHFFKCLMKFTQSGRS 192
           C+VC++ F +  NL  H         FKC      FTQ   +L KH+         +G  
Sbjct: 608 CNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLA-HLQKHYL------VHTGEK 660

Query: 193 SFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAH--VLEKHEV 250
             +C +C + FS   +L+TH+ R H G  E+PYQC  C   F Q   LK H  +  +   
Sbjct: 661 PHECQVCHKRFSSTSNLKTHL-RLHSG--EKPYQCKVCPAKFTQFVHLKLHKRLHTRERP 717

Query: 251 FQCTQCEKYYRSQSTLDVHVSKKHPAGTG 279
            +C QC K Y    +L VH+    PAG  
Sbjct: 718 HKCAQCHKSYIHLCSLKVHLKGNCPAGPA 746




Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells.
Mus musculus (taxid: 10090)
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 Back     alignment and function description
>sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 Back     alignment and function description
>sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 Back     alignment and function description
>sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 Back     alignment and function description
>sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 Back     alignment and function description
>sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 Back     alignment and function description
>sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 Back     alignment and function description
>sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
195168036 464 GL17891 [Drosophila persimilis] gi|19410 0.346 0.252 0.342 9e-10
380012665 868 PREDICTED: uncharacterized protein LOC10 0.523 0.203 0.235 2e-09
390349885 483 PREDICTED: zinc finger protein 845-like 0.461 0.322 0.338 4e-09
125859109 882 Prdm1 protein [Mus musculus] 0.5 0.191 0.285 4e-09
449486830 1265 PREDICTED: taste receptor type 1 member 0.431 0.115 0.329 5e-09
383864306 1048 PREDICTED: zinc finger protein 850-like 0.390 0.125 0.254 5e-09
328788084 828 PREDICTED: hypothetical protein LOC10057 0.523 0.213 0.231 5e-09
350420867 879 PREDICTED: zinc finger protein 408-like 0.446 0.171 0.251 6e-09
338710060 1090 PREDICTED: zinc finger protein 850 [Equu 0.375 0.116 0.337 6e-09
397560783 823 PR domain containing 1 with ZNF domain [ 0.5 0.205 0.285 8e-09
>gi|195168036|ref|XP_002024838.1| GL17891 [Drosophila persimilis] gi|194108268|gb|EDW30311.1| GL17891 [Drosophila persimilis] Back     alignment and taxonomy information
 Score = 70.9 bits (172), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 67/140 (47%), Gaps = 23/140 (16%)

Query: 142 YQCSVCSQVFIEKKNLSKHF-----------FKCLMKFTQKKKNLSKHFFKCLMKFTQSG 190
           YQCS CS+ F +K NL  H             +C   F Q+  NL+ H        T +G
Sbjct: 263 YQCSQCSKAFAQKSNLDIHMRNHTGERPYQCTQCSKAFVQQA-NLTAHMC------THTG 315

Query: 191 RSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEK--H 248
              ++C+ C + F+    L+ H+ R H G  E PYQCSQCS  F Q + LKAH+      
Sbjct: 316 ERPYQCSQCSKAFAQRSHLDIHM-RNHTG--ERPYQCSQCSKAFAQQANLKAHICRHTGE 372

Query: 249 EVFQCTQCEKYYRSQSTLDV 268
             F+C  C + Y ++  L V
Sbjct: 373 RPFKCPHCPRDYTNKGHLYV 392




Source: Drosophila persimilis

Species: Drosophila persimilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380012665|ref|XP_003690398.1| PREDICTED: uncharacterized protein LOC100864932 [Apis florea] Back     alignment and taxonomy information
>gi|390349885|ref|XP_003727303.1| PREDICTED: zinc finger protein 845-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|125859109|gb|AAI29802.1| Prdm1 protein [Mus musculus] Back     alignment and taxonomy information
>gi|449486830|ref|XP_004174322.1| PREDICTED: taste receptor type 1 member 1-like [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|383864306|ref|XP_003707620.1| PREDICTED: zinc finger protein 850-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328788084|ref|XP_003251061.1| PREDICTED: hypothetical protein LOC100578529 [Apis mellifera] Back     alignment and taxonomy information
>gi|350420867|ref|XP_003492653.1| PREDICTED: zinc finger protein 408-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|338710060|ref|XP_001494044.3| PREDICTED: zinc finger protein 850 [Equus caballus] Back     alignment and taxonomy information
>gi|397560783|gb|AFO54706.1| PR domain containing 1 with ZNF domain [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
ZFIN|ZDB-GENE-060503-59208 si:dkey-20i20.8 "si:dkey-20i20 0.517 0.841 0.303 8.8e-14
ZFIN|ZDB-GENE-110914-154213 si:ch211-161m3.2 "si:ch211-161 0.568 0.901 0.263 1.5e-13
ZFIN|ZDB-GENE-060503-152224 si:dkey-20i20.9 "si:dkey-20i20 0.508 0.767 0.283 1.9e-13
UNIPROTKB|Q1LZC0225 ZNF22 "Zinc finger protein 22" 0.494 0.742 0.288 2.7e-12
UNIPROTKB|F1RKP8646 ZNF568 "Uncharacterized protei 0.402 0.210 0.317 3.6e-12
UNIPROTKB|Q3ZCX4644 ZNF568 "Zinc finger protein 56 0.372 0.195 0.32 8.9e-12
UNIPROTKB|E1BKB3606 ZNF568 "Uncharacterized protei 0.405 0.226 0.312 1.4e-11
ZFIN|ZDB-GENE-110913-147209 si:dkey-47k16.3 "si:dkey-47k16 0.420 0.679 0.324 1.7e-11
ZFIN|ZDB-GENE-080305-4317 zgc:174649 "zgc:174649" [Danio 0.431 0.460 0.286 2.6e-11
FB|FBgn0031610346 CG15436 [Drosophila melanogast 0.390 0.381 0.305 2.7e-11
ZFIN|ZDB-GENE-060503-59 si:dkey-20i20.8 "si:dkey-20i20.8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 181 (68.8 bits), Expect = 8.8e-14, P = 8.8e-14
 Identities = 62/204 (30%), Positives = 96/204 (47%)

Query:    77 RPKGSLNKVK-REVVESPSPKREIDAPIVKRKKKDEILLMKALDEEMFKMDEENN--KEM 133
             RP G     K  E +  P P R      +K+++ +E++ +K ++ E+   DEE +  K  
Sbjct:    28 RPSGRREICKDSEKMSDPEPCR------IKQEETEELIDVK-VESEVLNEDEEKHQVKSK 80

Query:   134 ERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLS-KHFFKCLMKFTQSGRS 192
             E+I    E   SV           + + F C    TQ  K LS K  F   M+   +G  
Sbjct:    81 EKIQSETEDSISV--------NGTAVNSFTC----TQCGKTLSCKSTFIKHMRI-HTGEK 127

Query:   193 SFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHV-LEKHEV- 250
              ++C+ C + FSL ++L++H  R H G  E+PY+CS C   F    +LK HV +   E  
Sbjct:   128 PYQCSHCDKRFSLSQNLKSH-ERTHTG--EKPYKCSHCDKRFSHSGVLKTHVRIHTGEKP 184

Query:   251 FQCTQCEKYYRSQSTLDVHVSKKH 274
             + CT C K +   S+L +H    H
Sbjct:   185 YHCTDCGKSFTCSSSLRLHTKNYH 208




GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110914-154 si:ch211-161m3.2 "si:ch211-161m3.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-152 si:dkey-20i20.9 "si:dkey-20i20.9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZC0 ZNF22 "Zinc finger protein 22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKP8 ZNF568 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCX4 ZNF568 "Zinc finger protein 568" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKB3 ZNF568 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-147 si:dkey-47k16.3 "si:dkey-47k16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080305-4 zgc:174649 "zgc:174649" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031610 CG15436 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
KOG2462|consensus279 99.94
KOG1074|consensus958 99.93
KOG2462|consensus279 99.93
KOG3608|consensus467 99.87
KOG3608|consensus467 99.8
KOG3623|consensus 1007 99.79
KOG1074|consensus958 99.73
KOG3576|consensus267 99.68
KOG3576|consensus267 99.68
KOG3623|consensus 1007 99.57
PLN03086567 PRLI-interacting factor K; Provisional 99.28
PLN03086567 PRLI-interacting factor K; Provisional 99.23
PHA00733128 hypothetical protein 99.13
KOG3993|consensus500 99.09
PHA00733128 hypothetical protein 99.05
PHA0276855 hypothetical protein; Provisional 98.78
PHA0276855 hypothetical protein; Provisional 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.49
KOG3993|consensus500 98.48
PHA0073279 hypothetical protein 98.38
PHA0073279 hypothetical protein 98.34
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.3
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.25
PHA0061644 hypothetical protein 98.2
PHA0061644 hypothetical protein 98.0
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.0
COG5189423 SFP1 Putative transcriptional repressor regulating 97.91
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.75
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.7
COG5189423 SFP1 Putative transcriptional repressor regulating 97.66
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.53
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.4
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.28
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.22
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.14
KOG1146|consensus 1406 97.12
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.0
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.78
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.65
KOG2231|consensus 669 96.61
KOG2482|consensus423 96.6
smart0035526 ZnF_C2H2 zinc finger. 96.44
KOG1146|consensus 1406 96.32
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.31
KOG4173|consensus253 96.2
KOG2231|consensus 669 96.15
smart0035526 ZnF_C2H2 zinc finger. 96.06
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.9
PRK04860160 hypothetical protein; Provisional 95.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.67
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.66
KOG2785|consensus 390 95.6
PRK04860160 hypothetical protein; Provisional 95.46
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.37
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.27
KOG4173|consensus253 95.2
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.19
COG5048467 FOG: Zn-finger [General function prediction only] 94.89
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.5
COG5048467 FOG: Zn-finger [General function prediction only] 94.39
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.27
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.23
KOG2482|consensus423 94.19
KOG2893|consensus 341 94.15
KOG2785|consensus 390 94.01
KOG2893|consensus 341 93.12
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.81
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.49
COG404965 Uncharacterized protein containing archaeal-type C 92.03
KOG4167|consensus907 91.87
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.7
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.72
COG404965 Uncharacterized protein containing archaeal-type C 90.03
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.56
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.38
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.15
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 86.03
KOG2186|consensus276 85.18
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 84.98
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.86
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 84.61
KOG2272|consensus332 84.57
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.19
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.85
smart00531147 TFIIE Transcription initiation factor IIE. 83.82
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.18
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 82.87
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 82.43
KOG2186|consensus 276 81.2
PF1371937 zinc_ribbon_5: zinc-ribbon domain 81.1
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=3.6e-28  Score=203.43  Aligned_cols=137  Identities=25%  Similarity=0.490  Sum_probs=125.0

Q ss_pred             CCCccccccccccccChhhHHHHHHHhhhhhhhhhhchhhhhhhhhcccccCCCcceeccccccccCChHHHHHHHhhhc
Q psy7466         138 QGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRH  217 (338)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~f~~~~~~l~~h~~~c~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H  217 (338)
                      ....|+|+.||+.+.+.++|-+|.++|                     +.-...+.+.|.+||+.|.+..+|.+|+ +.|
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H---------------------~~~~s~ka~~C~~C~K~YvSmpALkMHi-rTH  184 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTH---------------------RSLDSKKAFSCKYCGKVYVSMPALKMHI-RTH  184 (279)
T ss_pred             cCCceeccccccccccccccchhhccc---------------------ccccccccccCCCCCceeeehHHHhhHh-hcc
Confidence            344689999999999999999998665                     2223457799999999999999999999 999


Q ss_pred             cCCCCCceecCcCcccccChhHHHHHHHc--CCCceecccccccccChhhHHHHhhccCCCCCCccccCCCCCCCCCCCC
Q psy7466         218 IGICEEPYQCSQCSLCFDQGSLLKAHVLE--KHEVFQCTQCEKYYRSQSTLDVHVSKKHPAGTGKVKRDIKPNTNILTVT  295 (338)
Q Consensus       218 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~--~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~C~~C~~~f~~~~~  295 (338)
                      .-    +++|.+||+.|...+.|+.|+++  |+|||.|+.|++.|..+++|+.| +.+| .+.++|+|..|+++|.....
T Consensus       185 ~l----~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAH-mQTH-S~~K~~qC~~C~KsFsl~Sy  258 (279)
T KOG2462|consen  185 TL----PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAH-MQTH-SDVKKHQCPRCGKSFALKSY  258 (279)
T ss_pred             CC----CcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHH-HHhh-cCCccccCcchhhHHHHHHH
Confidence            64    89999999999999999999998  99999999999999999999999 8999 99999999999999999999


Q ss_pred             ccccccc
Q psy7466         296 PNRRSAR  302 (338)
Q Consensus       296 l~~H~~~  302 (338)
                      |.+|...
T Consensus       259 LnKH~ES  265 (279)
T KOG2462|consen  259 LNKHSES  265 (279)
T ss_pred             HHHhhhh
Confidence            9999764



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-07
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 26/153 (16%) Query: 132 EMERISQGLE-YQCSVCSQVFIEKKNLSKH--------FFKC--LMKFTQKKKNLSKHFF 180 E +R G + Y+C C + F +KK+L++H +KC K ++ NL H Sbjct: 39 EHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAH-- 96 Query: 181 KCLMKFTQSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLL 240 + T +G + C C + FS L L H R H G E+PY+C +C F + L Sbjct: 97 ----QRTHTGEKPYACPECGKSFSQLAHLRAH-QRTHTG--EKPYKCPECGKSFSREDNL 149 Query: 241 ----KAHVLEKHEVFQCTQCEKYYRSQSTLDVH 269 + H EK ++C +C K + + L+VH Sbjct: 150 HTHQRTHTGEK--PYKCPECGKSFSRRDALNVH 180
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-06
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 8e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 55.2 bits (134), Expect = 3e-10
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 208 SLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVL----EKHEVFQCTQCEKYYRSQ 263
           S  +   R H G  E+PY+C  C   F Q   +K H+L    E    F C  C+     +
Sbjct: 2   SSGSSG-RTHSG--EKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK 58

Query: 264 STLDVHVSKKH 274
           S L VH+ K+H
Sbjct: 59  SDLGVHLRKQH 69


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.84
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.69
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.61
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.57
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.55
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.5
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.47
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.45
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.44
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.43
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.43
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.42
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.39
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.39
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.37
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.35
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.35
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.35
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.32
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.32
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.31
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.31
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.3
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.24
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.23
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.2
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.19
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.11
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.1
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.03
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.01
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.01
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.0
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.99
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.96
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.94
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.94
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.93
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.93
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.92
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.91
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.91
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.9
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.9
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.88
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.86
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.83
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.82
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.8
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.8
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.78
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.77
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.77
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.77
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.77
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.77
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.76
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.74
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.73
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.73
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.7
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.69
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.69
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.69
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.67
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.67
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.67
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.66
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.65
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.65
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.6
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.57
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.57
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.54
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.54
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.52
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.52
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.51
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.5
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.5
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.47
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.47
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.44
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.4
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.4
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.38
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.34
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.29
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.29
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.28
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.27
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.19
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.19
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.15
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.08
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.07
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.04
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.01
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.96
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.88
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.87
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.85
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.84
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.82
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.81
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.81
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.81
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.81
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.8
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.8
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.8
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.8
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.8
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.79
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.79
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.79
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.78
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.77
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.95
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.73
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.72
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.72
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.72
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.88
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.69
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.69
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.68
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.83
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.66
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.82
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.64
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.64
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.62
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.61
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.59
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.73
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.57
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.56
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.36
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.31
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.3
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.24
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.53
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.51
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.14
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.99
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.83
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.89
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.56
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.34
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 89.94
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 87.17
2k5c_A95 Uncharacterized protein PF0385; structural genomic 86.47
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.56
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.97
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.33
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 82.3
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.14
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.7e-35  Score=247.84  Aligned_cols=171  Identities=25%  Similarity=0.444  Sum_probs=142.6

Q ss_pred             ccccccccchhhHhhhcChHHHHHHHHHhcCCCccccccccccccChhhHHHHHHHhhhhhhhhhhchhhhhhhhhcccc
Q psy7466         108 KKDEILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKCLMKFTQKKKNLSKHFFKCLMKFT  187 (338)
Q Consensus       108 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~f~~~~~~l~~h~~~c~~~~~  187 (338)
                      ..++++|.|+.|++.|.+...|..|++.|.+.++|.|+.|++.|.+...|..|+                        ..
T Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~------------------------~~   71 (190)
T 2i13_A           16 EPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQ------------------------RT   71 (190)
T ss_dssp             ---------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHH------------------------HH
T ss_pred             cCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHH------------------------Hh
Confidence            445788999999999999999999999999999999999999999999999998                        55


Q ss_pred             cCCCcceeccccccccCChHHHHHHHhhhccCCCCCceecCcCcccccChhHHHHHHHc--CCCceecccccccccChhh
Q psy7466         188 QSGRSSFKCAICFEYFSLLESLETHITRRHIGICEEPYQCSQCSLCFDQGSLLKAHVLE--KHEVFQCTQCEKYYRSQST  265 (338)
Q Consensus       188 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~C~~C~~~f~~~~~l~~H~~~--~~~~~~C~~C~k~f~~~~~  265 (338)
                      |.+.++|.|++|++.|.+...|..|+ ..|.+  +++|.|+.|++.|.+...|..|+++  +.++|.|++|++.|.+...
T Consensus        72 h~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~--~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  148 (190)
T 2i13_A           72 HTGEKPYKCPECGKSFSQRANLRAHQ-RTHTG--EKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDN  148 (190)
T ss_dssp             HHCCCCEECTTTCCEESCHHHHHHHH-HHHHT--CCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHH
T ss_pred             cCCCCCccCcccCCccCCHHHHHHHH-HhcCC--CCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHH
Confidence            67788999999999999999999999 88888  8999999999999999999999987  7899999999999999999


Q ss_pred             HHHHhhccCCCCCCccccCCCCCCCCCCCCcccccccCCCCC
Q psy7466         266 LDVHVSKKHPAGTGKVKRDIKPNTNILTVTPNRRSARNDSTK  307 (338)
Q Consensus       266 L~~H~~~~H~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  307 (338)
                      |..| ++.| .++++|.|++|++.|.+...|..|++.|++..
T Consensus       149 L~~H-~~~H-~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          149 LHTH-QRTH-TGEKPYKCPECGKSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             HHHH-HHHH-HCCCCEECTTTCCEESSHHHHHHHHTTC----
T ss_pred             HHHH-HHhc-CCCCCeECCCCCCccCCHHHHHHHHHhcCCCC
Confidence            9999 7788 89999999999999999999999999987653



>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 33.8 bits (78), Expect = 0.001
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 215 RRHIGICEEPYQCSQCSLCFDQGSLLKAHVLEKH 248
           R H G  E+PY+C  C   F Q   +K H+L+KH
Sbjct: 1   RTHSG--EKPYECYICHARFTQSGTMKMHILQKH 32


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.5
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.87
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.84
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.8
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.79
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.77
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.74
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.74
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.73
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.72
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.71
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.71
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.71
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.6
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.6
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.58
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.54
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.52
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.51
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.41
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.37
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.34
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.29
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.28
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.27
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.22
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.2
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.1
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.05
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.05
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.98
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.92
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.91
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.88
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.88
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.82
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.63
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.52
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.4
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.37
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.3
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.24
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.15
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.12
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.08
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.05
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.93
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.89
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.87
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.85
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.82
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.8
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.73
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.69
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.68
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.66
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.65
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.62
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.54
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.5
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.41
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.31
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.29
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.25
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.07
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.98
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.91
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.68
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.56
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.55
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.45
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.39
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.35
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.26
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.06
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.17
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.12
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.1
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.95
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.77
d1y0jb136 U-shaped transcription factor, different fingers { 93.29
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.18
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.71
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.3
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.04
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.71
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.3
d1y0jb136 U-shaped transcription factor, different fingers { 89.84
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.77
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.4
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.17
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.11
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.7
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.46
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.41
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.2
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.54
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.07
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.53
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.26
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.17
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.72
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.93
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 83.87
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 82.71
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.22
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 80.98
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.32
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.50  E-value=3.2e-15  Score=95.19  Aligned_cols=53  Identities=21%  Similarity=0.276  Sum_probs=50.1

Q ss_pred             cccccchhhHhhhcChHHHHHHHHHhcCCCccccccccccccChhhHHHHHHHh
Q psy7466         111 EILLMKALDEEMFKMDEENNKEMERISQGLEYQCSVCSQVFIEKKNLSKHFFKC  164 (338)
Q Consensus       111 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  164 (338)
                      +++|.|. ||+.|.....|..|+++|++++||.|.+||+.|...+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4789995 9999999999999999999999999999999999999999999654



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure